WO2021107082A1 - Agent thérapeutique contre la péritonite carcinomateuse - Google Patents

Agent thérapeutique contre la péritonite carcinomateuse Download PDF

Info

Publication number
WO2021107082A1
WO2021107082A1 PCT/JP2020/044185 JP2020044185W WO2021107082A1 WO 2021107082 A1 WO2021107082 A1 WO 2021107082A1 JP 2020044185 W JP2020044185 W JP 2020044185W WO 2021107082 A1 WO2021107082 A1 WO 2021107082A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
therapeutic agent
cancer
cancerous peritonitis
tfr
Prior art date
Application number
PCT/JP2020/044185
Other languages
English (en)
Japanese (ja)
Inventor
富美子 野村
正 松浦
黎臨 張
洋一 藍川
浅尾　高行
武彦 横堀
Original Assignee
株式会社ペルセウスプロテオミクス
国立大学法人群馬大学
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 株式会社ペルセウスプロテオミクス, 国立大学法人群馬大学 filed Critical 株式会社ペルセウスプロテオミクス
Priority to CN202080082359.1A priority Critical patent/CN114786718A/zh
Priority to EP20892360.7A priority patent/EP4066858A4/fr
Priority to US17/780,758 priority patent/US20230250180A1/en
Priority to JP2021561536A priority patent/JPWO2021107082A1/ja
Publication of WO2021107082A1 publication Critical patent/WO2021107082A1/fr

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/04—Antineoplastic agents specific for metastasis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2881—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD71
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to a therapeutic agent for cancerous peritonitis containing an anti-transferrin receptor antibody.
  • TfR transferrin receptor
  • TfR transferrin receptor
  • Cancerous peritonitis is a condition in which cancer has spread to the peritoneum. Cancerous peritonitis can be complicated in all cancer types, but the complication rate is high in intra-abdominal gastrointestinal cancer (stomach cancer, pancreatic cancer, colon cancer, etc.) and ovarian cancer.
  • Cancer cells with peritoneal metastasis are known to be special cells that have acquired viability in hypoxic conditions. Cancer cells with peritoneal metastasis are expected to acquire resistance to anticancer drugs targeting the normal cell proliferation mechanism. From many clinical experiences and the results of clinical trials, it has become clear that the usual intraperitoneal administration of anticancer drugs is ineffective in the treatment of cancerous peritonitis.
  • Examples of the therapeutic method for cancerous peritonitis include immunotherapy, hyperthermia, and the like in addition to chemotherapy, but the therapeutic effect is not sufficient and the prognosis is poor, and a new therapeutic method is desired.
  • the present invention has made it a problem to be solved to provide a therapeutic agent for cancerous peritonitis.
  • cancerous peritonitis can be treated by administering an antibody that recognizes an amino acid sequence at a predetermined position in TfR to a model mouse of cancerous peritonitis.
  • the invention was completed.
  • a therapeutic agent for cancerous peritonitis which comprises an antibody that recognizes a transferrin receptor.
  • the antibody has the heavy chain first complementarity determining region (VH CDR1), the heavy chain second complementarity determining region (VH CDR2), and the heavy chain third complementarity determining region (VH CDR3) having SEQ ID NOs: 1, respectively. , 2, 3 and the light chain first complementarity determining regions (VL CDR1), light chain second complementarity determining regions (VL CDR2), and light chain third complementarity determining regions (VL CDR3) are SEQ ID NOs: respectively.
  • the therapeutic agent for cancerous peritonitis according to any one of (1) to (3), which is an antibody that is 4, 5, and 6.
  • the antibody is selected from the group consisting of peptides containing Fab, Fab', F (ab') 2 , single chain antibody (scFv), bispecific antibody, disulfide-stabilized V region (dsFv) and CDR.
  • Cancerous peritonitis is associated with gastric cancer, pancreatic cancer, colon cancer, ovarian cancer, biliary tract cancer, liver cancer, gastrointestinal stromal tumor (GIST) or small intestinal cancer.
  • the therapeutic agent for cancerous peritonitis according to any one of 1) to (8).
  • a method for treating cancerous peritonitis comprises administering to a subject an antibody that recognizes a transferrin receptor.
  • B An antibody that recognizes a transferrin receptor for use in the treatment of cancerous peritonitis.
  • C Use of an antibody that recognizes the transferrin receptor for the manufacture of a therapeutic agent for cancerous peritonitis.
  • the therapeutic agent for cancerous peritonitis of the present invention is useful in the treatment of cancerous peritonitis.
  • the therapeutic agent for cancerous peritonitis of the present invention is a molecular-targeted agent targeting a new mechanism that attacks the supply route of nutrients required for cell metabolism.
  • the therapeutic agent for cancerous peritonitis of the present invention is an optimal approach to existing anticancer drug-resistant peritoneal disseminated cells that survive in a hypoxic and malnourished environment, and is an unprecedented and original new medical treatment. Leads to.
  • FIG. 1 shows a site where each TfR mutant fragment is point-mutated.
  • FIG. 2 shows the reactivity of TfR436 with soluble wild type TfR (sTfR) and TfR mutant fragment.
  • FIG. 3 shows the Tf-TfR binding inhibitory activity of TfR436.
  • FIG. 4 shows the expression of TfR in patient tumor tissue.
  • FIG. 5 shows the results of the survival time analysis.
  • FIG. 6 shows HE specimens of mouse peritoneal masses in the TfR436 antibody-administered group.
  • FIG. 7 shows the measurement result of the ascites weight.
  • FIG. 8 shows the results of analysis of the survival rate of the pancreatic cancer cell line SUIT2 peritoneal dissemination model.
  • FIG. 9 shows the expression of TfR in patient specimens.
  • the transferrin receptor (TfR) is a transmembrane protein composed of 760 amino acids encoded on human chromosome 3 (SEQ ID NO: 9). This protein, also known as the CD71 antigen, is thought to be involved in cell iron uptake and cell proliferation.
  • the TfR of the present invention is not particularly limited in structure, and the monomer, multimer, intact form expressed on the cell membrane, solubilized form composed in the extracellular region, truncated form, gene mutation, and the like. , Mutation form due to defects, etc., and post-translational modified form due to phosphorylation, etc., all mean TfR.
  • React and Reactivity mean the same thing unless otherwise specified. That is, the antibody recognizes the antigen.
  • This antigen may be an antigen TfR expressed on the cell membrane, a truncated form, or a solubilized form. Further, TfR having a three-dimensional structure may be used, or TfR may be modified.
  • Means for examining reactivity include flow cytometer (FACS), enzyme-linked immunosorbent assay (ELISA), western-blot, fluorescence trace measurement technology (FMAT), surface plasmon resonance (BIAcore), immunostaining, immunoprecipitation, etc. Can be mentioned.
  • the antibody used for the flow cytometer may be an antibody labeled with a fluorescent substance such as FITC, biotin, or the like, or an unlabeled antibody.
  • fluorescent-labeled avidin, fluorescent-labeled anti-human immunoglobulin antibody, or the like is used depending on the presence or absence of labeling of the antibody used and its type. Reactivity should be evaluated by adding a sufficient amount of anti-TfR antibody (usually the final concentration is 0.01 to 10 ⁇ g / mL) to the sample and comparing it with the reactivity of the negative control antibody and the positive control antibody. Can be done.
  • Antibodies The following abbreviations (in parentheses) are used herein as is customary. Heavy chains (H chains), light chains (L chains), heavy chain variable regions (VH), light chain variable regions (VL), complementarity determining regions (CDRs), first complementarity determining regions (CDR1), second Complementarity determining regions (CDR2), third complementarity determining regions (CDR3) heavy chain first complementarity determining regions (VH CDR1), heavy chain second complementarity determining regions (VH CDR2), heavy chain third Complementarity determining regions (VH CDR3s)
  • antibody is synonymous with immunoglobulin and should be understood as is commonly known in the art. Specifically, the term antibody is not limited to any particular method of making an antibody. For example, the term antibody includes, but is not limited to, recombinant antibodies, monoclonal antibodies, and polyclonal antibodies.
  • human antibody means any antibody in which the sequences of the variable and constant regions are human sequences.
  • the term has a sequence derived from a human gene, but has been altered to, for example, reduce possible immunogenicity, increase affinity, remove cysteines that can cause unwanted folding, and so on. Includes antibodies.
  • the term also includes such antibodies made recombinantly in non-human cells that can undergo glycosylation that is not unique to human cells. These antibodies can be prepared in a variety of forms.
  • humanized antibody refers to an antibody of non-human origin, where an amino acid residue characteristic of the antibody sequence of a non-human species is replaced with a residue found at the corresponding position of the human antibody. Has been done. It is believed that this "humanization" step reduces the human immunogenicity of the resulting antibody.
  • non-human derived antibodies can be humanized using techniques well known in the art. For example, Winter et al., Immunol. See Today 14: 43-46 (1993).
  • Antibodies of interest can be engineered by recombinant DNA techniques that replace CH1, CH2, CH3, hinge domains, and / or framework domains with the corresponding human sequences. For example, WO 92/02190, and US Pat.
  • humanized antibody includes, within its meaning, chimeric human antibody and CDR-transplanted antibody.
  • the sequence of the framework region (FR) in the variable region of the antibody is not particularly limited as long as it does not substantially affect the specific binding property to the corresponding antigen. It is preferable to use the FR region of a human antibody, but the FR region of a non-human animal species (for example, mouse or rat) can also be used.
  • a constant region is included in addition to the variable region (for example, IgG type antibody).
  • the arrangement of the constant region is not particularly limited.
  • a known constant region of a human antibody can be used.
  • the heavy chain constant region (CH) of the human antibody may be any as long as it belongs to human immunoglobulin (hereinafter referred to as hIgG), but hIgG class ones are preferable, and hIgG1 belonging to the hIgG class, Any of the subclasses such as hIgG2, hIgG3 and hIgG4 can be used.
  • the light chain constant region (CL) any one belonging to hIg may be used, and those of ⁇ class or ⁇ class can be used. It is also possible to use constant regions of animal species other than humans (eg, mice and rats).
  • the term "modified” or “modified antibody” means that one or more amino acids are substituted, deleted, added and / or in the amino acid sequence of the variable region (CDR sequence and / or FR sequence) of the parent antibody. It is inserted.
  • the "parent antibody” is a TfR436 antibody having the amino acid sequence shown in SEQ ID NO: 7 for VH and SEQ ID NO: 8 for VL.
  • amino acid sequence one or several (eg, 1 to 8, preferably 1 to 5, more preferably 1 to 3, particularly preferably 1 or 2) amino acids are deleted, added, substituted and /. Or it has been inserted.
  • a method of introducing a mutation into a protein is known.
  • those skilled in the art can use the site-directed mutagenesis method (Hashimoto-Gotoh, T, Mizuno, T, Ogasahara, Y, anDNAkagawa, M. (1995) An oligodeoxyribonucleotide-directed dual amber method for site-directed mutagenesis. Gene. 152, 271-275, Zoller, MJ, and Smith, M.
  • a modified antibody functionally equivalent to the antibody having a binding activity to TfR can be prepared.
  • an antibody in which one or several amino acids are mutated in the variable region or constant region of the antibody and has a binding activity to TfR can also be used.
  • the activity is equivalent to that of the parent antibody
  • the binding activity to TfR is equivalent.
  • “Equivalent” does not necessarily mean that the activity is of the same degree, the activity may be enhanced, or the activity may be decreased as long as the activity is maintained.
  • Examples of the antibody having reduced activity include 30% or more activity, preferably 50% or more activity, more preferably 80% or more activity, and further preferably 90% or more activity as compared with the original antibody. Particularly preferably, an antibody having an activity of 95% or more can be mentioned.
  • Binding activity means recognizing an antigen.
  • This antigen may be an antigen TfR expressed on the cell membrane, a truncated form, or a solubilized form. Further, TfR having a three-dimensional structure may be used, or TfR may be modified.
  • a flow cytometer FACS
  • an enzyme-linked immunosorbent assay ELISA
  • Western-blot FMAT
  • fluorescence trace measurement technology FMAT
  • BIOcore surface plasmon resonance
  • the Tf-TfR binding inhibitory activity of an antibody can be measured according to the method described in "Example 2 (2) Comparison of TfR436 antibody and antibody of another company in Tf-TfR binding inhibition" described later.
  • the TfR solution is dispensed onto a substrate (96-well plate, etc.), allowed to stand, solidified, and blocked. Then, the HRP-labeled Tf solution is dispensed, an antibody is further added, and the reaction is carried out at room temperature. Then, the substrate is washed, a coloring reagent (TMB or the like) is added and reacted, and the absorbance is measured with a plate reader.
  • TMB coloring reagent
  • the antibody is not limited by its origin, and may be any animal-derived antibody such as a human antibody, a mouse antibody, and a rat antibody. Further, a chimeric antibody, a humanized antibody, or the like may be used.
  • a human antibody is one of the preferred embodiments of the antibody in the present invention.
  • the antibody may differ in amino acid sequence, molecular weight, isoelectric point, presence / absence and morphology of sugar chain, etc., depending on the cell producing the antibody described later, the host, or the purification method.
  • amino acid sequence described in the present invention is modified after translation is also included in the present invention.
  • post-translational modifications for sites other than known post-translational modifications are also included in the present invention.
  • the antibody is expressed in prokaryotic cells, for example, Escherichia coli, a methionine residue is added to the N-terminal of the amino acid sequence of the original antibody. In the present invention, such an antibody may be used.
  • Post-translational modifications for sites other than known post-translational modifications are also included in the invention.
  • scFv that reacts with antigen by phage display library Obtaining the antibody can be prepared according to several methods known in the art. For example, phage display technology can be used to provide a library containing a repertoire of antibodies with varying affinities for TfR. These libraries can then be screened to identify and isolate antibodies against TfR.
  • the phage library is an scFv phage display library produced using human VL and VH cDNA prepared from mRNA isolated from human B cells. Methods of preparing and screening such libraries are known in the art. Genetic material is recovered from reactive phage clones screened using TfR as an antigen.
  • the DNA sequences of VH and VL encoding the variable region of the human antibody that binds to the antigen can be determined.
  • a human antibody can be obtained by converting scFv to IgG using this scFv sequence.
  • a full long heavy chain gene can be obtained by linking a DNA encoding VH with another DNA molecule encoding a heavy chain constant region (CH1, CH2 and CH3).
  • a heavy chain constant region CH1, CH2 and CH3
  • the sequences of human heavy chain constant region genes are known in the art (eg, Kabat, EA et al., (1991) Sequences of Proteins of Immunological Interest, 5th Edition, US Department of Health and Human Services, NIH Publication No. 91-3242), DNA fragments containing these regions can be obtained by standard PCR amplification.
  • the heavy chain constant region may be a constant region of IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD, but most preferably a constant region of IgG1 or IgG2.
  • the IgG1 constant region sequence can be any of a variety of alleles or allotypes known to occur between different individuals, such as Gm (1), Gm (2), Gm (3) and Gm (17). These allotypes correspond to naturally occurring amino acid substitutions in the IgG1 constant region.
  • a full-length L-chain gene (and Fab light chain gene) can be obtained by linking the VL-encoding DNA with another DNA molecule encoding the light chain constant region CL.
  • the sequence of the human light chain constant region gene is known in the art (eg, Kabat, EA et al., (1991) Sequences of Proteins of Immunological Interest, 5th Edition, US Department of Health and. Human Services, NIH Publication No. 91-3242), DNA fragments containing these regions can be obtained by standard PCR amplification.
  • the light chain constant region may be a constant region of ⁇ or ⁇ .
  • the ⁇ constant region can be any of a variety of alleles known to occur between different individuals, such as Inv (1), Inv (2) and Inv (3).
  • the ⁇ constant region may be derived from any of the three ⁇ genes.
  • An expression vector is prepared by inserting the DNA encoding the H chain or L chain obtained as described above into an expression vector, expressed in a host cell, and a human antibody is obtained by collecting and purifying the secreted supernatant.
  • Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAV), plant viruses such as cauliflower mosaic virus and tobacco mosaic virus, and episomes derived from cosmid, YAC, and EBV.
  • the expression vector and expression regulatory sequence are selected to be compatible with the expression host cell used.
  • the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vectors, or both genes can be inserted into the same expression vector.
  • the antibody gene is inserted into the expression vector by standard methods (eg, ligation of the vector with complementary restriction sites on the antibody gene fragment, or blunt-ended ligation in the absence of restriction sites).
  • the favorable vector is a functionally complete human CH or CL with suitable restriction sites engineered to allow easy insertion and expression of any VH or VL sequence as described above. It encodes an immunoglobulin sequence.
  • splicing usually occurs between the splice-donating site in the inserted J region and the splice receiving site preceding the human C domain, and also in the splice region present within the human CH exon. Polyadenylation and transcription termination occur at naturally occurring chromosomal sites downstream of the coding region.
  • the recombinant expression vector can also encode a signal peptide that stimulates the secretion of host cell-derived antibody chains.
  • the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the immunoglobulin chain.
  • the signal peptide may be an immunoglobulin signal peptide or a heterologous signal peptide (ie, a signal peptide derived from a non-immunoglobulin protein).
  • the antibody expression vector may have, in addition to the antibody gene and control sequence, an additional sequence such as a sequence that controls the replication of the vector in the host cell (for example, an origin of replication) or a selectable marker gene.
  • the selectable marker gene facilitates the selection of the host cell into which the vector has been introduced.
  • the selectable marker gene usually confer resistance to drugs such as G418, hygromycin and methotrexate on the host cell into which the vector has been introduced.
  • Preferred selectable marker genes include the dehydrofolate reductase (DHFR) gene (used with methotrexate selection / amplification in dhfr-host cells), the neomycin phosphotransferase gene (for G418 selection), and the glutamic acid synthase gene.
  • DHFR dehydrofolate reductase
  • the host cell may be any cell such as a bacterium, a yeast, an animal cell, an insect cell, or a plant cell as long as it can produce an antibody, but an animal cell is preferable.
  • animal cells Chinese hamster ovary cells CHO / dhfr (-) cells CHO / DG44 cells, monkey-derived cells COS cells (A.Wright & SLMorrison, J.Immunol.160, 3393-3402 (1998)), SP2 / O cells (Mouth Mieroma) (K. Motmans et al., Eur.J. Cancer Prev.
  • the lipofectin method (RWMalone et al., Proc.Natl.Acad.Sci.USA 86,6007 (1989), PLFelgner et al., Proc.Natl.Acad.Sci.USA 84,7413 ( 1987), the electroporation method, the calcium phosphate method (FLGraham & AJvan der Eb, Virology 52,456-467 (1973)), the DEAE-Dextran method and the like are preferably used.
  • the human antibody After culturing the transformant, the human antibody is separated from the cells of the transformant or the culture medium.
  • methods such as centrifugation, salting out, salting out, ultrafiltration, affinity chromatography, ion exchange chromatography, and gel filtration chromatography can be appropriately combined and used.
  • Antibody fragment can be prepared based on an antibody or based on the sequence information of a gene encoding an antibody.
  • Examples of the antibody fragment include Fab, Fab', F (ab') 2 , scFv, and dsFv antibodies.
  • Fab is a fragment having a molecular weight of about 50,000, which is obtained by papain digestion of IgG in the presence of cysteine and is composed of an L chain and an H chain variable region, and an H chain fragment consisting of a CH1 domain and a part of a hinge portion. is there. In the present invention, it can be obtained by digesting the above antibody with papain. Further, a Fab can be prepared from a transformant transformed by incorporating a part of the H chain and the DNA encoding the L chain of the antibody into an appropriate vector.
  • Fab' is a fragment having a molecular weight of about 50,000 obtained by cleaving the disulfide bond between the H chains of F (ab') 2 described later. In the present invention, it is obtained by digesting the above antibody with pepsin and cleaving a disulfide bond with a reducing agent. Further, as with Fab, it can also be genetically engineered using DNA encoding Fab'.
  • F (ab') 2 is a fragment (Fab') obtained by pepsin digestion of IgG, which is composed of an L chain and an H chain variable region, and an H chain fragment consisting of a CH1 domain and a part of a hinge portion. Is a fragment having a molecular weight of about 100,000 bonded by a disulfide bond. In the present invention, it is obtained by pepsin digestion of the above antibody. Further, similarly to Fab, it can also be genetically engineered using DNA encoding F (ab') 2.
  • the scFv is an antibody fragment obtained by linking an Fv composed of an H chain variable region and an L chain variable region with the C-terminal of one chain and the N-terminal of the other with an appropriate peptide linker to form a single chain.
  • the peptide linker for example, highly flexible (GGGGS) 3 or the like can be used.
  • GGGGS highly flexible
  • a DNA encoding an scFv antibody is constructed using a DNA encoding the H chain variable region and the L chain variable region of the antibody and a DNA encoding a peptide linker, and this is incorporated into an appropriate vector, and the vector is used.
  • ScFv can be prepared from the transformed transformant.
  • dsFv is an Fv fragment in which Cys residues are introduced at appropriate positions in the H chain variable region and the L chain variable region, and the H chain variable region and the L chain variable region are stabilized by a disulfide bond.
  • the introduction position of the Cys residue in each chain can be determined based on the three-dimensional structure predicted by molecular modeling.
  • the three-dimensional structure is predicted from the amino acid sequences of the H chain variable region and the L chain variable region of the above antibody, and based on this prediction, DNA encoding the H chain variable region and the L chain variable region into which the mutation is introduced is constructed. Then, this can be incorporated into a suitable vector, and dsFv can be prepared from the transformant transformed with the vector.
  • the antibody fragment can be multimerized by ligating an scFv antibody, a dcFv antibody, or the like using an appropriate linker, or by fusing streptavidin.
  • Bispecific antibody The antibody may be a bispecific antibody.
  • Bispecific antibodies are bispecific (mabs) obtained by chemically cross-linking two monoclonal antibodies, and bispecific obtained by chemically cross-linking two or two Fab fragments. Gender F (ab') 2, quadroma, bsDb (bispecific diabody), scBsDb (single-chain bispecific diabody), scBsTaFv (single-chain bispecific tandem variable domain), Bite (Bispecific T cell Engager antibody), DNL-F (ab) ) 3 (docl-and-lock trivalent Fab) and the like (Shim, H. Bispecific Antibodies and Antibody-Drug COmjugates for Cancer Therapy: Technological Considerations. Biomolecules 2020, 10, 360).
  • compositions and preparations containing a therapeutic agent for cancerous peritonitis of the present invention are also included within the scope of the present invention.
  • the therapeutic agent for cancerous peritonitis of the present invention can be used for the treatment of cancerous peritonitis.
  • Cancerous peritonitis is a condition in which cancer has spread to the peritoneum.
  • the cancerous peritonitis is not particularly limited, and examples thereof include those associated with cancer that causes cancerous peritonitis, and more specifically, gastric cancer, pancreatic cancer, colon cancer, ovarian cancer, and the like. Examples include those associated with biliary tract cancer, liver cancer, gastrointestinal stromal tumor (GIST) or small intestinal cancer.
  • GIST gastrointestinal stromal tumor
  • cancerous peritonitis cancer cells are scattered in the abdominal cavity, a large number of sand-granular masses are formed on the peritoneum, and ascites accumulates.
  • the pharmaceutical composition and preparation containing the therapeutic agent for cancerous peritonitis of the present invention preferably contains a physiologically acceptable diluent or carrier in addition to the antibody, and may be a mixture with other agents.
  • Suitable carriers include, but are not limited to, physiological saline, phosphate buffered saline, phosphate buffered saline glucose solution, and buffered saline.
  • the antibody may be freeze-dried and reconstituted and used by adding a buffered aqueous solution as described above when required.
  • Examples of the administration form include parenteral administration by intraperitoneal administration (intraperitoneal injection, etc.).
  • the dose of the therapeutic agent for cancerous peritonitis of the present invention varies depending on symptoms, age, body weight, etc., but in general, the amount of antibody in oral administration is about 0.01 mg to 1000 mg per day for adults. , These can be administered once or in several divided doses. In parenteral administration, about 0.01 mg to 3000 mg can be administered intraperitoneally at a time.
  • VH CDR1 SYGMH (SEQ ID NO: 1)
  • VH CDR2 VISYDGSNKYADSVKG (SEQ ID NO: 2)
  • VH CDR3 DSNFWSGYYSPVDV (SEQ ID NO: 3)
  • VL CDR1 TRSSGSIASNSVQ (SEQ ID NO: 4)
  • VL CDR2 YEDTQRPS (SEQ ID NO: 5)
  • VL CDR3 QSYDSAYHWV (SEQ ID NO: 6)
  • TfR436 VH (SEQ ID NO: 7) DVQLVQSGGGVVQPGRSLRLSCAASGFPFKSYGMHWVRQAPGKGLEWVAVISYDGSNKYADSVKGRFTISRDNSKNTLYLQMNSLRGEDTAVYYCARDSNFFWSGYSPVTVGS
  • TfR436 VL (SEQ ID NO: 8) NFMLTQPHSVSESPGKTVTISCTRSSGSIASNSVQWYQQRPGSAPITVIYEDTQRPSGVPDRFSGSIDSSSNSASLSGLLQTEDEADYYCQSYDSAYHWVFGGGTKLALL
  • Example 1 Identification of the binding site of the TfR436 antibody
  • the TfR436 antibody did not cross-react with mouse TfR, but showed cross-reactivity with hamster TfR.
  • the amino acid sequence of the Transferrin (TF) binding site (amino acids 569 to 760) in TfR was aligned.
  • the same amino acids as hamsters and different from mice were picked up.
  • the picked up amino acids were point-mutated as shown in FIG. 1 to prepare a soluble TfR mutant fragment.
  • the plasmid was transfected into Expi293 cells (Invitrogen) using Expectamine (Invitrogen) and cultured at 37 ° C., 8% CO2, 135 rpm for 5 days. Then, the culture supernatant is collected by centrifugation, a HisTrapHP (GE Healthcare) column is connected to the AKTA prime (GE Healthcare), 20 mM Imidazole / DPBS is used as the binding buffer, and 500 mM Imidazole / DPBS is used as the elution buffer. Was purified. The eluted protein was buffer exchanged with 30 mM HEPES, 5% trehalose, pH 7.2 using Zeba spin colon (Thermo Scientific).
  • TfR436 antibody (1 ug / mL) was dispensed into 100 ⁇ L / well, placed on a shaker, and reacted at room temperature for 1 hour. Then, it was washed 5 times with PBS-T Buffer, diluted 50,000 times, and dispensed into 100 ⁇ L / well of secondary antibody F (ab') 2 Fragment Anti-Human IgG Fc ⁇ (Jackson Immuno Research) and reacted at room temperature for 1 hour. I let you.
  • TMB Solve Reagent High Sensitivity (Scy Tek) was dispensed into 100 ⁇ L / well, reacted at room temperature and in the dark for 3 minutes, and then TMB Stop Buffer (Scy Tek) was 100 ⁇ L. The mixture was added, shaken with a shaker for 1 minute, and the absorbance at 450 n (ref. 620 nm) was measured with a plate reader.
  • the TfR436 antibody showed a decrease in reactivity with TfR mutant fragment MF5, but no decrease in reactivity with other mutant fragments was observed. That is, if the 629th, 630th, and 633th amino acids of TfR are replaced with other amino acids, the TfR436 antibody cannot be recognized as TfR. It was suggested that amino acids 629-633 are recognition epitopes of the TfR436 antibody.
  • Example 2 Comparison of TfR436 antibody and comparative antibody in Tf-TfR binding inhibition (1) Preparation of comparative antibody A24 Patent Document US2008 / 0193453 describes an A24 antibody against human TfR. To compare this antibody with the TfR436 antibody, a deposited Hybridoma was obtained and the antibody was produced. Specifically, Hybridoma was sprinkled in a medium of RPMI1640 (GIBCO) and FBS 10% so that the cell concentration was 1 to 2x10 5 / mL, and cultured in a 5% CO 2 incubator at 37 ° C.
  • the cells were collected by centrifugation, washed twice with PBS, and then expanded and cultured in serum-free medium cosmedium005 (Cosmobio) and 0.5% Nutridoma-CS (Roche) until the volume became 550 mL.
  • the culture supernatant was collected by centrifugation 5 days after the cells became confluent.
  • the recovered supernatant is applied to a protein A carrier (Ab-Capcher Extra: Protenova), and the antibody bound to protein A is eluted with 0.1 M glycine hydrochloride buffer (pH 2.7), and promptly. Neutralized with 1M Tris hydrochloric acid buffer (pH 8.5). After that, the buffer was exchanged with PBS using an ultracell ultrafiltration disk (Merck Millipore).
  • the results show that the TfR436 antibody completely inhibited Tf-TfR binding at a much lower dose (100 ng / mL), as shown in FIG.
  • the A24 antibody could not completely inhibit the binding of Tf-TfR even at a dose of 10 ⁇ g / mL, and could inhibit the binding of Tf-TfR by only 50%. It was suggested that the TfR436 antibody was superior in inhibiting the binding of Tf-TfR.
  • Example 3 Expression of TfR in a patient sample of cancerous peritonitis (immunostaining of a patient pathological sample)
  • the expression of TfR1 in the tumor tissues of the primary and peritoneal disseminated lesions collected from patients with cancerous peritonitis of the primary gastric cancer was examined by immunostaining. Tumor tissue slides were deparaffinized and autoclaved at 121 ° C. for 15 minutes in pH 6.0 activation buffer for antigen activation. After endogenous peroxidase treatment with 0.3% H 2 O 2 water, primary antibody (0.4 ⁇ g / mL Anti TFRC Rabbit, ATLAS ANTIBODIES, HPA028598) was reacted at 4 ° C. overnight.
  • the polymer reagent Histfine Simple Stain MAX-PO MULTI, Nichirei, 424152
  • DAB reagent Histfine Simple Stain DAB, Nichirei, 415172
  • the expression of TfR was confirmed in both the tumor tissue derived from the primary tumor of the gastric cancer patient (FIG. 4A) and the tumor tissue of the peritoneal disseminated lesion (FIG. 4B).
  • Example 4 Antitumor effect of gastric cancer cell line MKN45-Luc peritoneal dissemination model
  • the antitumor effect of TfR436 antibody was examined using the gastric cancer cell line MKN45-Luc peritoneal dissemination model.
  • the MKN45-Luc cell line (JCRB1379) was cultured in culture medium (RPMI-1640, 10% FBS, 1% P / S). The culture medium was removed, washed once with PBS, and the cells were detached using TrypLE Express. The cells were collected by adding the culture medium, washed once with PBS, suspended again in PBS, and the number of cells was counted using 0.4% trypan blue. After counting, the cells were prepared with PBS to a cell concentration of 1 ⁇ 10 7 / mL.
  • This cell suspension was sucked up into a 1 mL tuberculin syringe, attached with a two-step needle, and C.I. 200 ⁇ L / animal was transplanted into the abdominal cavity of 20 B-17 / IcrHsd-Prkdc scid mice (female, 6 weeks old at the time of arrival).
  • the number of transplanted cells is 2 ⁇ 10 6 cells / animal.
  • luciferin was intraperitoneally administered and the luminescence of the transplanted cells was measured.
  • 17 mice in which the engraftment of the transplanted cells was confirmed by the detection of luminescence were used for grouping according to the luminescence intensity (8 in the control group and 9 in the antibody administration group).
  • the drug was intraperitoneally administered four times at intervals of once a week.
  • PBS was administered to the control group, and 15 mg / kg of TfR436 antibody was administered to the antibody-administered group.
  • mice were observed during the test period to determine whether they were alive or dead.
  • the test was completed 77 days after transplantation, and statistical analysis was performed based on the survival time of the mice.
  • the formation of a mass was confirmed in the abdominal cavity of 7 mice in the TfR436 antibody-administered group that were alive at the end of the test.
  • necrosis was observed extensively in the tumor, and tumor cells retaining the proliferative capacity were confirmed to remain only on the surface of the tumor and in a small area around the blood vessel (Fig. 6). ).
  • Example 5 Examination of antitumor effect by pancreatic cancer cell line SUIT-2 peritoneal dissemination model SUIT-2 cell line (JCRB1094) was cultured in a culture medium (EMEM, 10% FBS, 1% P / S). The culture broth was removed, washed once with PBS, and the cells were detached using TrypLE Express. The cells were collected by adding the culture medium, washed once with PBS, suspended again in PBS, and the number of cells was counted using 0.4% trypan blue. After counting, the cells were prepared with PBS to a cell concentration of 1 ⁇ 10 7 / mL. This cell suspension was sucked up into a 1 mL tuberculin syringe, attached with a two-step needle, and C.I.
  • a culture medium EMEM, 10% FBS, 1% P / S
  • the culture broth was removed, washed once with PBS, and the cells were detached using TrypLE Express.
  • the cells were collected by adding the culture medium, washed once
  • Example 6 Life-prolonging effect of pancreatic cancer cell line SUIT2 peritoneal dissemination model SUIT-2 cell line (JCRB1094) was cultured in a culture medium (EMEM, 10% FBS, 1% P / S). The culture medium was removed, washed once with PBS, and the cells were detached using TrypLE Express. The cells were collected by adding the culture medium, washed once with PBS, suspended again in PBS, and the number of cells was counted using 0.4% trypan blue. After counting, the cells were prepared with PBS to a cell concentration of 1 ⁇ 10 7 / mL. This cell suspension was sucked up into a 1 mL tuberculin syringe, attached with a two-step needle, and C.I.
  • EMEM 10% FBS, 1% P / S
  • Example 7 TfR expression analysis of patient specimens Using the cancer patient specimens shown in the table below, the TfR expression state was analyzed by immunostaining only for peritoneal disseminated tumors by the same method as in Example 3. The judgment criteria are shown in Table 1.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Le problème à résoudre par la présente invention est de fournir un agent thérapeutique contre la péritonite carcinomateuse. La présente invention concerne un agent thérapeutique contre la péritonite carcinomateuse et qui contient un anticorps qui reconnaît un récepteur de la transferrine.
PCT/JP2020/044185 2019-11-27 2020-11-27 Agent thérapeutique contre la péritonite carcinomateuse WO2021107082A1 (fr)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN202080082359.1A CN114786718A (zh) 2019-11-27 2020-11-27 癌性腹膜炎的治疗药
EP20892360.7A EP4066858A4 (fr) 2019-11-27 2020-11-27 Agent thérapeutique contre la péritonite carcinomateuse
US17/780,758 US20230250180A1 (en) 2019-11-27 2020-11-27 Therapeutic drug for carcinomatous peritonitis
JP2021561536A JPWO2021107082A1 (fr) 2019-11-27 2020-11-27

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
JP2019-213812 2019-11-27
JP2019213812 2019-11-27

Publications (1)

Publication Number Publication Date
WO2021107082A1 true WO2021107082A1 (fr) 2021-06-03

Family

ID=76129610

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/JP2020/044185 WO2021107082A1 (fr) 2019-11-27 2020-11-27 Agent thérapeutique contre la péritonite carcinomateuse

Country Status (5)

Country Link
US (1) US20230250180A1 (fr)
EP (1) EP4066858A4 (fr)
JP (1) JPWO2021107082A1 (fr)
CN (1) CN114786718A (fr)
WO (1) WO2021107082A1 (fr)

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1992001047A1 (fr) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Procede de production de chainon de paires a liaison specifique
WO1992002190A1 (fr) 1990-08-09 1992-02-20 Silverman Harvey N Procede et systeme de blanchiment des dents
WO1992020791A1 (fr) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methode de production de chainons de paires de liaison specifique
WO1993006213A1 (fr) 1991-09-23 1993-04-01 Medical Research Council Production d'anticorps chimeriques - une approche combinatoire
WO1993011236A1 (fr) 1991-12-02 1993-06-10 Medical Research Council Production d'anticorps anti-auto-antigenes a partir de repertoires de segments d'anticorps affiches sur phage
WO1993019172A1 (fr) 1992-03-24 1993-09-30 Cambridge Antibody Technology Limited Procedes de production d'elements de paires de liaison specifiques
WO1995001438A1 (fr) 1993-06-30 1995-01-12 Medical Research Council Membres d'une paire de liaison specifique dont une fraction chimique est liee par covalence dans le site de liaison; production et selection de ces membres
WO1995015388A1 (fr) 1993-12-03 1995-06-08 Medical Research Council Proteines et peptides de liaison recombines
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
WO1997010354A1 (fr) 1995-09-11 1997-03-20 Kyowa Hakko Kogyo Co., Ltd. Anticorps de la chaine alpha du recepteur de l'interleukine 5 humaine
US5693792A (en) 1992-02-18 1997-12-02 Otsuga Kagaku Kabushiki Kaisha β-lactam and cephem compounds and processes for their production
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5777085A (en) 1991-12-20 1998-07-07 Protein Design Labs, Inc. Humanized antibodies reactive with GPIIB/IIIA
US20080193453A1 (en) 2004-04-30 2008-08-14 Inserm Institut National De La Sante Et De La Recherche Medicale Anti Tfr Antibody
WO2014073641A1 (fr) 2012-11-08 2014-05-15 国立大学法人 宮崎大学 Anticorps capable de reconnaître spécifiquement un récepteur de transferrine

Patent Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
WO1992020791A1 (fr) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methode de production de chainons de paires de liaison specifique
WO1992001047A1 (fr) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Procede de production de chainon de paires a liaison specifique
WO1992002190A1 (fr) 1990-08-09 1992-02-20 Silverman Harvey N Procede et systeme de blanchiment des dents
WO1993006213A1 (fr) 1991-09-23 1993-04-01 Medical Research Council Production d'anticorps chimeriques - une approche combinatoire
WO1993011236A1 (fr) 1991-12-02 1993-06-10 Medical Research Council Production d'anticorps anti-auto-antigenes a partir de repertoires de segments d'anticorps affiches sur phage
US5777085A (en) 1991-12-20 1998-07-07 Protein Design Labs, Inc. Humanized antibodies reactive with GPIIB/IIIA
US5693792A (en) 1992-02-18 1997-12-02 Otsuga Kagaku Kabushiki Kaisha β-lactam and cephem compounds and processes for their production
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
WO1993019172A1 (fr) 1992-03-24 1993-09-30 Cambridge Antibody Technology Limited Procedes de production d'elements de paires de liaison specifiques
WO1995001438A1 (fr) 1993-06-30 1995-01-12 Medical Research Council Membres d'une paire de liaison specifique dont une fraction chimique est liee par covalence dans le site de liaison; production et selection de ces membres
WO1995015388A1 (fr) 1993-12-03 1995-06-08 Medical Research Council Proteines et peptides de liaison recombines
WO1997010354A1 (fr) 1995-09-11 1997-03-20 Kyowa Hakko Kogyo Co., Ltd. Anticorps de la chaine alpha du recepteur de l'interleukine 5 humaine
US20080193453A1 (en) 2004-04-30 2008-08-14 Inserm Institut National De La Sante Et De La Recherche Medicale Anti Tfr Antibody
WO2014073641A1 (fr) 2012-11-08 2014-05-15 国立大学法人 宮崎大学 Anticorps capable de reconnaître spécifiquement un récepteur de transferrine

Non-Patent Citations (16)

* Cited by examiner, † Cited by third party
Title
A. WRIGHTS. L. MORRISON, J. IMMUNOL., vol. 160, 1998, pages 3393 - 3402
F. L. GRAHAMA. J. VAN DER EB, VIROLOGY, vol. 52, 1973, pages 456 - 467
FUJIO OGAWA, ET.AL.: "PS30-4: Targeting therapy with PEG liposomes containing CDDP as a molecular target in Transferrin receptor for peritoneal dissemination of gastric cancer", JOURNAL OF JAPAN SOCIETY OF CLINICAL ONCOLOGY, vol. 37, no. 2, 10 September 2002 (2002-09-10), JP , pages 304, XP009536862, ISSN: 0021-4671 *
HASHIMOTO-GOTOH, TMIZUNO, TOGASAHARA, YDNA KAGAWA, M.: "An oligodeoxyribonucleotide-directed dual amber method for site-directed mutagenesis", GENE, vol. 152, 1995, pages 271 - 275, XP004042690, DOI: 10.1016/0378-1119(94)00750-M
K. MOTMANS ET AL., EUR. J. CANCER PREV., vol. 5, 1996, pages 512 - 5199
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION
KRAMER WFRITZ HJ: "Oligonucleotide-directed construction of mutations via gapped duplex DNA Methods", ENZYMOL, vol. 154, 1987, pages 350 - 367
KRAMER, WDRUTSA, VJANSEN, HWKRAMER, BPFLUGFELDER, MFRITZ, HJ: "The gapped duplex DNA approach to oligonucleotide-directed mutation construction", NUCLEIC ACIDS RES., vol. 12, 1984, pages 9441 - 9456, XP002026371
KUNKEL, TA: "Rapid and efficient site-specific mutagenesis without phenotypic selection", PROC NATL ACAD SCI USA., vol. 82, 1985, pages 488 - 492, XP002052322, DOI: 10.1073/pnas.82.2.488
MALONE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 6007
P. L. FEIGNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 7413
R. P. JUNGHANS ET AL., CANCER RES., vol. 50, 1990, pages 1495 - 1502
See also references of EP4066858A4
SHIM, H.: "Bispecific Antibodies and Antibody-Drug Conjugates for Cancer Therapy: Technological Considerations", BIOMOLECULES, vol. 10, 2020, pages 360
WINTER ET AL., IMMUNOL. TODAY, vol. 14, 1993, pages 43 - 46
ZOLLER, MJSMITH, M.: "Oligonucleotide-directed mutagenesis of DNA fragments cloned into M13 vectors", METHODS ENZYMOL., vol. 100, 1983, pages 468 - 500, XP001088749, DOI: 10.1016/0076-6879(83)00074-9

Also Published As

Publication number Publication date
EP4066858A1 (fr) 2022-10-05
US20230250180A1 (en) 2023-08-10
JPWO2021107082A1 (fr) 2021-06-03
CN114786718A (zh) 2022-07-22
EP4066858A4 (fr) 2023-12-27

Similar Documents

Publication Publication Date Title
CN113227146B (zh) 密蛋白18.2结合部分和其用途
JP2021531826A (ja) 栄養膜細胞表面抗原２（ｔｒｏｐ２）に対する特異的な抗体
CN116059347A (zh) 使用her3抗原结合分子治疗和预防癌症
WO2012153707A1 (fr) Anticorps reconnaissant spécifiquement un récepteur de la transferrine
DK2918603T3 (en) ANTIBODY STANDING TO SPECIFICALLY RECOGNIZE TRANSFERRIN RECEPTOR
CN109988240B (zh) 抗gpc-3抗体及其用途
WO2021244328A1 (fr) Anticorps bispécifique anti-pd-l1 et her2
JP7410051B2 (ja) 細胞内への鉄の取り込み阻害剤
WO2021043220A1 (fr) Anticorps monoclonal anti-cd47 et son utilisation
JP2021531825A (ja) 葉酸受容体アルファに特異的な抗体
JP6552412B2 (ja) ヒトインテグリンａ６ｂ４と特異的に反応する抗体
WO2020038404A1 (fr) Anticorps monoclonal anti-claudine 18,2 humaine et son utilisation
WO2021107082A1 (fr) Agent thérapeutique contre la péritonite carcinomateuse
CN111662385B (zh) 全人源抗人gpc3单克隆抗体及其用途
WO2021213245A1 (fr) Anticorps ou fragment de liaison à l'antigène, procédé de préparation correspondant et utilisations pharmaceutiques associées
KR20220048028A (ko) 항-cd19 항체 및 그의 용도
KR20220050182A (ko) 항-cd22 항체 및 그의 용도
WO2023204181A1 (fr) Agent thérapeutique pour tumeur à cellules nk
WO2022075439A1 (fr) Méthode de détermination de sensibilité ou d'effet médicinal d'un anticorps anti-récepteur de la transferrine
WO2019174637A1 (fr) Molécule d'anticorps complètement humanisé contre tim-3, fragment de liaison à l'antigène et utilisation médicale associée
AU2019413278A1 (en) Bispecific antibody binding to TfR
WO2023027164A1 (fr) Promoteur de production d'espèces réactives de l'oxygène (ros)
WO2021045184A1 (fr) Agent thérapeutique contre la polycythémie
RU2817146C2 (ru) Средство для ингибирования поглощения железа клетками
WO2023103962A1 (fr) Molécule de liaison à tnfr2 et son utilisation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20892360

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021561536

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020892360

Country of ref document: EP

Effective date: 20220627