WO2021097186A1 - Barcoded xten polypeptides and compositions thereof, and methods for making and using the same - Google Patents

Barcoded xten polypeptides and compositions thereof, and methods for making and using the same Download PDF

Info

Publication number
WO2021097186A1
WO2021097186A1 PCT/US2020/060378 US2020060378W WO2021097186A1 WO 2021097186 A1 WO2021097186 A1 WO 2021097186A1 US 2020060378 W US2020060378 W US 2020060378W WO 2021097186 A1 WO2021097186 A1 WO 2021097186A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
polypeptides
sequence
xten
fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/060378
Other languages
English (en)
French (fr)
Inventor
Volker Schellenberger
Eric Johansen
Angela HENKENSIEFKEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amunix Pharmaceuticals Inc
Original Assignee
Amunix Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202080090841.XA priority Critical patent/CN115175920B/zh
Priority to MX2022005676A priority patent/MX2022005676A/es
Priority to EP20820695.3A priority patent/EP4058466A1/en
Priority to PH1/2022/551163A priority patent/PH12022551163A1/en
Priority to AU2020382621A priority patent/AU2020382621A1/en
Priority to IL292863A priority patent/IL292863A/en
Priority to KR1020227019674A priority patent/KR20220131221A/ko
Priority to US17/776,478 priority patent/US12617815B2/en
Priority to JP2022526756A priority patent/JP7725466B2/ja
Priority to BR112022009217A priority patent/BR112022009217A2/pt
Application filed by Amunix Pharmaceuticals Inc filed Critical Amunix Pharmaceuticals Inc
Priority to CA3157605A priority patent/CA3157605A1/en
Publication of WO2021097186A1 publication Critical patent/WO2021097186A1/en
Anticipated expiration legal-status Critical
Priority to CONC2022/0008004A priority patent/CO2022008004A2/es
Priority to JP2025130787A priority patent/JP2025179058A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/13Labelling of peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6842Proteomic analysis of subsets of protein mixtures with reduced complexity, e.g. membrane proteins, phosphoproteins, organelle proteins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6848Methods of protein analysis involving mass spectrometry
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/034Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the periplasmic space of Gram negative bacteria as a soluble protein, i.e. signal sequence should be cleaved
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/101Plasmid DNA for bacteria
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/914Hydrolases (3)
    • G01N2333/948Hydrolases (3) acting on peptide bonds (3.4)
    • G01N2333/95Proteinases, i.e. endopeptidases (3.4.21-3.4.99)

Definitions

  • a polypeptide can be produced in a manner that results in a mixture of polypeptides.
  • the mixture of polypeptides can often include the full-length polypeptide, along with size variants ( e.g ., truncations) thereof.
  • size variants e.g ., truncations
  • the presence of variants that differ in size from the desired full-length product can affect the biological behavior of a polypeptide drug substance, potentially affecting the safety and/or efficacy of the polypeptide drug substance.
  • protein-based prodrugs for cancer therapy can be engineered with a tumor-targeted activation mechanism.
  • the full-length therapeutic protein can be produced and administered in an inactive (non-cytotoxic) prodrug form, that is converted to the active drug by preferential removal of a portion of the prodrug polypeptide at the intended biological side (e.g., the tumor).
  • Truncation variants of the full-length construct can lose protective sequences and become cytotoxic (active), thus '‘contaminating” the prodrug composition and producing a mixture having components that are unintentionally active outside the intended biological site.
  • such shorter length variants can pose a greater risk of immunogenicity, have less selective toxicity for tumor cells, or show a less desired pharmacokinetic profile (e.g., resulting in a narrowed therapeutic window) compared with the full-length protein, or deleteriously have unintended effects in a recipient outside the intended site (e.g. in healthy tissue).
  • detection and quantification of protein structural variations can be important for assessing biological properties (e.g., clinical safety and pharmacologic efficacy) of biotherapeutics and in developing new biotherapeutics (e.g., with increased efficacy and reduced side effects).
  • Existing techniques and methods for identifying and quantify ing the amount of “contaminating” truncation products can include one or more drawbacks, such as being of limited sensitivity, ease, efficiency, or effectiveness.
  • polypeptides comprising an extended recombinant polypeptide (XTEN) that is comprised of a plurality of non-overlapping sequence motifs.
  • XTEN polypeptides of this invention the plurality of non-overlapping sequence motifs comprise: a set of non-overlapping sequence motifs, wherein each of said sequence motifs is repeated at least twice in the XTEN polypeptide; and also a unique non-overlapping sequence motif that occurs only once within the XTEN polypeptide; wherein the polypeptide further comprises a first barcode fragment releasable from the polypeptide upon digestion by a protease.
  • the first barcode fragment is a portion of the XTEN that includes at least part of the sequence motif that occurs only once within the XTEN and differs in sequence and molecular weight from all other peptides fragments that are releasable from the polypeptide upon complete digestion of the polypeptide by the protease.
  • the barcode fragment does not include the N-terminal amino acid or the C-terminal amino acid of the polypeptide.
  • XTEN polypeptides of this invention are characterized as comprising at least 150 amino acids, more specifically 150-3000 amino acids in length.
  • the amino acids comprising XTEN polypeptides of the invention are characterized wherein at least 90% of these residues are glycine (G), alanine (A), serine (S), threonine (T), glutamate (E), or proline (P), and the XTEN polypeptide comprises at least four of these amino acids (G, A, S, T, E, or P).
  • XTEN polypeptides as provided herein comprise nonoverlapping sequence motifs that are 9 to 14 amino acid sequences in length and within each of said nonoverlapping motifs the sequence of G, A, S, T, E, or P amino acids is substantially randomized with respect to any other nonoverlapping sequence motif comprising the XTEN polypeptide.
  • the barcode fragment does not include a glutamic acid that is immediately adjacent to another glutamic acid in the XTEN. In some embodiments, the barcode fragment has a glutamic acid at its C-terminus. In some embodiments, the barcode fragment has an N-terminal amino acid that is immediately preceded by a glutamic acid residue. In some embodiments, the glutamic acid residue that precedes the N-terminal amino acid is not immediately adjacent to another glutamic acid residue.
  • the barcode fragment does not include a glutamic acid residue at a position other than the C-terminus of the barcode fragment unless the glutamic acid is immediately followed by a proline In some embodiments, the barcode fragment is located from 10 amino acids to 150 amino acids from either the N-terminus of the polypeptide or the C-terminus of the polypeptide.
  • sequence motifs of the set of non-overlapping sequence motifs are identified herein by SEQ ID NOs: 182-203 and 1715-1722. In some embodiments, the sequence motifs of the set of nonoverlapping sequence motifs are identified herein by SEQ ID NOs: 186-189. In some embodiments, the set of non-overlapping sequence motifs comprise at least two, at least three, or all four of the sequence motifs SEQ ID NOs: 186-189.
  • polypeptides provided herein comprise an XTEN polypeptide as disclosed herein wherein the barcode fragment does not include the N-terminal amino acid or the C-terminal amino acid of the polypeptide; does not include a glutamic acid that is immediately adjacent to another glutamic acid in the XTEN; has a glutamic acid at its C-terminus; has an N -terminal amino acid that is immediately preceded by a glutamic acid residue; and is located 10 amino acids to 125 amino acids from either the N-terminus of the polypeptide or the C-terminus of the polypeptide.
  • the glutamic acid residue that precedes the N-terminal amino acid is not immediately adjacent to another glutamic acid residue.
  • the barcode fragment does not include a glutamic acid residue at a position other than the C-terminus of the barcode fragment unless the glutamic acid is immediately followed by a proline.
  • the XTEN polypeptides provided herein comprise a plurality of non-overlapping sequence motifs, wherein each said sequence motif is repeated at least twice in the XTEN polypeptide and is between 9 and 14 amino acids in length.
  • the sequence motifs of the set of nonoverlapping sequence motifs are identified herein by SEQ ID NOs: 182-203 and 1715-1722.
  • the sequence motifs of the set of non-overlapping sequence motifs are identified herein by SEQ ID NOs: 186-189.
  • the set of non-overlapping sequence motifs comprises at least two, at least three, or all four of the sequence motifs SEQ ID NOs: 186-189.
  • At least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of the amino acid residues of the XTEN polypeptide are a combination of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) or proline (P), wherein the XTEN polypeptide comprises at least four of these amino acids (G, A, S, T, E, or P).
  • the XTEN is from 150 to 3000 amino acids in length. In some embodiments, the XTEN is from 150 to 1000 amino acids in length.
  • the polypeptide can be cleaved by a protease that cleaves on the C- lenninal side of glutamic acid residues that are not followed by proline.
  • the protease is a Glu-C protease.
  • the barcode fragment is located within 200, within 150, within 100, or within 50 amino acids of the N-terminus of the polypeptide. In some embodiments, the barcode fragment is located between 10 and 200, between 30 and 200, between 40 and 150, or between 50 and 100 amino acids from the N-terminus of the protein. In some embodiments, the barcode fragment is located within 200, within 150, within 100, or within 50 amino acids of the C-terminus of the polypeptide In some embodiments, the barcode fragment is located between 10 and 200, between 30 and 200, between 40 and 150, or between 50 and 100 amino acids from the C-terminus of the protein. In some embodiments, the barcode fragment is at least 4 amino acids in length.
  • the barcode fragment is between 4 and 20, between 5 and 15, between 6 and 12, or between 7 and 10 amino acids in length. In some embodiments, the barcode fragment is identified herein by SEQ ID Nos: 8020-8030 (BAR001- BAR011). [0010] In some embodiments, the polypeptide further comprises a second barcode fragment wherein the second barcode fragment is a portion of the XTEN and differs in sequence and molecular weight from all other peptides fragments that are releasable from the polypeptide upon complete digestion of the polypeptide by protease.
  • the polypeptide further comprises a third barcode fragment wherein the third barcode fragment is a portion of the XTEN and differs in sequence and molecular weight from all other peptides fragments that are releasable from the polypeptide upon complete digestion of the polypeptide by protease.
  • the XTEN has at least 90%, at least 92%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence identified herein by SEQ ID NOs: 8001-8019. In some embodiments, the XTEN is at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, or at least 500 amino acids in length.
  • the polypeptide further comprises a biologically active polypeptide linked to the XTEN polypeptide (BPXTEN).
  • BPXTEN biologically active polypeptide linked to the XTEN polypeptide
  • the XTEN polypeptide is linked to the biologically active polypeptide at the XTEN’s amino or carboxyl terminus.
  • the barcode fragment is located within a region of the XTEN that extends, as measured from the amino or carboxyl terminus linked to the biologically active polypeptide, between 5% and 50%, between 7% and 40%, or between 10% and 30% of the length of the XTEN.
  • the BPXTEN polypeptide further comprises one or more reference fragments releasable from the polypeptide upon digestion by the protease, wherein the one or more reference fragments each comprise a portion of the biologically active polypeptide.
  • the one or more reference fragments is a single reference fragment that differs in sequence and molecular weight from all other peptide fragments that are releasable from the polypeptide upon digestion of the polypeptide by the protease.
  • said reference fragment comprises a peptide whose presence in a polypeptide mixture indicates its existence or integrity (i ' .e., that the protein has not been degraded or proteolytically cleaved).
  • the BPXTEN polypeptide further comprises a first release segment (RSI) located between the XTEN and the biologically active polypeptide.
  • RSI comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence identified herein by any one of the sequences in Tables 4a-4h.
  • the biologically active polypeptide identified herein by any one or combination of the sequences in Tables 4a-4h and 8a-8b.
  • the BPXTEN polypeptide advantageously has a terminal half-life that is at least two-fold longer compared to the biologically active polypeptide not linked to any XTEN.
  • the BPXTEN polypeptide advantageously is less immunogenic compared to the biologically active polypeptide not linked to any XTEN, wherein immunogenicity can be ascertained by measuring production of IgG antibodies that selectively bind to the biologically active polypeptide after administration of comparable doses to a human or animal.
  • the BPXTEN polypeptide exhibits an apparent molecular weight factor under physiological conditions that is greater than about 6.
  • the BPXTEN polypeptide further comprises a second XTEN polypeptide wherein the second XTEN polypeptide comprises an amino acid sequence having the same characteristics as set forth above and throughout this disclosure for the first XTEN component of these embodiments of the BPXTEN, and wherein the first XTEN polypeptide is located N-terminal of the biologically active polypeptide and the second XTEN polypeptide is located C-terminal of the biologically active polypeptide.
  • the second XTEN polypeptide comprises an amino acid sequence that differs from the amino acid sequence of the first XTEN comprising these embodiments of the BPXTEN. In certain embodiments the amino acid sequence of the second XTEN polypeptide is longer than the amino acid sequence of the first XTEN polypeptide.
  • the BPXTEN polypeptide further comprises a second release segment (RS2) located between the biologically active polypeptide and the second XTEN polypeptide.
  • RSI of the first XTEN polypeptide and RS2 of the second XTEN polypeptide are identical in sequence.
  • the RSI of the first XTEN polypeptide and RS2 of the second XTEN polypeptide are each a substrate for cleavage by multiple proteases at one, or two, or three, or more cleavage sites within each release segment sequence.
  • the BPXTEN polypeptide comprises a further barcode fragment that is a portion of the second XTEN polypeptide and differs in sequence and molecular weight from all other peptides fragments that are releasable from the polypeptide upon complete digestion of the polypeptide by protease.
  • the further barcode fragment does not include the C-terminal amino acid of the polypeptide.
  • the further barcode fragment comprises a glutamic acid residue at its C -terminus.
  • the further barcode fragment of the second XTEN polypeptide is located within 200, within 150, within 100, or within 50 amino acids of the C-terminus of the second XTEN component of the BPXTEN polypeptide. In some of these embodiments, the further barcode fragment of the second XTEN polypeptide is located at a location that is between 10 and 200, between 30 and 200, between 40 and 150, or between 50 and 100 amino acids from the C-terminus of the second XTEN component of the BPXTEN polypeptide. In some of these embodiments, the further barcode fragment is between 4 and 20, between 5 and 15, between 6 and 12, or between 7 and 10 amino acids in length.
  • the further barcode fragment is identified herein by SEQ ID Nos: 8020-8030 (BAR001 -BAR011).
  • the second XTEN polypeptide further comprises a set of barcode fragments that includes the further barcode fragment and at least one additional barcode fragment, wherein each barcode fragment of the set of barcode fragments differs in sequence and molecular weight from all other peptides fragments that are releasable from the BPXTEN polypeptide upon complete digestion of the polypeptide by the protease.
  • the second XTEN polypeptide is identified by SEQ ID NOs: 8001-8019.
  • the further barcode fragment does not include a glutamic acid residue that is immediately adjacent to another glutamic acid residue in the polypeptide.
  • At least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of the amino acid residues of the second XTEN polypeptide are a combination of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), wherein the XTEN polypeptide comprises at least four of these amino acids (G, A, S, T, E, or P).
  • the sum of the total number of amino acids in the first XTEN polypeptide and the total number of amino acids in the second XTEN polypeptide is at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, or at least 800 amino acids.
  • the second XTEN polypeptide comprises a plurality of non-overlapping sequence motifs, wherein each of said sequence motifs is repeated at least two times in the second XTEN polypeptide sequence and is between 9 and 14 amino acids in length.
  • the sequence motifs of the plurality of non- overlapping sequence motifs are identified herein by SEQ ID NOs: 182-203 and 1715-1722. In some embodiments, the sequence motifs of the plurality of non-overlapping sequence motifs are identified herein by SEQ ID NOs: 186-189. In some embodiments, for the second XTEN polypeptide, the plurality of nonoverlapping sequence motifs comprise at least two, at least three, or all four of the following motifs: SEQ ID NOs: 186-189. In some embodiments, the second XTEN polypeptide is from 150 to 3000 amino acids in length. In some embodiments, the second XTEN polypeptide is from 150 to 1000 amino acids in length.
  • the second XTEN polypeptide has at least 90%, at least 92%, at least 95%, at least 98%, at least 99% or 100% sequence identity to sequence identified herein by SEQ ID NOs: 8001-8019. In some embodiments, the second XTEN polypeptide is at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, or at least 500 amino acids in length.
  • the BPXTEN polypeptides provided herein comprise a first XTEN polypeptide comprising a fust RS sequence proximal but not comprising the C-terminus of the polypeptide, covalently linked to a fust and second biologically active polypeptide covalently linked in tandem, wherein a second XTEN polypeptide is covalently linked to the C-terminus of the tandemly linked biologically active polypeptides, wherein the second XTEN polypeptide comprises a second RS sequence proximal to but not comprising the N-terminus of the second XTEN polypeptide, wherein the fust and second RS sequences can be the same or different.
  • the second XTEN polypeptide comprises an amino acid sequence that is longer than the amino acid sequence of the first XTEN polypeptide.
  • the first or second biologically active protein or both comprises a specific binding protein, in certain embodiments wherein the specific binding protein specifically binds to an antigen or agonist expressed at a desired biological site.
  • the desired biological site is a tumor and the antigen is a tumor-specific antigen.
  • the first and second biologically active polypeptide are different, including but not limited to have different specific binding affinities.
  • nucleic acid comprising a polynucleotide encoding a polypeptide such as any XTEN or BPXTEN polypeptide disclosed herein or the reverse complement of said polynucleotide.
  • an expression vector comprising any polynucleotide sequence such disclosed herein and a regulatory sequence operably linked to the polynucleotide sequence that regulates expression or other biological activity of said polynucleotide.
  • a host cell comprising an expression vector as disclosed herein.
  • the host cell is a prokaryote.
  • the host cell is E. coli.
  • the host cell is a mammalian cell.
  • compositions comprising a polypeptide as disclosed herein and one or more pharmaceutically acceptable excipients.
  • the pharmaceutical composition is formulated for administration to an animal and in particular a human, wherein said administration can be by any therapeutically effective administration route
  • Pharmaceutical compositions as disclosed herein can be prepared and used in any formulation known in the art and particularly adapted to administration route, site, and intended effect on the human or animal.
  • a polypeptide as disclosed herein and particularly a BPXTEN polypeptide in the preparation of a medicament for the treatment of a disease, disorder, or condition in a human or animal.
  • the disease, disorder, or condition can be cancen-
  • a method of treating a disease in a human or animal human or animal as disclosed hereinabove and throughout this disclosure comprising administering to the human or animal in need thereof one or more therapeutically eifective doses of a pharmaceutical composition.
  • the pharmaceutical composition is administered to the human or animal as one or more therapeutically effective doses administered on a clinically appropriate schedule daily, weekly, monthly, or annually and at a clinically appropriate dose
  • a mixture comprising a plurality of polypeptides, particularly XTEN and BPXTEN polypeptides as disclosed herein of varying length, the mixture comprising: a first set of polypeptides, wherein each polypeptide of the first set of polypeptides comprises a barcode fragment that is releasable from the polypeptide by digestion with a protease and has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragments that are releasable from the first set of polypeptides; and a second set of polypeptides lacking the barcode fragment of the first set of polypeptides; wherein both the first set of polypeptides and the second set of polypeptides each comprise a reference fragment that is common to first set of polypeptides and the second set of polypeptides and produced by digestion with the protease; and wherein the ratio of the first set of polypeptides to polypeptides comprising the reference
  • ratio of the first set of polypeptides to polypeptides comprising the reference fragment is greater than 0.8, 0.9, 0.95, or 0.98.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the protease is a protease that cleaves on the C-terminal side of glutamic acid residues.
  • barcode release from polypeptides comprising the first set of polypeptides is facilitated by pepsin, elastase, thermolysin, or Glu-C proteases.
  • barcode release is facilitated by Glu-C protease.
  • the protease is not trypsin.
  • the polypeptides of varying lengths comprise polypeptides comprising at least one XTEN polypeptide as set forth herein.
  • the first set of polypeptides comprises a full-length polypeptide, wherein the barcode fragment is a portion of the full-length polypeptide.
  • the full-length polypeptide is any polypeptide disclosed herein and particularly XTEN and BPXTEN polypeptides.
  • the barcode fragment docs not comprise either the N-terrainal amino acid or C-terminal amino acid of the full- length polypeptide.
  • the mixture of polypeptides of varying lengths differ from one another due to N-terminal truncation, C-terminal truncation, or both N- and C-terminal truncation of a full- length polypeptide.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the protease cleaves the polypeptides of varying length on the C-terminal side of glutamic acid residues that are not followed by a proline residue.
  • the protease is a Glu-C protease.
  • the protease is not trypsin.
  • determining a ratio of the amount of barcode fragments to the amount of reference fragments comprises quantifying barcode fragments and reference fragments from the mixture after the mixture of polypeptides has been contacted with the protease.
  • the barcode fragments and the reference fragments are identified based their respective masses.
  • the barcode fragments and the reference fragments are identified via mass spectrometry. In some embodiments, the barcode fragments and reference fragments are identified via liquid chromatography-mass spectrometry (LC-MS). In some embodiments, determining a ratio of the barcode fragments to the reference fragments comprises isobaric labeling or stable isotope labeling. In some embodiments, determining a ratio of the barcode fragments to the reference fragments comprises spiking the mixture with one or both of an isotope-labeled reference fragment and an isotope labeled barcode fragment.
  • LC-MS liquid chromatography-mass spectrometry
  • the polypeptides of varying length comprise a full-length polypeptide and truncated fragments thereof.
  • the mixture of polypeptides of varying lengths differ from one another due to N-tcrminal truncation, C-terminal truncation, or both N- and C-terminal truncation of a full-length polypeptide.
  • the ratio of the amount of barcode fragments to reference fragments is greater than 0.5, 0.6, 0.7, 0.8, 0.9, 0.95, 0.98, or 0.99.
  • a mixture comprising a plurality of polypeptides of varying length, the mixture comprising a first set of polypeptides, wherein each polypeptide of the first set of polypeptides comprises a barcode fragment that is releasable from the polypeptide by digestion w'ith a protease and has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragments that are releasable from the first set of polypeptides.
  • Said embodiment also includes a second set of polypeptides lacking the barcode fragment of the first set of polypeptides, wherein both the first set of polypeptides and the second set of polypeptides each comprise a reference fragment that is common to first set of polypeptides and the second set of polypeptides and releasable by digestion with the protease.
  • the number of reference fragments quantified in the polypeptide mixture after protease digestion is equal to the sum of the number of the first and second set of polypeptides in the mixture, and the number of barcode fragments quantified in the polypeptide mixture after protease digestion is equal to the number of the first set of polypeptides in the mixture;.
  • the first set of polypeptides comprises one reference fragment the ratio of the first set of polypeptides to polypeptides in the mixture comprising the reference fragment is greater than 0.7.
  • the mixture has a ratio of the first set of polypeptides to polypeptides comprising the reference fragment greater than 0.8, 0.9, or 0.95.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides. In alternative embodiments the reference fragment occurs twice in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the first set of polypeptides comprises a full-length polypeptide, wherein the barcode fragment is a portion of the full-length polypeptide.
  • the full-length polypeptide includes the polypeptides disclosed herein.
  • the mixture barcode fragment does not comprise the N-terminal amino acid and C-terminal amino acid of the full-length polypeptide.
  • the mixture contains polypeptides of varying lengths that differ from one another due to N-terminal truncation, C-terminal truncation, or both N-terminal and C-terminal truncation of a full- length polypeptide.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the number of reference fragments in the first set of polypeptides can differ from the number of reference fragments in the second set of polypeptides but the number thereof in each polypeptide of each set must be the same.
  • each of the reference fragments in the polypeptides of the mixture has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragments.
  • a mixture comprising a plurality of polypeptides of varying length, the mixture comprising a first set of polypeptides, wherein each polypeptide of the first set of polypeptides comprises a barcode fragment that is releasable from the polypeptide by digestion with a protease and has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragments that are releasable from the first set of polypeptides.
  • the mixture further comprises a second set of polypeptides lacking the barcode fragment of the first set of polypeptides wherein both the first set of polypeptides and the second set of polypeptides each comprise a reference fragment that is common to first set of polypeptides and the second set of polypeptides and releasable by digestion with the protease.
  • the ratio of the first set of polypeptides to polypeptides in the mixture has the formula:
  • Ibarcode-containing polypeptides preference peptide-containing polypeptides) x Nj where N is the number of occurrences of the reference peptide that is released from each polypeptide in the mixture, and wherein when the first set of polypeptides comprises one reference fragment the ratio of the first set of polypeptides to polypeptides in the mixture comprising the reference fragment is greater than 0.7.
  • the ratio of the first set of polypeptides to polypeptides comprising the reference fragment is greater than 0.8, 0.9, or 0.95.
  • the reference fragment in the occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the reference fragment occurs twice in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the first set of polypeptides comprises a full-length polypeptide, wherein the barcode fragment is a portion of the full-length polypeptide.
  • the full-length polypeptide includes the polypeptides disclosed herein.
  • the barcode fragment does not comprise the N-terminal amino acid and C-terminal amino acid of the full-length polypeptide.
  • the mixture of polypeptides of varying lengths differ from one another due to N- terminai truncation, C-terminal truncation, or both N-terminal and C-tcrminal truncation of a full-length polypeptide.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the number of reference fragments in the first set of polypeptides can differ from the number of reference fragments in the second set of polypeptides but the number thereof in each polypeptide of each set must be the same.
  • the reference fragments in the polypeptides of the mixture has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragments.
  • a method of detecting sequence integrity of polypeptides comprising the first set of polypeptides in the mixture disclosed herein, the method comprising the steps of digesting the mixture of polypeptides with a protease that releases the barcode fragment and the reference fragment from the first set of polypeptides and releases the reference fragment from the second set of polypeptides, and determining a ratio of the barcode fragments from the first set of polypeptides to the reference fragments from the first and second set of polypeptides.
  • sequence integrity of polypeptides of the first set of polypeptides are detected by a comparison of the ratio of the fragments to the expected ratio of the fragments based on the number of barcode fragments and reference fragments in polypeptides comprising the first and second set of polypeptides.
  • the methods contemplated herein are readily amenable to qualitative and quantitative analysis of the polypeptides that contain the barcodes and/or reference fragments, for example by use of LC/MS.
  • the LC/MS is quantitative and detects an isotopically distinguishable amount of bar code fragments, reference fragments, or both.
  • the mixture of polypeptides is spiked with a known amount of a “standard material” to facilitate such analysis.
  • a standard material is one which comprises an isotopically-labelled version of said mixture of a plurality of polypeptides of varying length that are to be analyzed.
  • This isotopically labelled standard may be added to the mixture as a complete sequence prior to digestion by said protease.
  • the test sample of the mixture of polypeptides of varying length and the isotopically labelled standard material are digested by the protease in separate reactions and the protease-digested isotopically labelled standard material is added to the test sample prior to analysis by LC/MS.
  • the methods of the present invention further comprise quantitating the amount of bar code fragments, reference fragments or both from the test sample by comparison to the quantification of the detected isotopically distinguishable amounts of bar code fragments, reference fragments, or both.
  • Figure 1 depicts a mixture of XTENyla!ed Protease-Activated T Cell Engager (“XPAT”) polypeptides having varying lengths of XTEN polypeptides.
  • the full-length XPAT (top) comprises a 288 amino acid-long XTEN polypeptide at the N-terminus and a 864 amino acid-long XTEN polypeptide at the C-terminus.
  • Various truncations can occur in the XPAT in one or both of the N- and C-terminal XTEN polypeptides, for example, during fermentation, purification or other steps in product preparation.
  • While products having limited truncations can function in a manner similar to the full-length construct, severe truncations (truncations closer to a portion of the XTEN polypeptide proximal from Protease-Activated T Cell Engager linked thereto) can possess significantly different pharmacological properties from their full-length counterparts.
  • the presence of truncations poses a challenge for quantifying the pharmacologically efficacious and inefficacious variants in an XPAT product.
  • each XTEN polypeptide has a proximal end and a distal end, wherein the proximal end is located, relative to the distal end, closer to the biologically active polypeptide (e g ⁇ , T-cell engager, cytokine, monoclonal antibody (mAb), antibody fragment, or other protein that is XTENylated).
  • the biologically active polypeptide e g ⁇ , T-cell engager, cytokine, monoclonal antibody (mAb), antibody fragment, or other protein that is XTENylated.
  • the proximal or distal ends of the XTEN polypeptide can correspond to the XTEN polypeptide's N-terminus or C-terminus.
  • Figure 2 depicts a mixture of XPAT polypeptides having varying lengths of barcoded XTEN polypeptides.
  • the 288 amino acid-long N-terminal XTEN polypeptide contains three cleavably fused barcode sequences, “NA,” “NB,” and “NC” (from distal end to proximal end), and the 864 amino acid-long C-terminal XTEN polypeptide contains three cleavably fused barcode sequences, “CC,” “CB,” and “CA” (from proximal end to distal end).
  • Each barcode is located to indicate a pharmacologically relevant length of the corresponding XTEN polypeptide.
  • minor N-terminal truncation products of the XPAT lacking the barcode “NA” but having the more proximal barcodes “NB” and “NC,” can show substantially the same pharmacological properties as the full-length construct.
  • major N-terminal truncation products of the XPAT e.g., lacking all three barcodes on the N-terminus, can discemibly differ in pharmacological activity from the full-length construct.
  • a unique proleolytically cleavable sequence is identified from the biologically active polypeptide (here, the tandem scFvs that comprise the active portion of the T-cell engager) of the XPAT.
  • the unique proteolytically cleavable sequence can be used as a reference for quantifying the amounts of various truncation products in relation to the total amount of the biologically active protein.
  • Figure 3 illustrates a potential design for a barcoded XTEN polypeptide by inserting a barcode- generating sequence into a general-purpose (or regular) XTEN polypeptide.
  • the exemplaiy general-purpose (or regular) XTEN polypeptide (top) comprises non-overlapping 12-mer motifs in the sequence “BCDABDCDABDCBDCDABDCB,” wherein the sequence motifs “A,” “B,” “C,” and “D” occur 3, 6, 5, and 7 times, respectively.
  • Glu-C protease digest of the exemplary general-purpose XTEN polypeptide (upper panel) does not yield unique peptides except both termini (“NT’- and “CT”).
  • a barcode-generating sequence e.g., a unique 12-mer
  • the barcode- generaling sequence, “X” can be located wherein the resulting barcode marks a pharmacologically-relevant length of the XTEN polypeptide.
  • an XTEN polypeptide lacking a barcode can functionally differ from the corresponding XTEN polypeptide with the barcode.
  • the barcode-generating sequence (“X”) can be the barcode sequence itself.
  • the barcodegenerating sequence (“X”) can differ from the resulting barcode sequence.
  • the barcode sequence can overlap with and, thus, contain part of the preceding or following 12-mer motif.
  • Figures 4A-4B illustrate the quantification of the level of truncation for an N-terminal XTEN polypeptide.
  • Figure 4A demonstrates that a barcoded XTEN polypeptide (bottom panel) can be constructed by replacing a sequence motif in a general-purpose XTEN polypeptide (top panel) (e.g ., the third sequence motif from the N-terminus, “O’ " ) with a barcode-generating motif, “X”; and, in this example, the barcode-generating motif (“X”) is itself the unique proteolytically cleavable barcode sequence.
  • the barcode is located wherein all the severe truncation forms of the XTEN polypeptide lack the barcode, and all the limited truncation forms of the XTEN polypeptide contain the barcode.
  • Figure 4B illustrates the relative abundance of various cleavage products in two different mixtures of XPAT. In one of the mixtures, the barcode is present in 99% of the constructs that contain the biologically active protein. In the other one of the mixtures, 13% of the constructs are lack a barcode.
  • Figures 4A-4B illustrate the use of barcoded XTEN polypeptide to differentiate between two polypeptide mixtures having substantially similar average molecular weights but discemibly different pharmacological activities
  • Figure 5A illustrates analytical size exclusion chromatography (SEC) of XPAT protein and detection of full-length protein and truncated derivatives thereof.
  • the Synthetic protein + truncates fraction includes fragments as large as intact synthetic protein.
  • Figure 5B illustrates the abundance of Barcode peptides in XPAT preparations as detected by mass spectrometry. Each measurement is the XIC area of N-Barcode SGPGSTPAE (SEQ ID No. 8029) and, C- Barcode GSAPGTE (SEQ ID No. 8023) normalized to a 400nM Spike of its corresponding heavy isotope labeled Synthetic peptide.
  • polypeptide As used in the specification and claims, the singular forms “a,” “an,” and “the” include plural references unless the context clearly dictates otherwise.
  • a cell includes a plurality of cells, including mixtures thereof.
  • the terms '‘polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified, for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including but not limited to glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics. Standard single or three letter codes are used to designate amino acids.
  • a “host cell” includes an individual cell or cell culture which can be or has been a recipient for the human or animal vectors.
  • Host cells include progeny of a single host cell. The progeny are not necessarily completely identical (in morphology or in genomic of total DNA complement) to the original parent cell due to naturally occurring or genetically engineered variation.
  • a “chimeric” protein contains at least one polypeptide comprising regions in a different position in the sequence than that which occurs in nature.
  • the regions can normally exist in separate proteins and are brought together in the fusion polypeptide; or they can normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide.
  • Said proteins can be described as “conjugated,” “linked,” ‘"fused,” or “fusion” proteins; these terms are used interchangeably herein and refer to the joining together of two more polypeptide sequences by whatever means including chemical conjugation or recombinant means.
  • a chimeric protein can be created, for example, by chemical synthesis, or by' creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
  • polynucleotides are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • Polynucleotides can have any three-dimensional structure, and can perform any function, known or to be discovered or developed.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polymer.
  • the sequence of nucleotides can be interrupted by nonnucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • complement of a polynucleotide denotes a polynucleotide molecule having a complementary base sequence and reverse orientation as compared to a reference sequence, wherein it could hybridize with a reference sequence with complete fidelity.
  • polynucleotides having “homology” or that are “homologous” are those which hybridize under stringent conditions as defined herein and have at least 70%, preferably at least 80%, more preferably at least 90%, more preferably 95%, more preferably 97%, more preferably 98%, and even more preferably 99% sequence identity to those sequences.
  • percent identity * and “% identity,” as applied to polynucleotide sequences, refer to the percentage of residue matches between at least two polynucleotide sequences aligned using a standardized algorithm. Such an algorithm can insert, in a standardized and reproducible way, gaps in the sequences being compared in order to optimize alignment between two sequences, and therefore achieve a more meaningful comparison of the two sequences.
  • Percent identity can be measured over the length of an entire defined polynucleotide sequence, for example, as defined by a particular SEQ ID number, or can be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polynucleotide sequence, for instance, a fragment of at least 45, at least 60, at least 90, at least 120, at least 150, at least 210 or at least 450 contiguous residues.
  • Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, in the tables, figures or Sequence Listing, can be used to describe a length over which percentage identity can be measured.
  • ‘'Percent (%) amino acid sequence identity,” with respect to the polypeptide sequences identified herein, is defined as the percentage of amino acid residues in a query sequence that are identical with the amino acid residues of a second, reference polypeptide sequence or a portion thereof, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
  • Percent identity can be measured over the length of an entire defined polypeptide sequence, for example, as defined by a particular SEQ ID number, or can be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polypeptide sequence, for instance, a fragment of at least 15, at least 20, at least 30, at least 40, at least 50, at least 70 or at least 150 contiguous residues.
  • Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, in the tables, figures or Sequence Listing, can be used to describe a length over which percentage identity can be measured.
  • ‘"repetitiveness” of an XTEN polypeptide amino acid sequence refers to 3-mer repetitiveness and can be measured by computer programs or algorithms or by other means known in the art.
  • the 3-mer repetitiveness of an XTEN polypeptide amino acid sequence can be assessed by determining the number of occurrences of the overlapping 3-mer sequences w'ithin the polypeptide. For example, a polypeptide of 200 amino acid residues has 198 overlapping 3-amino acid sequences (3-mers), but the number of unique 3- mer sequences depends on the amount of repetitiveness within the sequence.
  • a score can be generated (hereinafter “subsequence score”) that is reflective of the degree of repetitiveness of the 3-mers in the overall polypeptide sequence.
  • subsequence score means the sum of occurrences of each unique 3-mer frame across a 200 consecutive amino acid sequence of the polypeptide divided by the absolute number of unique 3-mer subsequences within the 200 amino acid sequence. Examples of such subsequence scores derived from the first 200 amino acids of repetitive and non -repetitive polypeptides are presented in Example 73 of International Patent Application Publication No. WO 2010/091122 A 1, which is incorporated by reference in its entirety.
  • the present invention provides BPXTEN polypeptides each comprising at least one XTEN polypeptide in which the XTEN polypeptide amino acid sequence can have a subsequence score less than 16, or less than 14, or less than 12, or more preferably less than 10.
  • substantially non-repetitive XTEN polypeptide amino acid sequence refers to an XTEN polypeptide, wherein there are few or no instances of four contiguous amino acids in the XTEN polypeptide amino acid sequence that are identical amino acid types and wherein the XTEN polypeptide amino acid sequence has a subsequence score (defined in the preceding paragraph herein) of 12, or 10 or less or that there is not a pattern in the order, from N- to C-terminus, of the sequence motifs that constitute the polypeptide sequence.
  • non-overlapping sequence motifs includes sequence motifs that arc completely non-overlapping as well as sequence motifs that are only partially non-overlapping, provided that said partially non-overlapping sequence motifs are not completely overlapping.
  • a ‘ Vector” is a nucleic acid molecule, preferably self-replicating in an appropriate host, which transfers an inserted nucleic acid molecule into and/or between host cells.
  • the term includes vectors that function primarily for insertion of DNA or RNA into a cell, replication of vectors that function primarily for the replication of DNA or RNA, and expression vectors that function for transcription and/or translation of the DNA or RNA. Also included are vectors that provide more than one of the above functions.
  • An “expression vector” is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide(s).
  • An “expression system” usually connotes a suitable host cell comprised of an expression vector that can function to yield a desired expression product.
  • ti / 2 as used herein means the terminal half-life calculated as ln(2)/K «i .
  • Kei is the terminal elimination rate constant calculated by linear regression of the terminal linear portion of the log concentration vs. time curve.
  • Half-life typically refers to the time required for half the quantity of an administered substance deposited in a living organism to be metabolized or eliminated by normal biological processes.
  • ii / z terminal half-life
  • elimination half-life and “circulating half-life” are used interchangeably herein.
  • antigen antigen
  • target antigen or “immunogen” are used interchangeably herein to refer to the structure or binding determinant that an antibody fragment or an antibody fragment-based therapeutic binds to or has specificity against.
  • payload refers to a protein or peptide sequence that has biological or therapeutic activity; the counterpart to the pharmacophore of small molecules.
  • payloads include, but are not limited to, cytokines, enzymes, hormones and blood and growth factors.
  • Payloads can further comprise genetically fused or chemically conjugated moieties such as chemotherapeutic agents, antiviral compounds, toxins, or contrast agents. These conjugated moieties can be joined to the rest of the polypeptide via a linker which can be cleavable or non-cleavable.
  • treatment or “‘treating,” “palliating,” and “ameliorating” are used interchangeably herein and refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disease condition wherein an improvement is observed in the human or animal, notwithstanding that the human or animal can still be afflicted with the underlying disorder.
  • the compositions can be administered to a human or animal at risk of developing a particular disease condition, or to a human or animal reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease cannot have been made.
  • a “therapeutic effect,” as used herein, refers to a physiologic effect, including but not limited to the cure, mitigation, amelioration, or prevention of disease condition in humans or other animals, or to otherwise enhance physical or mental wellbeing of humans or animals, caused by a fusion polypeptide of the invention other than the ability to induce the production of an antibody against an antigenic epitope possessed by the biologically active protein. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
  • terapéuticaally effective amount refers to an amount of a biologically active protein, either alone or as a part of a fusion protein composition, that is capable of having any detectable, beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition when administered in one or repeated doses to a human or animal. Such effect need not be absolute to be beneficial.
  • the disease condition can refer to a disorder or a disease.
  • terapéuticaally effective dose regimen refers to a schedule for consecutively administered doses of a biologically active protein, either alone or as a part of a fusion protein composition, wherein the doses are given in therapeutically effective amounts to result in sustained beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition.
  • polypeptides comprising one or more extended recombinant polypeptides (XTEN or XTENs) (as described more fully hereinbelow) that can be fused or otherwise conjugated to another polypeptide, particularly a biologically active polypeptide, wherein said embodiments are termed BPXTEN herein.
  • XTEN extended recombinant polypeptides
  • the polypeptide comprises a first XTEN polypeptide (such as those described below in the 'EXTENDED RECOMBINANT POLYPEPTIDE (XTEN)” section or described anywhere else herein).
  • the polypeptide further comprises a second XTEN polypeptide (such as those described below in the ‘EXTENDED RECOMBINANT POLYPEPTIDE (XTEN)” section or described anywhere else herein).
  • the polypeptide comprises an XTEN polypeptide at or near its N-terminus (an “N- terminal XTEN”).
  • the polypeptide comprises an XTEN polypeptide at or near its C- terminus (a “C-terminal XTEN”).
  • the polypeptide comprises both an N-terminal XTEN polypeptide and a C-terminal XTEN polypeptide.
  • the first XTEN polypeptide is an N- terminal XTEN polypeptide and the second XTEN polypeptide is a C-terminal XTEN polypeptide.
  • the polypeptide can further comprise a biologically active polypeptide (“BP”) linked to the XTEN polypeptide, thereby' forming a XTEN -containing fusion polypeptide termed an “BPXTEN” polypeptide herein.
  • BP biologically active polypeptide
  • the XTEN polypeptide can comprise one or more barcode fragments (as described more fully below) releasable (configured to be released) from the XTEN polypeptide upon digestion of the fusion polypeptide (or BPXTEN) by a protease.
  • each barcode fragment differs in sequence and molecular weight from all other peptide fragments (including all other barcode fragments if present) that are releasable from the polypeptide upon complete digestion of the polypeptide by the protease.
  • the (fusion) polypeptide can comprise one or more reference fragments (as described more fully below) releasable (configured to be released) from the polypeptide, for example, upon the protease digestion which releases the barcode fragmcnt(s) from the polypeptide.
  • each reference fragment can be a single reference fragment that differs in sequence and molecular weight from all other peptide fragments that are releasable from the polypeptide upon digestion of the polypeptide by the protease.
  • the XTEN polypeptide comprises at least 150 amino acids. In some embodiments, the XTEN polypeptide is from 150 to 3,000 amino acids in length, or from 150 to 1,000 amino acids in length, or at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, or at least 500 amino acids in length. In some embodiments, at least 90% of the amino acid residues of the XTEN polypeptide are glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) or proline (P).
  • G glycine
  • A alanine
  • S serine
  • T threonine
  • E glutamate
  • P proline
  • At least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of the amino acid residues of the XTEN polypeptide are selected from G, A, S, T, E, or P.
  • the XTEN polypeptide comprises at least 4 different types G, A, S, T, E, or P amino acids.
  • the XTEN polypeptide is characterized in that it comprises at least 150 amino acids; at least 90% of the amino acid residues of the XTEN polypeptide are G, A, S, T, E, or P and it comprises at least 4 different types of amino acids selected from G, A, S, T, E, and P that is substantially randomized with respect to any other nonoverlapping sequence motif comprising the XTEN polypeptide.
  • an XTEN-containing fusion polypeptide e.g., a fusion polypeptide comprising a biologically active polypeptide conjugated therewith
  • the sum of the total number of amino acids in the first XTEN and the total number of amino acids in the second XTEN polypeptide is at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, or at least 800 amino acids.
  • the XTEN polypeptides provided herein comprise, or are formed from, a plurality of non-overlapping sequence motifs.
  • at least one of the non-overlapping sequence motifs is recurring (or repeated at least two times in the XTEN), and wherein at least another one of the non-overlapping sequence motifs is non-recurring (or found only once within the XTEN).
  • the plurality of non-overlapping sequence motifs comprises a set of (recurring) non-overlapping sequence motifs, wherein each of said sequence motifs is repeated at least two times in the XTEN; and a nonoverlapping (non-recurring) sequence motif that occurs (or is found) only once within the XTEN.
  • each non-overlapping sequence motif is from 9 to 14 (or 10 to 14, or 11 to 13) amino acids in length. In some embodiments, each non-overlapping sequence motif is 12 amino acids in length. In some embodiments, the plurality of non-overlapping sequence motifs comprises a set of non-overlapping (recurring) sequence motifs, wherein each of said sequence motifs is repeated at least two times in the XTEN; and is between 9 and 14 amino acids in length. In some embodiments, the set of (recurring) non-overlapping sequence motifs comprises 12-raer sequence motifs identified herein by SEQ ID NOs: 182-203 and 1715-1722 in Table 1.
  • the set of (recurring) non-overlapping sequence motifs comprises 12-mer sequence motifs identified herein by SEQ ID NOs: 186-189 in Table 1. In some embodiments, the set of (recurring) non-overlapping sequence motifs comprise at least two, at least three, or all four of 12-mer sequence motifs of SEQ ID NOs: 186-189 in Table 1. Table 1. Exemplary 12-Mer Sequence Motifs for Construction of XTENs
  • Denotes individual motif sequences that, when used together in various permutations, results in a “family sequence”
  • the polypeptides provided herein comprise a barcode fragment (e.g., a first, second, or third barcode fragment of an XTEN polypeptide) releasable from the polypeptide upon digestion by a protease.
  • the barcode fragment is a portion of the XTEN that includes at least part of the (non-recurring, non-overlapping) sequence motif that occurs (or is found) only once within the XTEN; and differs in sequence and molecular weight from all other peptide fragments that are releasable from the polypeptide upon complete digestion of the polypeptide by the protease.
  • barcode fragment (or “barcode,’ 7 or “barcode sequence”) can refer to either the portion of the XTEN identified herein by cleavably fused within the polypeptide, or the resulting peptide fragment released from the polypeptide.
  • the barcode fragment docs not include the N-terminal amino acid or the C- terminal amino acid of the XTEN polypeptide. As described more fully below or described anywhere herein, in some embodiments, the barcode fragment is releasable (configured to be released) upon Glu-C digestion of the fusion polypeptide. In some embodiments, the barcode fragment does not include a glutamic acid that is immediately adjacent to another glutamic acid in the XTEN polypeptide. In some embodiments, the barcode fragment has a glutamic acid at its C-terminus.
  • the C- terminus of a barcode fragment can refer to the “last” (or the most C-terminal) amino acid residue within the barcode fragment, when cleavably fused within an XTEN polypeptide, even if other “non-barcode” amino acid residues are located C-terminal to the barcode fragment within the same XTEN polypeptide.
  • the barcode fragment has an N-terminal amino acid that is immediately preceded by a glutamic acid residue.
  • the glutamic acid residue that precedes the N-terminal amino acid is not immediately adjacent to another glutamic acid residue.
  • the barcode fragment does not include a glutamic acid residue at a position other than the C-terminus of the barcode fragment unless the glutamic acid is immediately followed by a proline. In some embodiments, the barcode fragment is located from 10 to 150, or 10 to 125 amino acids from either the N-tcrminus of the polypeptide or the C-terminus of the polypeptide.
  • the barcode fragment is located within, or at a location of, 300, 280, 260, 250, 240, 220, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 48, 40, 36, 30, 24, 20, 12, or 10 amino acids from the N-terminus of the polypeptide, or at a location in a range between any of the foregoing. In some embodiments, the barcode fragment is located within 200, within 150, within 100, or within 50 amino acids of the N-terminus of the polypeptide.
  • the barcode fragment is located between 10 and 200, between 30 and 200, between 40 and 150, or between 50 and 100 amino acids from the N-terminus of the polypeptide. In some embodiments, the barcode fragment is located within 300, 280, 260, 250, 240, 220, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 48, 40, 36, 30, 24, 20, 12, or 10 amino acids from the C-terminus of the polypeptide, or in a range between any of the foregoing. In some embodiments, the barcode fragment is located within 200, within 150, within 100, or within 50 amino acids of the C-terminus of the polypeptide.
  • the barcode fragment is located between 10 and 200, between 30 and 200, between 40 and 150, or between 50 and 100 amino acids from the C-terminus of the polypeptide. In some embodiments, the barcode fragment does not include the N-terminal amino acid or the C-terminal amino acid of the polypeptide; does not include a glutamic acid that is immediately adjacent to another glutamic acid in the XTEN; has a glutamic acid at its C-terminus; has an N-terminal amino acid that is immediately preceded by a glutamic acid residue; and (v) is located from 10 to 150, or 10 to 125 amino acids from either the N -term in us of the polypeptide or the C-terminus of the polypeptide.
  • the glutamic acid residue that precedes the N-terminal amino acid is not immediately adjacent to another glutamic acid residue.
  • the barcode fragment does not include a glutamic acid residue at a position other than the C-terminus of the barcode fragment unless the glutamic acid is immediately followed by a proline.
  • at least one barcode fragment (or at least two barcode fragments, or three barcode fragments) contained in the barcoded XTEN is located at least 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300 amino acids from the biologically active polypeptide.
  • the barcode fragment is at least 4, at least 5, at least 6, at least 7, or at least 8 amino acids in length. In some embodiments, the barcode fragment is at least 4 amino acids in length. In some embodiments, the barcode fragment is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 amino acids in length, or in a range between any of the foregoing values. In some embodiments, the barcode fragment is between 4 and 20, between 5 and 15, between 6 and 12, or between 7 and 10 amino acids in length. In some embodiments, the barcode fragment is selected from SEQ ID NOs: 8020-8030 (BAR001- BAR011) in Table 2.
  • a barcoded XTEN polypeptide comprises only one barcode fragment.
  • a barcoded XTEN polypeptide comprises a set of barcode fragments, comprising a first barcode fragment, such as those described above or anywhere else herein.
  • each member of the set of barcode sequences can be distinguished from all other barcode sequences on the basis of amino acid sequence or molecular weight (wherein these methods for distinguishing different barcode sequences will be related).
  • the set of barcode fragments comprises a second barcode fragment (or a further barcode fragment), such as those described above or anywhere else herein.
  • the set of barcode fragments comprises a third barcode fragment, such as those described above or anywhere else herein.
  • the set of barcode fragments fused within an N-terminal XTEN polypeptide can be referred to as an N-terminal set of barcodes (“an N-terminal set”).
  • the set of barcode fragments fused within a C-terminal XTEN polypeptide can be referred to as a C-terminal set of barcodes (“a C-terminal set”).
  • the N-terminal set comprises a first barcode fragment and a second barcode fragment.
  • the N-terminal set further comprises a third barcode fragment.
  • the C-terminal set comprises a first barcode fragment and a second barcode fragment. In some embodiments, the C-terminal set further comprises a third barcode fragment. In some embodiments, the second barcode fragment is located N-terminal to the first barcode fragment of the same set. In some embodiments, the second barcode fragment is located C- terminal to the first barcode fragment of the same set. In some embodiments, the third barcode fragment is located N-terminal to both the first and second barcode fragments. In some embodiments, the third barcode fragment is located C-terminal to both the first and second barcode fragments. In some embodiments, the third barcode fragment is located between the first and second barcode fragments.
  • the polypeptide comprises a set of barcode fragments that includes a first barcode fragment, a further (second) barcode fragment, and at least one additional barcode fragment, wherein each barcode fragment of the set of barcode fragments is a portion of the second XTEN polypeptide and differs in sequence and molecular weight from all other peptides fragments that arc releasable from the polypeptide upon complete digestion of the polypeptide by the protease.
  • Amino acid sequences of 13 exemplary barcoded XTENs containing one barcode (e.g., SEQ ID NOs: 8002-8003, 8005-8009, and 8013), or two barcodes (e.g., SEQ ID NOs: 8001, 8004, 8010, and 8012), or three barcodes (e.g., SEQ ID NO: 8011), arc illustrated in Tabic 3a.
  • one barcode e.g., SEQ ID NOs: 8002-8003, 8005-8009, and 8013
  • two barcodes e.g., SEQ ID NOs: 8001, 8004, 8010, and 8012
  • three barcodes e.g., SEQ ID NO: 8011
  • the XTEN polypeptide has at least 90%, at least 92%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence selected from SEQ ID NOs: 8001-8019 in Tabic 3a.
  • a barcoded XTEN polypeptide can be obtained by making one or more mutations to a general-purpose XTEN polypeptide, such as any listed in Table 3b, according to one or more of the following criteria: to minimize the sequence change in the XTEN polypeptide, to minimize the amino acid composition change in the XTEN polypeptide, to substantially maintain the net charge of the XTEN polypeptide, to substantially maintain (or improve) low immunogenicity of the XTEN polypeptide, and to substantially maintain (or improve) the pharmacokinetic properties of the XTEN polypeptide.
  • the XTEN polypeptide amino acid sequence has at least 90%, at least 92%, at least 95%, at least 98%, at least 99%, or 100% sequence identity to any one of SEQ ID NOs: 676-734 listed in Table 3b.
  • the XTEN sequence having at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) but less than 100% sequence identity to any of SEQ ID NOs: 676-734 listed in Table 3b, is obtained by one or more mutations (e.g., less than 10, less than 8, less than 6, less than 5, less than 4, less than 3, less than 2 mutations) of she corresponding sequence from Table 3b.
  • the one or more mutations comprise deletion of a glutamic acid residue, insertion of a glutamic acid residue, substitution of a glutamic acid residue, or substitution for a glutamic acid residue, or any combination thereof.
  • the XTEN polypeptide amino acid sequence differs from, but has at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) sequence identity to, any one of SEQ ID NGs: 676-734 listed in Table 3b, at least 80%, at least 90%, at least 95%, at least 97%, or about 100% of the difference between the XTEN polypeptide amino acid sequence and the corresponding sequence of Table 3b involve deletion of a glutamic acid residue, insertion of a glutamic acid residue, substitution of a glutamic acid residue, or substitution for a glutamic acid residue, or any combination thereof.
  • At least 80%, at least 90%, at least 95%, at least 97%, or about 100% of the difference between the XTEN polypeptide am ino acid sequence and the corresponding sequence of Table 3b involve a substitution of a glutamic acid residue, or a substitution for a glutamic acid residue, or both.
  • the term “a substitution of a first ammo acid,” as used herein, refers to replacement of the first amino acid residue for a second amino acid residue, resulting in the second amino acid residue taking place at the substitution position in the obtained sequence.
  • a substitution of glutamic acid refers to replacement of the glutamic acid (E) residue for a non-glutamic acid residue (e.g., serine (8)).
  • a substitution for a first ammo acid refers to replacement of a second amino acid residue for the first amino acid residue, resulting in the first anrino acid residue taking place at the substitution position in the obtained sequence.
  • a substitution for glutamic acid refers to replacement of a non-glutamic acid residue (e.g., serine (S)) for a glutamic acid residue.
  • amino acid mutations are performed on XTEN polypeptides of intermediate lengths to those of Table 3b, as well as XTEN polypeptides of longer lengths than those of Table 3b, such as those in which one or more 12-mer motifs of Table 1 are added to the N- or C- terminus of a general-purpose XTEN of Table 3b.
  • a barcoded XTEN polypeptide fused within a polypeptide chain adjacent to the N-terminus of the polypeptide chain (“N-terminal XTEN”) can be attached to a His tag of comprising a plurality of poly(His) residues, including six to eight His residues at the N-terminus to facilitate the purification of the fusion polypeptide.
  • a barcoded XTEN polypeptide fused within a polypeptide chain at the C -terminus of the polypeptide chain (“C-terminal XTEN polypeptide”) can be comprise or be attached to the sequence EPEA at the C-terminus to facilitate the purification of the fusion polypeptide.
  • the fusion polypeptide comprises both an N-terminal barcoded XTEN polypeptide and a C- terminal barcoded XTEN polypeptide, wherein the N-terminal barcoded XTEN is attached to a His tag of comprising a plurality of poly(His) residues, including six to eight His residues at the N-terminus; and wherein the C-terminal barcoded XTEN polypeptide is attached to the sequence EPEA at the C-terminus, thereby facilitating purification of the fusion polypeptide, for example, to at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least 99% purity by chromatography methods known in the art, including but not limited to I MAC chromatography, C-tagXL affinity matrix, and other such methods, including but not limited to those described in the EXAMPLES section below.
  • a barcode fragment as described above or anywhere else herein, can be cleavably fused within the XTEN polypeptide and releasable (configured to be released) from the XTEN polypeptide upon digestion of the polypeptide by a protease.
  • the protease is a Glu-C protease.
  • the protease cleaves on the C-terminal side of glutamic acid residues that are not followed by proline.
  • a barcoded XTEN polypeptide an XTEN polypeptide that contains barcode fragments
  • Glu-Glu (EE) residues in an XTEN sequence can result in varying cleavage patterns upon Glu-C digestion. Accordingly, when Glu-C protease is used for barcode release, the barcoded XTEN polypeptide or the barcode fragmcnt(s) can be without any Glu-Glu (EE) sequence.
  • a di-peptide Glu-Pro (EP) sequence if present in the fusion polypeptide, can be incapable of cleavage by Glu-C protease during the barcode release process.
  • a BPXTEN fusion protein comprises a single BP polypeptide and a single XTEN polypeptide
  • BPXTEN proteins can have at least the following permutations of configurations, each listed in an N- to C-terminus orientation: BP-XTEN; XTEN-BP; BP-S-XTEN; and XTEN-S-BP, wherein “S” is a spacer sequence as set forth below.
  • the BPXTEN protein comprises a C -terminal XTEN polypeptide and, optionally, a spacer sequence (S) between the XTEN polypeptide and the BP polypeptide.
  • S spacer sequence
  • Such BPXTEN protein can be represented by Formula 1 (depicted N- to C-terminus):
  • BP BP-(S)x-(XTEN)
  • I BP-(S)x-(XTEN)
  • S is a spacer sequence having between I to about 50 amino acid residues that can optionally include a BP release segment (as described more fully bereinbelow);
  • x is either 0 or 1 ;
  • XTEN can be any XTEN polypeptide described herein.
  • the BPXTEN protein comprises an N-terminal XTEN polypeptide and, optionally, a spacer sequence (S) between the XTEN polypeptide and the BP protein.
  • S spacer sequence
  • Such BPXTEN proteins can be represented by Formula II (depicted N- to C-terminus):
  • BP is a biologically active protein as described bereinbelow
  • S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a BP release segment (as described more fully bereinbelow)
  • x is either 0 or 1
  • XTEN can be any XTEN polypeptide as described herein.
  • the BPXTEN protein comprises both an N-terminal XTEN polypeptide and a C- terminal XTEN polypeptide.
  • Such BPXTEN proteins e.g., the XPATs in Figures 1-2
  • Formula III can be represented by Formula III:
  • BP is a biologically active protein as described hereinbe!ow
  • S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a BP release segment (as described more fully bereinbelow)
  • y is either 0 or 1
  • z is either 0 or 1
  • XTEN can be any XTEN polypeptide as described herein.
  • a biologically active protein (BP) that can be fused to one or more XTEN polypeptides (as described herein), particularly those disclosed hereinbelow', comprising sequences identified herein by Tables 4a-4h and Tables 6a-6f, together with their corresponding nucleic acid and amino acid sequences, are well known in the art. Descriptions and sequences of these BP are available in public databases such as Chemical Abstracts Services Databases (e g., the CAS Registry), Gen Bank. The Universal Protein Resource (UniProl) and subscription provided databases such as GenSeq (e.g., Derwent).
  • Polynucleotide sequences encoding BPs can be wildtype polynucleotide sequences encoding a native BP (e.g., either full length or mature), or in some instances the sequence can be a variant of a wildtype polynucleotide sequence (e g., a polynucleotide which encodes the wildtype, biologically active protein), wherein the nucleotide sequence of the polynucleotide has been optimized, for example, for expression in a particular species; or a polynucleotide encoding a variant of the wildtype protein, such as a site-directed mutant or an allelic variant.
  • a wildtype polynucleotide sequence e.g., a polynucleotide which encodes the wildtype, biologically active protein
  • BP for inclusion in BPXTEN proteins disclosed herein can include any protein of biologic, therapeutic, prophylactic, or diagnostic interest or function, or that is useful for mediating a biological activity or preventing or ameliorating a disease, disorder or conditions when administered to a human or animal.
  • BP for which an increase in a pharmacokinetic parameter, increased solubility, increased stability, masking of activity, or some other enhanced pharmaceutical property is sought, or those BP for which increasing the terminal half-life would improve efficacy, safety, or result in reduce dosing frequency and/or improve patient compliance.
  • BPXTEN fusion protein compositions can be prepared with various objectives in mind, including improving therapeutic efficacy of the bioactive compound by, for example, increasing in vivo exposure or the length of time that the BPXTEN remains within the therapeutic window when administered to a human or animal compared to a BP not linked to an XTEN polypeptide.
  • a BP can be a native, full-length protein or can be a fragment or a sequence variant of a biologically active protein that retains at least a portion of the biological activity of the native protein.
  • the BP incorporated into the human or animal compositions can be a recombinant polypeptide with a sequence corresponding to a protein found in nature.
  • the BP can be sequence variants, fragments, homologs, and mimetics of a natural sequence that retain at least a portion of the biological activity of the native BP.
  • a BP can be a sequence that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Tables 4a-4h.
  • a BP can be a bispecific sequence comprising a first binding domain and a second binding domain, wherein the first binding domain, having specific binding affinity to a tumor-specific marker or an antigen of a target cell, exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to paired VL and VH sequences of an anti-CD3 antibody identified in Table 6f; and wherein the second binding domain, having specific binding affinity to an effector cell, exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to paired VL and VH
  • a BPXTEN fusion protein can comprise a single BP protein linked to an XTEN polypeptide.
  • the BPXTEN protein can comprise a first BP and a second molecule of the same BP, resulting in a fusion protein comprising the two BP linked to one or more XTEN polypeptides (for example, two molecules of glucagon, or two molecules of hGH).
  • BP exhibits a binding specificity to a given target (or a given number of targets) or another desired biological characteristic when used in vivo or when utilized in an in vitro assay.
  • the BP can be an agonist, a receptor, a ligand, an antagonist, an enzyme, an antibody (e.g., mono- or bi-specific), or a hormone.
  • BP used or known to be useful for a disease or disorder wherein the native BP have a relatively short terminal half-life and for which an enhancement of a pharmacokinetic parameter (which optionally could be released from the fusion protein by cleavage of a spacer sequence) would permit less frequent dosing or an enhanced pharmacologic effect.
  • BP that have a narrow therapeutic window between the minimum effective dose or blood concentration (Cmin) and the maximum tolerated dose or blood concentration (Cmax).
  • Cmin minimum effective dose or blood concentration
  • Cmax maximum tolerated dose or blood concentration
  • the linking of the BP to a fusion protein comprising a select XTEN polypeptide sequence(s) can result in an improvement in these properties, making them more useful as therapeutic or preventive agents compared to BP not linked to one or more XTEN polypeptides.
  • Endocrine and obesity-related diseases or disorders have reached epidemic proportions in most developed countries, and represent a substantial and increasing health care burden in most developed nations, which include a large variety of conditions affecting the organs, tissues, and circulatory system of the body. Of particular concern are endocrine and obesity-related diseases and disorders, chief amongst which is diabetes, one of the leading causes of death in the United States.
  • Glucose-increasing peptides are exemplified by the peptide hormone glucagon, while glucose-lowering peptides include exendin-4, glucagon-like peptide 1, and amylin.
  • one aspect of the present invention is the incorporation of peptides involved in glucose homeostasis, insulin resistance and obesity (collectively, '‘glucose regulating peptides”) in BPXTEN fusion proteins to create compositions with utility in the treatment of glucose, insulin, and obesity disorders, disease and related conditions.
  • Suitable glucose-regulating peptides that can be linked to XTEN polypeptides disclosed herein to create BPXTEN proteins that include all biologically active polypeptides, inter alia , that increase glucose-dependent secretion of insulin by pancreatic beta-cells or potentiate the action of insulin.
  • Glucoseregulating peptides can also include biologically active polypeptides that stimulate pro-insulin gene transcription in the pancreatic beta-cells, Furthermore, glucose-regulating peptides can also include biologically active polypeptides that slow down gastric emptying time and reduce food intake. Glucoseregulating peptides can also include biologically active polypeptides that inhibit glucagon release from the alpha cells of the Islets of Langerhans. Table 4a provides a nonlimiting list of sequences of glucose-regulating peptides that can be encompassed by BPXTEN fusion proteins of the invention.
  • Glucose regulating peptides of the inventive BPXTEN compositions disclosed herein can be a peptide that exhibits at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to an amino acid sequence selected from Table 4a.
  • sequence identity e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • ADM adrenomedullin or “ADM” means the human adrenomedulin peptide honuone and species and sequence variants thereof having at least a portion of the biological activity of mature ADM.
  • ADM is generated from a 185 amino acid preprohormone through consecutive enzymatic cleavage and arnidation, resulting in a 52 amino acid bio active peptide with a measured plasma half-life of 22 min.
  • ADM-containing fusion proteins of the invention can find particular use in diabetes for stimulatory effects on insulin secretion from islet cells for glucose regulation or in human or animals with su stained hypotension.
  • the complete genom ic infrastructure for human AM has been reported (Ishimitsu et al., 1994, Biochem, Biophys. Res. Commun 203:631-639). and analogs of ADM peptides have been cloned, as described in U.S. Pat. No. 6,320,022.
  • Amylin means the human peptide hormone referred to as amylin, pramlinfide, and species variations thereof, as described in U.S. Pat. No. 5,234,906, having at least a portion of the biological activity 7 of mature amylin.
  • Amylin is a 37-amino acid polypeptide hormone eo-seereted with insulin by pancreatic beta cells in response to nutrient intake (Koda et al, 1992, Lancet 339:1179-1180), and has been reported to modulate several key pathways of carbohydrate metabolism, including incorporation of glucose into glycogen.
  • Amylin- contaming fusion proteins of the invention can complement the action of insulin, which regulates the rate of glucose disappearance from the circulation and its uptake by peripheral tissues.
  • Amylin analogues have been cloned, as described in U.S. Pat. Nos. 5,686,411 and 7,271,238.
  • Amylin mimetics can be created that retain biologic activity.
  • pramlintide has the sequence KCNTAT C ATNRLANFL VHS SNNFGPILPPTN VGSNT Y (SEQ ID NO: 43), wherein amino acids from the rat amylin sequence are substituted for amino acids in the human amylin sequence.
  • the invention contemplates fusion proteins comprising amylin mimetics of the sequence KCNTATCATX1RLANFLVHSSNNFGX2ILX2X2TNVGSNTY (SEQ ID NO: 44) wherein Xi is independently N or Q and X2 is independently S, P or G.
  • the amylin mimetic incorporated into a BPXTEN can have the sequence
  • the mimetic in another embodiment, wherein the amylin mimetic is used at the C -terminus of the BPXTEN, can have the sequence KCNTATCATNRLANFLYHSSNNFGGILGGTNVGSNTY(NH 2 ) (SEQ ID NO: 46).
  • CT Calcitonin
  • sCT salmon calcitonin
  • Calcitonin-containing fusion proteins of the invention can find particular use for the treatment of osteoporosis and as a therapy for Paget’s disease of bone.
  • Synthetic calcitonin peptides have been created, as described in U.S. Pat. Nos. 5,175,146 and 5,364,840.
  • CGRP Calcitonin gene related peptide
  • CGRP means the human CGRP peptide and species and sequence variants thereof having at least a portion of the biological activity of mature CGRP, which is a member of the calcitonin family of peptides, which in humans exists in two forms, ct-CGRP (a 37 amino acid peptide) and ⁇ -CGRP.
  • CGRP has 43-46% sequence identity with human amylin.
  • CGRP-containing fusion proteins of the invention can find particular use in decreasing morbidity associated with diabetes, ameliorating hyperglycemia and insulin deficiency, inhibition of lymphocyte infiltration into the islets, and protection of beta cells against autoimmune destruction. Methods for making synthetic and recombinant CGRP are described in U.S. Pat. No. 5,374,618.
  • ‘"Cholecy stokinin” or “CCK” means the human CCK peptide and species and sequence variants thereof having at least a portion of the biological activity of mature CCK.
  • CCK-58 is the mature sequence, while the CCK-33 amino acid sequence first identified in humans is the major circulating form of the peptide.
  • the CCK family also includes an 8-amino acid in vivo C-terminal fragment (“CCK-8”), pentagastrin or CCK-5 being the C-terminal peptide CCK(29-33), and CCK-4 being the C-terminal tetrapeptide CCK(30-33).
  • CCK is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.
  • CCK-33 and CCK-8-containing fusion proteins of the invention can fmd particular use in reducing the increase in circulating glucose after meal ingestion and potentiating the increase in circulating insulin.
  • Analogues of CCK- 8 have been prepared, as described in U.S. Pat. No. 5,631,230.
  • Exendin-3 means a glucose regulating peptide isolated from Hehderma horndum and sequence variants thereof having at least a portion of the biological activity of mature exendin-3.
  • Exendin-3 amide is a specific exendin receptor antagonist from that mediates an increase in pancreatic cAMP, and release of insulin and amylase.
  • Exendin -3 -contain ing fusion proteins of the invention can fmd particular use in the treatment of diabetes and insulin resistance disorders. The sequence and methods for its assay are described in United States Patent 5,4242,86.
  • Exendin-4 means a glucose regulating peptide found in the saliva of the Gila-monster Heloderma sus peclum, as well as species and sequence variants thereof, and includes the native 39 amino acid sequence HGEGTFTSDLSKQMEEEAVRLFIEYLKNGGPSSGAPPPS (SEQ ID NO: 47] and homologous sequences and peptide mimetics, and variants thereof; natural sequences, such as from primates and non-natural having at least a portion of the biological activity of mature exendin-4.
  • Exendin-4 is an incretin polypeptide hormone that decreases blood glucose, promotes insulin secretion, slows gastric emptying and improves satiety, providing a marked improvement in postprandial hyperglycemia.
  • Table 4b shows the sequences from a wide variety of species, while Table 4c shows a list of synthetic GLP-1 analogs; all of which are contemplated for use in the BPXTEN proteins described herein.
  • Fibroblast growth factor 21, or “FGF-21” means the human protein encoded by the FGF-21 gene, or species and sequence variants thereof having at least a portion of the biological activity of mature FGF-21.
  • FGF-21 stimulates glucose uptake in adipocytes but not in other cell types; the effect is additive to the activity of insulin.
  • FGF-21 -containing fusion proteins of the invention can find particular use in treatment of diabetes, including causing increased energy expenditure, fat utilization and lipid excretion.
  • FGF-21 has been cloned, as disclosed in U.S. Pat. No. 6,716,626.
  • Fibroblast growth factor 19 means the human protein encoded by the FGF-19 gene, or species and sequence variants thereof having at least a portion of the biological activity of mature FGF-19.
  • FGF-19 is a protein member of the fibroblast growth factor (FGF) family.
  • FGF-19 increases liver expression of the leptin receptor, metabolic rate, stimulates glucose uptake in adipocytes, and leads to loss of weight in an obese mouse model (Fu et al., 2004, Endocrinology 145: 2504-2603)
  • FGF-19-containing fusion proteins of the invention can find particular use in increasing metabolic rate and reversal of dietary and leptin-deficient diabetes.
  • FGF-19 has been cloned and expressed, as described in US Patent Application No. 20020042367.
  • Gastrin means the human gastrin peptide, truncated versions, and species and sequence variants thereof having at least a portion of the biological activity of mature gastrin. Gastrin is found primarily in three forms: gastrin-34 (“big gastrin”); gastrin-17 (“little gastrin”); and gastrin-14 (“minigastrin”) and shares sequence homology with CCK. Gastrin-containing fusion proteins of the invention can find particular use in the treatment of obesity and diabetes for glucose regulation. Gastrin has been synthesized, as described in U .S. Pat. No. 5,843,446.
  • Ohrelin means a human hormone that induces satiation, or species and sequence variants thereof, including the native, processed 27 or 28 amino acid sequence and homologous sequences. Ghrelin levels increase before meals and decrease after meals, and can result in increased food intake and increase fat mass by an action exerted at the level of the hypothalamus. Ghrelin-containing fusion proteins of the invention can find particular use as agonists; e.g., to selectively stimulate motility of the G1 tract in gastrointestinal motility disorder, to accelerate gastric emptying, or to stimulate the release of growth hormone. Ghrelin analogs with sequence substitutions or truncated variants, such as described in U.S. Pat. No.
  • 7,385,026, can find particular use as fusion partners with XTEN polypeptides for use as antagonists for improved glucose homeostasis, treatment of insulin resistance and treatment of obesity.
  • the isolation and characterization of ghrelin has been reported (Kojima et ai, 1999, Nature. 402:656-660) and synthetic analogs have been prepared by peptide synthesis, as described in II.S. Pat. No. 6,967,237.
  • Glucagon means the human glucagon glucose regulating peptide, or species and sequence variants thereof, including the native 29 amino acid sequence and homologous sequences; natural, such as from primates, and non-natural sequence variants having at least a portion of the biological activity of mature glucagon.
  • the term “glucagon” as used herein also includes peptide mimetics of glucagon.
  • Glucagon-containing fusion proteins of the invention can find particular use in increasing blood glucose levels in individuals with extant hepatic glycogen stores and maintaining glucose homeostasis in diabetes. Glucagon has been cloned, as disclosed in U.S. Pat. No. 4,826,763.
  • GLP-1 means human glucagon like peptide- 1 and sequence variants thereof having at least a portion of the biological activity of mature GLP-1.
  • GLP-1 includes human GLP-l(l-37), GLP-l(7-37), and GLP-i(7-36)amide.
  • GLP-1 stimulates insulin secretion, but only during periods of hyperglycemia.
  • the safety of GLP-1 compared to insulin is enhanced by this property 7 and by 7 the observation that the amount of insulin secreted is proportional to the magnitude of the hyperglycemia.
  • the biological half-life of GLP-l(7-37)OH is a mere 3 to 5 minutes (U.S. Pat. No. 5,118,666).
  • GLP-1 -containing fusion proteins of the invention can find particular use in the treatment of diabetes and insulin-resistance disorders for glucose regulation.
  • GLP-1 has been cloned and derivatives prepared, as described in U.S. Pat. No. 5,118,666.
  • Non-limited examples of GLP- 1 sequences from a wide variety of species are shown in Table 4b, while Table 4c shows the sequences of a number of synthetic GLP-1 analogs; all of which are contemplated for use in the BPXTEN compositions described herein.
  • GLP native sequences can be described by several sequence motifs, which are presented below. Letters in brackets represent acceptable amino acids at each sequence position: ⁇ HVY] ⁇ AGISTV] ⁇ DEHQ] ⁇ AG] ⁇ ILMPSTV] ⁇ FLY] ⁇ DINST] ⁇ ADEKNST] ⁇ ADENSTV] ⁇ LMVY] ⁇ ANRSTY] ⁇ EHIKNQRST] ⁇ AHILMQVY] ⁇ LMRT] ⁇ ADEGKQS] ⁇ ADEGKNQSY] ⁇ AEIKLMQR] ⁇ AKQRSVY] ⁇ AILMQSTV] ⁇ GKQR] ⁇ DEKLQR] ⁇ FHLVWY] ⁇ ILV] ⁇ ADEGHIKMQRST] ⁇ ADEGNRSTW] ⁇ GILVW] ⁇ AIKLMQSV] ⁇ ADGIKNQRST] ⁇ GKRSY] (SEQ ID NO: 9399
  • GLP-2 means human glucagon like peptide-2 and sequence variants thereof having at least a portion of the biological activity of mature GLP-2. More particularly, GLP-2 is a 33 amino acid peptide, co-secreted along with GLP-1 from intestinal endocrine cells in the small and large intestine.
  • IGF-1 insulin-like growth factor 1
  • IGF-1 means the human IGF-1 protein and species and sequence variants thereof having at least a portion of the biological activity of mature IGF-1.
  • IGF-1 consists of 70 amino acids and is produced primarily by the liver as an endocrine hormone as well as in target tissues in a paracrine/autocrine fashion.
  • IGF-1 -containing fusion proteins of the invention can find particular use in the treatment of diabetes and insulin-resistance disorders for glucose regulation.
  • IGF-1 has been cloned and expressed in E. coli and yeast, as described in United States Patent No. 5,324,639.
  • IGF-2 insulin-like growth factor 2
  • IGF-2 means the human 1GF-2 protein and species and sequence variants thereof having at least a portion of the biological activity of mature IGF-2. IGF-2 has been cloned, as described in Bell et ai, 1985, Proc Natl Acad Sci U S A. 82:6450-4.
  • Islet neogenesis-associated protein (INGAP), or “pancreatic beta cell growth factor” means the human 1NGAP peptide and species and sequence variants thereof having at least a portion of the biological activity of mature INGAP.
  • INGAP-containing fusion proteins of the invention can find particular use in the treatment or prevention of diabetes and insulin-resistance disorders.
  • INGAP has been cloned and expressed, as described in R Rafaeloff et ai, 1997, J Clin Invest. 99(9): 2100-2109.
  • Intermedin or “AFP-6” means the human intermedin peptide and species and sequence variants thereof having at least a portion of the biological activity of mature intermedin. Intermedin treatment leads to blood pressure reduction both in normal and hypertensive human or animals, as well as the suppression of gastric emptying activity, and is implicated in glucose homeostasis. Intermedin-containing fusion proteins of the invention can find particular use in the treatment of diabetes, insulin-resistance disorders, and obesity. Intermedin peptides and variants have been cloned, as described in U.S. Pat. No. 6,965,013.
  • Leptin means the naturally occurring lepbn from any species, as well as biologically active D- isoforms, or fragments and sequence variants thereof. Leptin -containing fusion proteins of the invention can find particular use in the treatment of diabetes for glucose regulation, insulin-resistance disorders, and obesity. Leptin has been cloned, as described in U.S. Pat. No. 7,112,659, and leptin analogs and fragments in U.S. Pat. No. 5,521,283, U.S. Pat. No. 5,532,336, PCT/US96/22308 and PCT/US96/01471.
  • Neuromedin means the neuromedin family of peptides including neuromedin U and S peptides, and sequence variants thereof. Included in the neuromedin U family are various truncated or splice variants, e.g., FLFHYSKTQKLGKSNWEELQSPFASQSRGYFLFRPRN (SEQ ID NO: 180). Exemplary of the neuromedin S family is human neuromedin S with the sequence ILQRGSGT AA VDFTKKDHT ATW GRPFFLFRPRN (SEQ ID NO: 181), particularly its amide form. Neuromedin fusion proteins of the invention can find particular use in treating obesity, diabetes, reducing food intake, and other related conditions and disorders as described herein.
  • ‘"Oxyntomodulin”, or ‘ ⁇ ” means human oxyntomodulin and species and sequence variants thereof having at least a portion of the biological activity of mature OXM.
  • OXM is a 37 amino acid peptide produced in the colon that contains the 29 amino acid sequence of glucagon followed by an 8 amino acid carboxyterminal extension.
  • OXM -containing fusion proteins of the invention can find particular use in the treatment of diabetes for glucose regulation, insulin-resistance disorders, obesity, and can be used as a weight loss treatment.
  • PYY means human peptide YY polypeptide and species and sequence variants thereof having at least a portion of the biological activity of mature PYY.
  • PPY-containing fusion proteins of the invention can find particular use in the treatment of diabetes for glucose regulation, insulin-resistance disorders, and obesity. Analogs of PYY have been prepared, as described in U.S. Pat. Nos. 5,604,203, 5,574,010 and 7,166,575.
  • “Urocortin” means a human urocortin peptide hormone and sequence variants thereof having at least a portion of the biological activity of mature urocortin. There are three human urocortins: Ucn-1, Ucn-2 and Ucn-3. Further urocortins and analogs have been described in U.S. Pat. No. 6,214,797. BPXTEN proteins comprising urocortin of the invention can also find particular use in treating or preventing conditions associated with stimulating ACTH release, hypertension due to vasodilatory effects, inflammation mediated via other than ACTH elevation, hyperthermia, appetite disorder, congestive heart failure, stress, anxiety, and psoriasis.
  • Urocortin-containing fusion proteins can also be combined with a natriuretic peptide module, amylin family, and exendin family, or a GLP1 family module to provide an enhanced cardiovascular benefit, e.g. treating CHF, as by providing a beneficial vasodilation effect.
  • Metabolic and cardiovascular diseases represent a substantial health care burden in most developed countries, with cardiovascular diseases remaining the number one cause of death and disability in the United States and most European countries. Metabolic diseases and disorders include a large variety of conditions affecting the organs, tissues, and circulatory system of the body
  • Dyslipidemia is a frequent occurrence among diabetics and human or animals with cardiovascular disease; typically characterized by parameters such as elevated plasma triglycerides, low HDL (high density lipoprotein) cholesterol, normal to elevated levels of LDL (low density lipoprotein) cholesterol and increased levels of small dense, LDL particles in the blood.
  • Dyslipidemia and hypertension is a main contributor to an increased incidence of coronary events, renal disease, and deaths among human or animals with metabolic diseases like diabetes and cardiovascular disease.
  • Cardiovascular disease can be manifest by many disorders, symptoms and changes in clinical parameters involving the heart, vasculature and organ systems throughout the body, including aneurysms. angina, atherosclerosis, cerebrovascular accident (Stroke), cerebrovascular disease, congestive heart failure, coronary artery disease, myocardial infarction, reduced cardiac output and peripheral vascular disease, hypertension, hypotension, blood markers (e.g., C-reactive protein, BNP, and enzymes such as CPK, LDH, SGPT, SCOT), amongst others.
  • metabolic proteins ' peptides and hormones
  • many such peptides and hormones, as well as analogues thereof have found utility in the treatment of such diseases and disorders.
  • the use of therapeutic peptides and/or hormones even when augmented by the use of small molecule drugs, has met xvith limited success in the management of such diseases and disorders.
  • dose optimization is important for drugs and biologies used in the treatment of metabolic diseases, especially those with a narrow therapeutic window. Hormones in general, and peptides involved in glucose homeostasis often have a narrow therapeutic window.
  • one aspect of the present invention is the incorporation of biologically active metabolic proteins and involved in or used in the treatment of metabolic and cardiovascular diseases and disorders into BPXTEN fusion proteins to create compositions with utility in the treatment of such disorders, disease and related conditions.
  • the metabolic proteins can include any protein of biologic, therapeutic, or prophylactic interest or function Eat is useful for preventing, treating, mediating, or ameliorating a metabolic or cardiovascular disease, disorder or condition.
  • Table 4d provides a non-limiting list of such sequences of metabolic BPs Eat are encompassed by Ee BPXTEN fusion proteins of Ee invention.
  • Metabolic proteins of Ee inventive BPXTEN compositions can be a protein Eat exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Table 4d.
  • Anti-CD3 means the monoclonal antibody against the T cell surface protein CD3, species and sequence variants, and fragments thereof, including OKT3 (also called muromonab) and humanized anti-CD3 monoclonal antibody (hOKT31 (Ala-Ala))( Herald et al., 2002, New England Journal of Medicine 346: 1692- 1698]
  • Anti-CD3-containing fusion proteins of the invention can find particular use to slow ncw-onsct Type 1 diabetes, including use of the anti-CD3 as a therapeutic effector as well as a targeting moiety for a second therapeutic BP in the BPXTEN composition.
  • the sequences for the variable region and the creation of anti- CD3 have been described in U.S.
  • IL-Ira means the human IL-I receptor antagonist protein and species and sequence variants thereof, including the sequence variant anakinra (Kineret(R)), having at least a portion of the biological activity of mature IL-lra.
  • Anakinra is a nonglycosylated, recombinant human IL-lra and differs from endogenous human IL-lra by the addition of an N-terminal methionine.
  • a commercialized version of anakinra is marketed as Kincret3 ⁇ 4.
  • Anakinra has 153 amino acids and 17.3 kD in size, and has a reported half-life of approximately 4-6 hours.
  • IL-lra-containing fusion proteins of the invention can find particular use in the treatment of any of the foregoing diseases and disorders.
  • IL-lra has been cloned, as described in U.S. Pat. Nos. 5,075,222 and 6,858,409.
  • ‘Natriuretic peptides” means atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP or B-type natriuretic peptide) and C-type natriuretic peptide (CNP); both human and non-human species and sequence variants thereof having at least a portion of the biological activity of the mature counterpart natriuretic peptides. Sequences of useful forms of natriuretic peptides are disclosed in U.S. Patent Publication 20010027181.
  • ANPs examples include human ANP (Kangawa et al., 1984, BBRC 118: 131 ) or that from various species, including pig and rat ANP (Kangawa ct al., 1984, BBRC 121 :585]. Sequence analysis revealed that preproBNP consists of 134 residues and is cleaved to a 108-amino acid ProBNP. Cleavage of a 32-amino acid sequence from the C-terminal end of ProBNP results in human BNP (77-108], which is the circulating, physiologically active form.
  • the 32-amino acid human BNP involves the formation of a disulfide bond (Sudoh et al., 1989, BBRC 159:1420) and U.S. Pat. Nos. 5,114,923, 5,674,710, 5,674,710, and 5,948,761.
  • BPXTEN-containing one or more natriuretic functions can be useful in treating hypertension, diuresis inducement, natriuresis inducement, vascular conduct dilatation or relaxation, natriuretic peptide receptors (such as NPR-A) binding, , aldostrerone secretion suppression from the adrenal gland, treatment of cardiovascular diseases and disorders, reducing, stopping or reversing cardiac remodeling after a cardiac event or as a result of congestive heart failure, treatment of renal diseases and disorders; treatment or prevention of ischemic stroke, and treatment of asthma.
  • NPR-A natriuretic peptide receptors
  • Heparin-binding growth factor 2 means the human FGF-2 protein, and species and sequence variants thereof having at least a portion of the biological activity of the mature counterpart. FGF-2 has been cloned, as described in Burgess, W. H. and Maciag, T., Ann. Rev. Biochem., 58:575-606 (1989); Coulier, F., ct al., 1994, Prog. Growth Factor Res. 5:1; and the PCT publication WO 87/01728.
  • TNF receptor means the human receptor for TNF, and species and sequence variants thereof having at least a portion of the biological receptor activity of mature TNFR.
  • the x-ray crystal structure of the complex fonned by the extracellular domain of the human p55 TNF receptor and TNF ⁇ has been determined (Banner et al., 1993 Cell 73:431, incorporated herein by reference).
  • FIX Human factor IX
  • FVlIa Factor Vila
  • factor IX and factor Vila compositions with extended half-life and retention of activity when administered as part of a preventive and/or therapeutic regimen for hemophilia B, as well as formulations that reduce side effects and can be administered by both intravenous and subcutaneous routes.
  • the coagulation factors for inclusion in the BPXTEN of the invention can include proteins of biologic, therapeutic, or prophylactic interest or function that are useful for preventing, treating, mediating, or ameliorating blood coagulation disorders, diseases, or deficiencies.
  • Suitable coagulation proteins include biologically active polypeptides that are involved in the coagulation cascade as substrates, enzymes or cofactors.
  • Table 4c prorides a non-limiting list of sequences of coagulation factors that are encompassed by the BPXTEN fusion proteins of the invention.
  • Coagulation factors for inclusion in the BPXTEN of the invention can be a protein that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Table 4c.
  • FIX Factor IX
  • the FIX peptide is a structural analog or peptide mimetic of any of the FIX peptides described herein, including the sequences of Table 4e.
  • the FIX peptide is a structural analog or peptide mimetic of any of the FIX peptides described herein, including the sequences of Table 4e.
  • the FIX is human FIX.
  • the FIX is a polypeptide sequence from Table 4e.
  • Mature Factor IX is a single chain protein of 415 amino acid residues that contains approximately 17% carbohydrate by weight (Schmidt 2003, Trends Cardiovasc Med, 13: 39).
  • the coagulation factor is Factor IX, a sequence variant of Factor IX, or a Factor IX moiety, such as the exemplary sequences of Table 4e, as well as any protein or polypeptide substantially homologous thereto whose biological properties result in the activity of Factor IX.
  • Fractor VII means the human protein, and species and sequence variants thereof having at least a portion of the biological activity of activated Factor VII.
  • Factor VII and recombinant human FVIla has been introduced for use in uncontrollable bleeding in hemophilia patients (with Factor VIII or EX deficiency) who have developed inhibitors against replacement coagulation factor.
  • Recombinant human factor VIIa has utility in treatment of uncontrollable bleeding in hemophilia patients (with Factor VIII or IX deficiency), including those who have developed inhibitors against replacement coagulation factor.
  • the FVII peptide is the activated form (FVIla), a structural analog or peptide mimetic of any of the FVII peptides described herein, including sequences of Table 4c.
  • Factor VII and VIIa have been cloned, as described in US Patent No. 6,806,063 and US Patent Application No. 20080261886.
  • ‘‘Growth Hormone” or "GHH means the human growth hormone protein and species and sequence variants thereof, and includes, but is not limited to, the 191 single-chain amino acid human sequence of GH.
  • the invention contemplates inclusion in the BPXTEN of any GH homologous sequences, sequence fragments that are natural, such as from primates, mammals (including domestic animals), and non-natural sequence variants which retain at least a portion of the biologic activity or biological function of GH and/or that are useful for preventing, treating, mediating, or ameliorating a GH-related disease, deficiency, disorder or condition.
  • Non-mammalian GH sequences are well-described in the literature.
  • a sequence alignment of fish GHs can be found in Genetics and Molecular Biology 2003 26 p.295-300.
  • native sequences homologous to human GH can be found by standard homology searching techniques, such as NCB1 BLAST.
  • the GH incorporated into the human or animal compositions can be a recombinant polypeptide with a sequence corresponding to a protein found in nature.
  • the GH can be a sequence variant, fragment, homolog, or a mimetics of a natural sequence that retains at least a portion of the biological activity of the native GH.
  • Table 4f provides a nonlimiting list of sequences of GHs from a wide variety of mammalian species that are encompassed by the BPXTEN fusion proteins of the invention. Any of these GH sequences or homologous derivatives constructed by shuffling individual mutations between species or families can be useful for the fusion proteins of this invention.
  • GH that can be incorporated into a BPXTEN fusion protein can include a protein that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein selected from Table 4f.
  • the BP can be a cytokine or one or more cytokines.
  • the cytokines refer to proteins (e.g., cbemokines, interferons, lymphokines, interleukins, and tumor necrosis factors) released by cells which can affect cell behavior.
  • Cytokines can be produced by a broad range of cells, including immune cells such as macrophages, B lymphocytes, T lymphocytes and mast cells, as well as endothelial cells, fibroblasts, and various stromal cells.
  • a given cytokine can be produced by more than one type of cell. Cytokines can be involved in producing systemic or local immunomodulatory effects.
  • Certain cytokines can function as pro-inflammatory cytokines.
  • Pro-inflammatory cytokines refer to cytokines involved in inducing or amplifying an inflammatory reaction.
  • Pro-inflammatory cytokines can work with various cells of the immune system, such as neutrophils and leukocytes, to generate an immune response.
  • Certain cytokines can function as anti-inflammatory cytokines.
  • Anti-inflammatory cytokines refer to cytokines involved in the reduction of an inflammatory reaction.
  • Anti-inflammatory' cytokines in some cases, can regulate a pro-inflammatory cytokine response.
  • Some cytokines can function as both pro- and anti-inflammatory cytokines.
  • Cytokines encompassed by the inventive compositions can have utility in the treatment in various therapeutic or disease categories, including but not limited to cancer, rheumatoid arthritis, multiple sclerosis, myasthenia gravis, systemic lupus erythematosus, Alzheimer’s disease, Schizophrenia, viral infections (e.g., chronic hepatitis C, AIDS), allergic asthma, retinal neurodegenerative processes, metabolic disorder, insulin resistance, and diabetic cardiomyopathy. Cytokines can be especially useful in treating inflammatory conditions and autoimmune conditions.
  • the target polynucleotide can encode for a cytokine.
  • cytokines include 4- 1BBL, activin ⁇ , activin ⁇ , activin ⁇ activin ⁇ , artemin (ARTN), BAFF/BLyS/TNFSF138, BMP10, BMP15, BMP2, BMP3, BMP4, BMPS, BMP6, BMP7, BMP8a, BMP8b, bone morphogenetic protein 1 (BMP1), CCL1/TCA3, CCL11, CCL 12/MCP-5 ,CCL 13/MCP-4, CCL14, CCL15, CCL16, CCL17/TARC, CCLI8, CCL 19, CCL2/MCP-1, CCL20, CCL2I, CCL22/MDC, CCL23, CCL24, CCL25, CCL26, CCL27, CCL28, CCL3, CCL3L3, CCL4, CCL4L1/LAG-I, CCL5, CCL6, CCL
  • the target gene encodes for an immune checkpoint inhibitor.
  • immune checkpoint inhibitors include PD-1, CTLA-4, LAG3, TIM-3, A2AR, B7-H3, B7-H4, BTLA, IDO, KIR, and VISTA.
  • the target gene encodes for a T cell receptor (TCR) alpha, beta, gamma, and/or delta chain.
  • TCR T cell receptor
  • the cy tokine can be a chemokine.
  • the chemokine can be selected from a group including, but not limited to, ARMCX2, BCA-1 / CXCL13, CCL11, CCL12/MCP-5, CCL13/MCP-4, CCL15/MIP- 5/MIP-l delta, CCL16 / HCC-4 / NCC4, CCL17/TARC, CCLI8 / PARC / MIP-4, CCL19/MIP-3b, CCL2/MCP-1, CCL20/MIP-3 alpha/MIP3A, CCL21/6Ckine, CCL22/MDC, CCL23 / MIP 3, CCL24/Eotaxin- 2/MPIF-2, CCL25/TECK, CCL26/Eotaxin-3, CCL27/CTACK, CCL28, CCL3/Mipla, CCL4 / MIP1B, CCL4L1/LAG-1, CCL5/RANTES
  • Table 4g provides a non-limiting list of such sequences of BPs that are encompassed by the BPXTEN fusion proteins of the invention.
  • Metabolic proteins of the inventive BPXTEN compositions can be a protein that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Table 4g.
  • IL-lra means the human IL-I receptor antagonist protein and species and sequence variants thereof, including the sequence variant anakinra (Kineret®), having at least a portion of the biological activity of mature IL-lra Human IL-lra is a mature glycoprotein of 152 amino acid residues. . IL- Ira-con taning fusion proteins of the invention can find particular use in the treatment of any of the foregoing diseases and disorders. IL-lra has been cloned, as described in U.S. Pat. Nos. 5,075,222 and 6,858,409.
  • the BP can be IL-10.
  • IL-10 can be an effective anti-inflammatory cytokine that represses the production of the proinflammatory cytokines and chemokines.
  • IL-10 can be useful for the treatment of autoimmune diseases and inflammatory diseases such as rheumatoid arthritis, multiple sclerosis, myasthenia gravis, systemic lupus erythematosus, Alzheimer’s, Schizophrenia, allergic asthma, retinal neurodegenerative processes, and diabetes.
  • IL-10 can be modified to improve stability and decrease prolytic degradation.
  • the modification can be one or more amide bond substitution.
  • one or more amide bonds within backbone of IL-10 can be substituted to achieve the abovementioned effects.
  • amide linkages in IL-10 can also be replaced by a reduced isostere pseudopeptide bond. See Couder et al. (1993) Int. J. Peptide Protein Res. 41:181-184, which is hereby incorporated by reference in its entirety.
  • the one or more acidic amino acids including aspartic acid, glutamic acid, homoglutamic acid, ty rosine, alkyl, aryl, arylalkyl, and heteroaryl sulfonamides of 2,4-diaminopriopionic acid, ornithine or lysine and tetrazole-substituted alkyl amino acids; and side chain amide residues such as asparagine, glutamine, and alkyl or aromatic substituted derivatives of asparagine or glutamine; as well as hydroxyl-containing amino acids, including serine, threonine, homoserine, 2,3-diaminopropionic acid, and alkyl or aromatic substituted derivatives of serine or threonine can be substituted.
  • the one or more hydrophobic amino acids in IL-10 such as alanine, leucine, isoleucine, valine, norleucine, (S)-2-aminobutyric acid, (S)-cyclohexylalamne or other simple alpha-amino acids can be substituted with amino acids including, but not limited to, an aliphatic side chain from Cl -CIO carbons including branched, cyclic and straight chain alkyl, alkenyl or alkynyl substitutions
  • the one or more hydrophobic amino acids in IL-10 such as can be substituted substitution of aromatic-substituted hydrophobic amino acids, including phenylalanine, tryptophan, tyrosine, sulfotyrosine, biphenylalanine, 1-naphthylalanine, 2-naphthylalanine, 2-benzothienylalanine, 3- benzothienylalanine, histidine, including amino, alkylamino, dialkylamino, aza, halogenated (fluoro, chloro, bromo, or iodo) or alkoxy (from Ci-G*)-substituted forms of the above-listed aromatic amino acids, illustrative examples of which are: 2-, 3- or 4-aminophenylalanine, 2-, 3- or 4-chlorophenylalanine, 2-, 3- or 4- methylphenylalanine, 2-, 3- or 4-methoxyphenylalan
  • the one or more hydrophobic amino acids in IL-10 such as phenylalanine, tryptophan, tyrosine, sulfotyrosine, biphenylalanine, 1-naphthylalanine, 2-naphthylalanine, 2-benzothienylalanine, 3- benzothienylalanine, histidine, including amino, alkylamino, dialkylamino, aza, halogenated (fluoro, chloro, bromo, or iodo) or alkox can be substituted by aromatic amino acids including: 2-, 3- or 4-aminophenylalanine, 2-, 3- or 4-chlorophcnyIalaninc, 2-, 3- or 4-methylpheny!aIanine, 2-, 3- or 4-methoxyphenylalanine, 5 -amino-, 5-chloro-, 5-methyl- or 5-methoxy tryptophan, 2’-, 3’-, or 4 '
  • amino acids comprising basic side chains, including arginine, lysine, histidine, ornithine, 2,3- diaminopropionic acid, homoaiginine, including alkyl, alkenyl, or aryl-substituted derivatives of the previous amino acids, can be substituted.
  • Examples arc N-epsilon-isopropyl-lysine, 3-(4-tetrahydropyridyl)-glycine, 3- (4-tetrahydropyridyl)-alanine, ⁇ , ⁇ -gamma, gamma ' -diethyl-homoarginine, alpha-methyl-arginine, alpha- methyl-2, 3-diaminopropionic acid, alpha-methyl-histidine, and alpha-methyl-omithine where the alkyl group occupies the pro-R position of the alpha-carbon.
  • the modified IL-10 can comprise amides formed from any combination of alkyl, aromatic, heteroaromatic, ornithine, or 2,3-diaminopropionic acid, carboxylic acids or any of the many well-known activated derivatives such as acid chlorides, active esters, active azolides and related derivatives, lysine, and ornithine.
  • IL- 10 comprises can comprise one or more naturally occurring L-amino acids, synthetic L-amino acids, and/or D -enantiomers of an amino acid.
  • the IL-10 polypeptide can comprise one or more of the following amino acids: ⁇ -aminodecanoic acid, co-am inotetradecanoic acid, cyclohexylalanine, ⁇ , ⁇ - diamino butyric acid, ⁇ , ⁇ -diaminopropionic acid, ⁇ -amino valeric acid, t-butyl alanine, t-butylglycine, N- methylisoleucine, phenylglycine, cyclohexylalanine, norleucine, napbthylalanine, ornithine, citrulline, 4- chlorophenylalanine, 2-fluorophenylalanine, pyridylalanine 3-benzothienyl alanine, hydroxyproline, ⁇ -alanine, o-aminobenzoic acid, m-aminobenzoic acid, p-aminobenzoic acid, m-aminomethyl
  • IL-10 can comprise a cysteine residue or a cysteine which can act as linker to another peptide via a disulfide linkage or to provide for cyclization of the IL-10 polypeptide.
  • Methods of introducing a cysteine or cysteine analog are known in the art; see, e.g., U.S. Pat. No. 8,067,532.
  • An IL-10 polypeptide can be cyclized.
  • Other means of cyclization include introduction of an oxime linker or a lanthionine linker; see, e.g., U.S. Pat. No. 8,044,175.
  • a cyclizing bond can be generated with any combination of amino acids (or with an amino acid and -(CH 2 )CO- or -(CH 2 ) n C6H4-CO-) with functional groups which allow for the introduction of a bridge.
  • Some examples are disulfides, disulfide mimetics such as the -(CH 2 ) o -carba bridge, thioacetal, thioether bridges (cystathionine or lanthionine) and bridges containing esters and ethers.
  • the IL-10 can be substituted with an N-alky!, aryl, or backbone crosslinking to construct lactams and other cyclic structures, C-tenninal hydroxymethyl derivatives, o-modified derivatives, N-terminally modified derivatives including substituted amides such as alkylamides and bydrazides.
  • an IL-10 polypeptide is a retroinverso analog.
  • IL-10 can be IL-10 can be native protein, peptide fragment IL-10, or modified peptide, having at least a portion of the biological activity of native IL-10.
  • IL-10 can be modified to improve intracellular uptake.
  • One such modification can be attachment of a protein transduction domain.
  • the protein transduction domain can be attached to the C-terminus of the IL-10.
  • the protein transduction domain can be attached to the N-terminus of the IL-10.
  • the protein transduction domain can be attached to IL-10 via covalent bond.
  • the protein transduction domain can be chosen from any of the sequences listed in Table 4h.
  • the BP of the human or animal compositions are not limited to native, full-length polypeptides, but also include recombinant versions as well as biologically and/or pharmacologically active variants or fragments thereof.
  • recombinant versions as well as biologically and/or pharmacologically active variants or fragments thereof.
  • various amino acid substitutions can be made in the BP to create variants without departing from the spirit of the invention with respect to the biological activity or pharmacologic properties of the BP. Examples of conservative substitutions for amino acids in polypeptide sequences are shown in Table 5.
  • the invention contemplates substitution of any of the other 19 natural L-amino acids for a given amino acid residue of the given BP, which can be at any position within the sequence of the BP, including adjacent amino acid residues. If any particular substitution results in an undesirable change in biological activity, then an alternative amino acid can be employed and the construct evaluated by the methods described herein, or using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934, the contents of which is incorporated by reference in its entirety, or using methods generally known to those of skill in the art.
  • variants can also include, for instance, polypeptides wherein one or more amino acid residues are added or deleted at the N- or C-terminus of the full-length native amino acid sequence of a BP that retains at least a portion of the biological activity of the native peptide.
  • a BP incorporated into a BPXTEN polypeptide can have a sequence that exhibits at least about 80% sequence identity to a sequence from Tables 4a-4h, alternatively at least about 81%, or about 82%, or about 83%, or about 84%, or about 85%, or about 86%, or about 87%, or about 88%, or about 89%, or about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99%, or 100% sequence identity as compared with a sequence from Tables 4a-4h.
  • a BP incorporated into a BPXTEN can be a bispecific sequence comprising a first binding domain and a second binding domain, wherein the first binding domain, having specific binding affinity to a tumor-specific marker or an antigen of a target cell, exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to paired VL and VH sequences of an anti-CD3 antibody selected from Table 6f; and wherein the second binding domain, having specific binding affinity to an effector cell, exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to
  • the BP of the foregoing embodiments can be evaluated for activity using assays or measured or determined parameters as described herein, and those sequences that retain at least about 40%, or about 50%, or about 55%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95% or more activity compared to the corresponding native BP sequence would be considered suitable for inclusion in the human or animal BPXTEN.
  • the BP found to retain a suitable level of activity can be linked to one or more XTEN polypeptides described hereinabove or anywhere else herein.
  • a BP found to retain a suitable level of activity can be linked to one or more XTEN polypeptides, having at least about 80% sequence identity (e.g., at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity) to a sequence from Tables 3a-3b, resulting in a chimeric fusion protein.
  • T CELL ENGAGERS e.g., at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at
  • BPXTEN XTENylated Protease- Activated T Cell Engagers
  • BP is a bispecific antibody (e.g., a bispecific T-cell engager).
  • the XPAT composition comprises a first portion comprising a first binding domain and a second binding domain, a second portion comprising the release segment, and a third portion comprising XTEN bulking moiety.
  • the XPAT composition has the configuration of Formula la (depicted N-terminus to C-terminus):
  • first portion Hsecond portion (first portion Hsecond portion)-(third portion) (la) wherein first portion is a bispecific comprising two scFv wherein the first binding domain has specific binding affinity to a tumor-specific marker or an antigen of a target cell and the second binding domain has specific binding affinity to an effector cell; the second portion comprises a release segment (RS) capable of being cleaved by a mammalian protease (as described more fully hereinbelow, the protease can be tumor- or antigen-specific, thereby activation); and the third portion is a bulking moiety.
  • RS release segment
  • the first portion binding domains can be in the order (VL-VH)1-(VL-VH)2, wherein ' ⁇ ’ and ‘"2’ * represent the first and second binding domains, respectively, or (VL-VH)1-(VH-VL)2, or (VH-VL)1-(VL-VH)2, or (VH- VL)1-(VH-VL)2, wherein the paired binding domains are linked by a polypeptide linker (as described more fully hereinbelow).
  • alternatives for the first portion VL and VH are identified in Tables 6a-6f; alternatives for RS are identified in the sequences set forth in Tables 8a-8b (as described more fully hereinbelow); and alternatives for the bulking moiety is identified herein by: XTEN; albumin binding domain; albumin; IgG binding domain; polypeptides consisting of proline, serine, and alanine; fatty acid; Fc domain; polyethylene glycol (PEG), PLGA; and hydoxylethyl starch.
  • the bulking moiety is an XTEN having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a sequence identified by the sequences set forth in Tables 3a-3b.
  • the composition is a recombinant fusion protein.
  • the portions are linked by chemical conjugation.
  • the XPAT composition has the configuration of Formula Ua (depicted N- terminus to C-terminus):
  • first portion is a bispecific comprising two scFv wherein the first binding domain has specific binding affinity to a tumor-specific marker or an antigen of a target cell and the second binding domain has specific binding affinity to an effector cell;
  • the second portion comprises a release segment (RS) capable of being cleaved by a mammalian protease;
  • the third portion is a bulking moiety.
  • the first portion binding domains can be in the order (VL-VH)l -(VL-VH)2, wherein ‘T’ and “2” represent the first and second binding domains, respectively, or (VL-VH)1-(VH-VL)2, or (VH-VL)1-(VL-VH)2, or (VH- VL)I-(VH-VL)2, wherein the paired binding domains are linked by a polypeptide linker as described herein, below.
  • alternatives for the first portion VL and VH are identified in Tables 6a-6f; alternatives for RS are identified in the sequences set forth in Tables 8a-8b; and alternatives for the bulking moiety are identified herein by: XTEN; albumin binding domain; albumin; IgG binding domain; polypeptides consisting of proline, serine, and alanine; fatty acid; and Fc domain.
  • the bulking moiety is an XTEN having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a sequence selected from the group of sequences set forth in Tables 3a-3b.
  • the composition is a recombinant fusion protein.
  • the portions are linked by chemical conjugation.
  • the XPAT composition has the configuration of Formula Ilia (depicted N- terminus to C-terminus):
  • first portion is a bispecific comprising two scFv wherein the first binding domain has specific binding affinity to a tumor-specific marker or an antigen of a target cell and the second binding domain has specific binding affinity to an effector cell;
  • the second portion comprises a release segment (RS) capable of being cleaved by a mammalian protease;
  • the third portion is a bulking moiety;
  • the fourth portion comprises a release segment (RS) capable of being cleaved by a mammalian protease which can be identical or different from the second portion;
  • the fifth portion is a bulking moiety that can be identical or can be different from the third portion.
  • the first portion binding domains can be in the order (VL- VH)1-(VL-VH)2, wherein “1” and “2” represent the first and second binding domains, respectively, or (VL- VH)1-(VH-VL)2, or (VH-VL)1-(VL-VH)2, or (VH-VL)1-(VH-VL)2, wherein the paired binding domains are linked by a polypeptide linker as described herein, below'.
  • alternatives for RS are identified in the sequences set forth in Tables 8a-8b.
  • the bulking moiety is identified herein by: XTEN; albumin binding domain; albumin; IgG binding domain; polypeptides consisting of proline, serine, and alanine; fatty acid; and Fc domain.
  • the bulking moiety is an XTEN having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a sequence selected from the group of sequences set forth in Tables 3a-3b.
  • the composition is a recombinant fusion protein.
  • the portions are linked by chemical conjugation.
  • the human or animal compositions advantageously provide bispecific therapeutics that have more selectivity, greater half-life, and result in less toxicity and fewer side effects once they are cleaved by proteases found in associated with the target tissues or tissues rendered unhealthy by a disease, wherein the human or animal compositions have improved therapeutic index compared to bispecific antibody compositions known in the art.
  • Such compositions are useful in the treatment of certain diseases, including, but not limited to cancer as set forth herein.
  • compositions of the instant invention achieve this reduction in non-specific interactions by a combination of mechanisms, which include stcric hindrance by locating the binding domains to the bulky XTEN molecules, wherein flexible, unstructured characteristics of XTEN polypeptides, by being tethered to the composition, are able to oscillate and move around the binding domains, providing blocking between the composition and tissues or cells, as well as providing a reduction in the ability of the intact composition to penetrate a cell or tissue due to the large molecular mass (contributed to by both the actual molecular weight of the XTEN polypeptide(s) and due to the large hydrodynamic radius of the unstructured XTEN polypeptides) compared to the size of the individual binding domains.
  • mechanisms which include stcric hindrance by locating the binding domains to the bulky XTEN molecules, wherein flexible, unstructured characteristics of XTEN polypeptides, by being tethered to the composition, are able to oscillate and move around the binding domain
  • compositions are designed wherein when in proximity to a target tissue or cell bearing or secreting a protease capable of cleaving the RS, or when internalized into a target cell or tissue when a binding domain has bound the ligand, the bispecific binding domains are liberated from the bulk of the XTEN by the action of the protease(s), removing the steric hindrance barrier, and is freer to exert its pharmacologic effect.
  • the human or animal compositions find use in the treatment of a variety of conditions where selective delivery of a therapeutic bispecific antibody composition to a cell, tissue or organ is desired.
  • the target tissue is a cancer, which can be a leukemia, a lymphoma, or a tumor of an organ or system.
  • the disclosure contemplates use of single chain binding domains, such as but not limited to Fv, Fab, Fab’, Fab’-SH, F(ab’)2, linear antibodies, single domain antibody, single domain camelid antibody, single-chain antibody molecules (scFv), and diabodies capable of binding ligands or receptors associated with effector cells and antigens of diseased tissues or cells that are cancers, tumors, or other malignant tissues.
  • the bispecific antibody comprises a first binding domain with binding specificity to a target cell marker and a second binding domain with binding specificity to an effector cell antigen.
  • the first and the second binding domains can be non-antibody scaffolds such as anticalins, adnectins, fynomers, affilins, affibodies, centyrins, DARPins.
  • the binding domain for the tumor cell target is a variable domain of a T cell receptor that has been engineered to bind MHC that is loaded with a peptide fragment of a protein that is overexpressed by tumor cells.
  • the XPAT compositions are designed with considerations of the location of the target tissue protease as well as the presence of the same protease in healthy tissues not intended to be targeted, as well as the presence of the target ligand in healthy tissue but a greater presence of the ligand in unhealthy target tissue, in order to provide a wide therapeutic window.
  • a '‘therapeutic window” refers to the largest difference between the minimal effective dose and the maximal tolerated dose for a given therapeutic composition.
  • the binding domains of the first portion of the compositions are shielded by the proximity of the bulking moiety (e.g., an XTEN polypeptide), wherein the binding affinity of the intact composition for one or both of the ligands is reduced compared to the composition that has been cleaved by a mammalian protease, thereby releasing the first portion from the shielding effects of the bulking moiety.
  • the bulking moiety e.g., an XTEN polypeptide
  • Fv is the minimum antibody fragment which contains a complete antigen recognition and binding site, consisting of a dimer of one heavy (VH) and one light chain variable domain (VL) in non-covalent association.
  • VH dimer of one heavy
  • VL light chain variable domain
  • CDRs complementarity determining regions
  • scFv are created in which each has 3, 4, or 5 CHRs within each binding domain.
  • Framework sequences flanking the CDRs have a tertiary structure that is essentially conserved in native immunoglobulins across species, and the framework residues (FR) serve to hold the CDRs in their appropriate orientation.
  • the constant domains are not required for binding function, but can aid in stabilizing VH-VL interaction.
  • the domain of the binding site of the polypeptide can be a pair of VH-VL, VH-VH or VL-VL domains either of the same or of different immunoglobulins, however it is generally preferred to make single chain binding domains using the respective VH and VL chains from the parental antibody.
  • VH and VL domains within the polypeptide chain is not limiting for the present invention; the order of domains given can be reversed usually without any loss of function, but it is understood that the VH and VL domains are arranged so that the antigen binding site can properly fold.
  • the single chain binding domains of the bispecific scFv embodiments of the human or animal compositions can be in the order (VL-VH) l -(VL-VH) 2 , wherein “1” and “2” represent the first and second binding domains, respectively, or (VL-VH)*-(VH-VL) 2 , or (VH-VL) 1 -(VL-VH) 2 , or (VH-VL)‘-(VH-VL) 2 , wherein the paired binding domains are linked by a polypeptide linker as described herein, below.
  • the arrangement of the binding domains in an exemplary bispecific single chain antibody disclosed herein can therefore be one in which the first binding domain is located C-terminally to the second binding domain.
  • the arrangement of the V chains can be VH (target cell surface antigen)- VL(target cell surface antigen )-VL(effector cell antigen)-VH(effector cell antigen), VH(target cell surface antigen)- VL(target cell surface antigen )-VH(effector cell antigen )-VL(effector cell antigen), VL(target cell surface antigen)-VH(target cell surface antigen)-VL(effector cell antigen)-VH(effector cell antigen) or VL(target cell surface antigen )- VH(target cell surface antigen)-VH(effector cell antigen)- VL(effector cell antigen).
  • N-terminally to or C-terminally to and grammatical variants thereof denote relative location within the primary amino acid sequence rather than placement at the absolute N- or C-terminus of the bispecific single chain antibody.
  • a first binding domain which is “located C-terminally to the second binding domain” denotes that the first binding is located on the carboxyl side of the second binding domain within the bispecific single chain antibody, and does not exclude the possibility that an additional sequence, for example a His-tag, or another compound such as a radioisotope, is located at the C-terminus of the bispecific single chain antibody.
  • the chimeric polypeptide assembly compositions comprise a first portion comprising a first binding domain and a second binding domain wherein each of said binding domains is an scFv and wherein each scFv comprises one VL and one VH.
  • the chimeric polypeptide assembly compositions comprise a first portion comprising a first binding domain and a second binding domain wherein said binding domains are in a diabody configuration and wherein each domain comprises one VL domain and one VH.
  • the first domain has binding specificity to a tumor-specific marker or an antigen of a target cell and the second binding domain has binding specificity to an effector cell antigen.
  • the effector cell antigen is expressed on or within an effector cell.
  • the effector cell antigen is expressed on a T cell, such as a CD4+, CD8+, or natural killer (NK) cell.
  • the effector cell antigen is expressed on a B cell, master cell, dendritic cell, or myeloid cell.
  • the effector cell antigen is CD3, the cluster of differentiation 3 antigen of a cytotoxic T cell.
  • the first binding domain exhibits binding specificity to a tumor-specific marker associated with a tumor cell.
  • the binding domain has binding affinity to a tumor-specific marker wherein the tumor cell can include without limitation cells from stroma cell tumor, fibroblast tumor, myofibroblast tumor, glial cell tumor, epithelial cell tumor, fat cell tumor, immune cell tumor, vascular cell tumor, and smooth muscle cell tumor.
  • the tumor-specific marker or an antigen of a target cell can be alpha 4 integral, Ang2, B7-H3, B7-H6, CEACAM5, cMET, CTLA4, FOLRl,EpCAM, CCR5, CD19, HER2, HER2 neu, HER3, HER4, HER1 (EGFR), PD-L1, PSMA, CEA, TROP-2, MUC1 (mucin), MUC-2, MUC3, MUC4, MUC5AC, MUC5B, MUC7, MUC16 ⁇ hCG, Lewis- Y, CD20, CD33, CD38, CD30, CD56 (NCAM), CD133, ganglioside GD3; 9-0- Acetyl-GD3, GM2, Globo H, fucosyl GM1, GD2, carbonicanhydrase IX, CD44v6, Nectin-4, Sonic Hedgehog (Shh), Wue-1, plasma cell antigen 1, melanoma chondroitin sulfate proteog
  • the first binding domain that exhibits binding affinity to CD70 is its natural ligand, CD27 rather than an antibody fragment.
  • the first binding domain that exhibits binding affinity to B7-H6 is its natural ligand Nkp30 rather than an antibody fragment.
  • the scFv embodiments of the XPAT compositions of the invention comprise a first binding domain and a second binding domain wherein the VL and VH domains are derived from monoclonal antibodies with binding specificity to the tumor-specific marker or an antigen of a target cell and effector cell antigens, respectively.
  • the first and second binding domains each comprise six CDRs derived from monoclonal antibodies with binding specificity to a target cell marker, such as a tumor-specific marker and effector cell antigens, respectively.
  • the first and second binding domains of the first portion of the human or animal compositions can have 3, 4, or 5 CHRs within each binding domain.
  • the embodiments of the invention comprise a first binding domain and a second binding domain wherein each comprises a CDR-H1 region, a CDR-H2 region, a CDR-H3 region, a CDR-L1 region, a CDR-L2 region, and a CDR-H3 region, wherein each of said regions is derived from a monoclonal antibody capable of binding the tumor-specific marker or an antigen of a target cell, and effector cell antigens, respectively.
  • the invention provides a chimeric polypeptide assembly composition wherein the second binding domain comprises VH and VL regions derived from a monoclonal antibody capable of binding human CD3.
  • the invention provides a chimeric polypeptide assembly composition, wherein the scFv second binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of an anti-CD3 antibody set forth in Table 6a.
  • the second domain embodiments of the invention comprise a CDR-H1 region, a CDR-H2 region, a CDR-H3 region, a CDR-L1 region, a CDR-L2 region, and a CDR-H3 region, wherein each of said regions is derived from a monoclonal antibody as set forth in Table 6a.
  • the VH and/or VL domains can be configured as scFv, diabodies, a single domain antibody, or a single domain camelid antibody.
  • the second domains of the human or animal compositions are derived from an anti-CD3 antibody as set forth in Table 6a.
  • the second domain of the human or animal composition comprises the paired VL and the VH region sequences of the anti-CD3 antibody as set forth in Table 6a.
  • the invention provides a chimeric polypeptide assembly composition, wherein (he second binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of the huUCHTl anti-CD3 antibody of Table 6a.
  • the VH and/or VL domains can be configured as scFv, a portion of a diabody, a single domain antibody, or a single domain camelid antibody.
  • the scFv of the first domain of the composition are derived from an anti-tumor cell antibody as set forth in Table 6f.
  • the invention provides a chimeric polypeptide assembly composition, wherein the first binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of an anti-tumor cell antibody as set forth in Table 6f.
  • the first domain of the recited compositions comprises the paired VL and the VH region sequences of an anti-tumor cell antibody disclosed herein.
  • the VH and/or VL domains can be configured as scFv, a portion of a diabody, a single domain antibody, or a single domain camelid antibody.
  • the chimeric polypeptide assembly compositions comprise a first portion comprising a first binding domain and a second binding domain wherein said binding domains are in a diabody configuration and each of said binding domains comprises one VL domain and one VH domain.
  • the diabody embodiments of the invention comprise a first binding domain and a second binding domain wherein the VL and VH domains are derived from monoclonal antibodies with binding specificity to a tumor-specific marker or an antigen of a target cell, and the effector cell antigen, respectively.
  • the diabody embodiments of the invention comprise a first binding domain and a second binding domain wherein each comprises a CDR-H1 region, a CDR-H2 region, a CDR-H3 region, a CDR-L1 region, a CDR-L2 region, and a CDR-H3 region, wherein each of said regions is derived from a monoclonal antibody capable of binding the tumor-specific marker or target cell antigen, and the effector cell antigen, respectively.
  • the diabody embodiments of the invention comprise a first binding domain and a second binding domain wherein the VL and VH domains are derived from monoclonal antibodies with binding specificity to the tumor-specific marker or target cell antigen, and the effector cell antigen, respectively.
  • the diabody embodiments of the invention comprise a first binding domain and a second binding domain wherein each comprises a CDR-H1 region, a CDR-H2 region, a CDR-H3 region, a CDR-LI region, a CDR-L2 region, and a CDR-H3 region, wherein each of said regions is derived from a monoclonal antibody capable of binding the tumor-specific marker or target cell antigen, and the effector cell antigen, respectively.
  • the invention provides a chimeric polypeptide assembly composition w'herein the diabody second binding domain comprises the paired VH and VL regions derived from a monoclonal antibody capable of binding human CD3.
  • the invention provides a chimeric polypeptide assembly composition, wherein the diabody second binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of an anti-CD3 antibody as set forth in Table 6a.
  • the invention provides a chimeric polypeptide assembly composition, wherein the diabody second binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to the VL and a VH sequence of the huUCHTl antibody as set forth in Table 6a.
  • the diabody second domain of the composition is derived from an anti-CD3 antibody described herein.
  • the invention provides a chimeric polypeptide assembly composition, wherein the diabody first binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91 %, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to VL and VH sequences of an anti-tumor cell antibody as set forth in Table 6f.
  • the diabody first domain of the composition is derived from an anti-tumor cell antibody described herein.
  • Therapeutic monoclonal antibodies from which VL and VH and CDR domains can be derived for the human or animal compositions are known in the art.
  • the sequences for the above antibodies can be obtained from publicly available databases, patents, or literature references.
  • non-limiting examples of monoclonal antibodies and VH and VL sequences from anti-CD3 antibodies set forth in Table 6a and nonlimiting examples of monoclonal antibodies and VH and VL sequences to cancer, tumor, or target cell markers set forth in Table 6f.
  • the invention provides chimeric polypeptide assembly compositions comprising a binding domain of the first portion with binding affinity' to T cells.
  • the binding domain of the second portion comprises VL and VH derived from a monoclonal antibody to an antigen of the CD3.
  • the binding domain comprises VL and VH derived from a monoclonal antibody to CD3epsilon and CD3delta.
  • Monoclonal antibodies to CD3 neu are known in the art. Exemplary, non-limiting examples of VL and VH sequences of monoclonal antibodies to CD3 are set forth in Table 6a.
  • the invention provides a chimeric polypeptide assembly comprising a binding domain with binding affinity to CD3 comprising anti-CD3 VL and VH sequences set forth in Table 6a. In another embodiment, the invention provides a chimeric polypeptide assembly comprising a binding domain of the first portion with binding affinity to CD3epsilon comprising anti-CD3epsilon VL and VH sequences set forth in Table 6a.
  • the invention provides a chimeric polypeptide assembly composition, wherein the scFv second binding domain of the first portion comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of the huUCHT 1 anti-CD3 antibody of Table 6a.
  • the invention provides a chimeric polypeptide assembly composition comprising a binding domain with binding affinity to CD3 comprising the CDR-L1 region, the CDR-L2 region, the CDR- L3 region, the CDR-H1 region, the CDR-H2 region, and the CDR-H3 region, wherein each is derived from the respective anti-CD3 VL and VH sequences set forth in Table 6a.
  • the invention provides a chimeric polypeptide assembly composition comprising a binding domain with binding affinity to CD3 comprising the CDR-L1 region, the CDR-L2 region, the CDR-L3 region, the CDR-H1 region, the CDR- H2 region, and the CDR-H3 region, wherein the CDR sequences are RASQD1RNYLN (SEQ ID NO: 8034), YTSRLES (SEQ ID NO: 8035],QQGNTLPWT (SEQ ID NO: 8036), GYSFTGYTMN (SEQ ID NO: 8037], LINPYKGVST (SEQ ID NO: 8038], and SGYYGDSDWYFDV (SEQ ID NO: 8039)
  • the CDR sequences are RASQD1RNYLN (SEQ ID NO: 8034), YTSRLES (SEQ ID NO: 8035],QQGNTLPWT (SEQ ID NO: 8036), GYSFTGYTMN (SEQ ID NO: 80
  • the CD3 complex is a group of cell surface molecules that associates with the T-cell antigen receptor (TCR) and functions in the cell surface expression of TCR and in the signaling transduction cascade that originates when a peptide:MHC ligand binds to the TCR.
  • TCR T-cell antigen receptor
  • MHC ligand binds to the TCR.
  • the CD3 sends signals through the cell membrane to the cytoplasm inside the T cell. This causes activation of the T cell that rapidly divide to produce new T cells sensitized to attack the particular antigen to which the TCR were exposed.
  • the CD3 complex is comprised of the CD3epsiIon molecule, along with four other membrane- bound polypeptides (CD3-gamma, -delta, -zeta, and -beta).
  • CD3-epsilon is encoded by the CD3E gene on Chromosome 11.
  • the intracellular domains of each of the CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) that serve as the nucleating point for the intracellular signal transduction machinery upon T cell receptor engagement.
  • ITAMs immunoreceptor tyrosine-based activation motifs
  • a number of therapeutic strategies modulate T cell immunity by targeting TCR signaling, particularly the anti-human CD3 monoclonal antibodies (mAbs) that are widely used clinically in immunosuppressive regimes.
  • the CD3-specific mouse mAb OKT3 was the first mAb licensed for use in humans (Sgro, C. Side- effects of a monoclonal antibody, muromonab CD3/orthoclone OKT3: bibliographic review. Toxicology 105:23-29, 1995] and is widely used clinically as an immunosuppressive agent in transplantation (Chatenoud, Clin. Transplant 7:422-430, (1993); Chatenoud, Nat. Rev. Immunol. 3:123-132 (2003); Kumar, Transplant. Proc.
  • anti-CD3 mAbs can induce partial T cell signaling and clonal energy (Smith, JA, Nonmitogenic Anli-CD3 Monoclonal Antibodies Deliver a Partial T Cell Receptor Signal and Induce Clonal Anergy J. Exp. Med. 185:1413-1422 (1997]).
  • OKT3 has been described in the literature as a T cell mitogen as well as a potent T cell killer (Wong, JT. The mechanism of anti-CD3 monoclonal antibodies. Mediation of cytolysis by intcr-T cell bridging. Transplantation 50:683-689 (1990)).
  • the studies of Wong demonstrated that by bridging CD3 T cells and target cells, one could achieve killing of the target and that neither FcR-mediated ADCC nor complement fixation was necessary for bivalent anti-CD3 MAB to lyse the target cells.
  • OKT3 exhibits both a mitogenic and T-cell killing activity in a time-dependent fashion; following early activation of T cells leading to cytokine release, upon further administration OKT3 later blocks all known T- cell functions. It is due to this later blocking of T cell function that OKT3 has found such wide application as an immunosuppressant in therapy regimens for reduction or even abolition of allograft tissue rejection.
  • Other antibodies specific for the CD3 molecule are disclosed in Tunnacliffe, Int. Immunol.
  • the disclosure relates to antigen binding fragments (AF2) having specific binding affinity for an effector cell antigen that can be incorporated into any of the human or animal composition embodiments described herein.
  • the effector cell antigen is expressed on the surface of an effector cell selected from a plasma cell, a T cell, a B cell, a cytokine induced killer cell (CIK cell), a mast cell, a dendritic cell, a regulatory T cell (RegT cell), a helper T cell, a myeloid cell, and a NK cell.
  • an effector cell selected from a plasma cell, a T cell, a B cell, a cytokine induced killer cell (CIK cell), a mast cell, a dendritic cell, a regulatory T cell (RegT cell), a helper T cell, a myeloid cell, and a NK cell.
  • Binding specificity can be determined by complementarity determining regions, or CDRs, such as light chain CDRs or heavy chain CDRs. In many cases, binding specificity is determined by light chain CDRs and heavy chain CDRs. A given combination of heavy chain CDRs and light chain CDRs provides a given binding pocket that confers greater affinity and/or specificity towards an effector cell antigen as compared to other reference antigens.
  • compositions having a first antigen binding fragment (AF1) to EGFR linked by a short, flexible peptide linker to a second antigen binding fragment (AF2) with binding specificity to an effector cell antigen are bispecific, with each antigen binding fragment having specific binding affinity to their respective ligands.
  • AF1 directed against an EGFR of a disease tissue is used in combination with a AF2 directed towards an effector cell marker in order to bring an effector cell in close proximity to the cell of a disease tissue in order to effect the cytolysis of the cell of the diseased tissue.
  • the AF1 and AF2 are incorporated into the specifically designed polypeptides comprising cleavable release segments and XTEN in order to confer prodrug characteristics on the compositions that becomes activated by release of the fused AF1 and AF2 upon the cleavage of the release segments when in proximity to the disease tissue having proteases capable of cleaving the release segments in one or more locations in the release segment sequence.
  • the AF2 of the human or animal compositions has binding affinity for an effector cell antigen expressed on the surface of a T cell.
  • the AF2 of the human or animal compositions has binding affinity for CD3.
  • the AF2 of the human or animal compositions has binding affinity for a member of the CD3 complex, which includes in individual form or independently combined form all known CD3 subunits of the CD3 complex; for example, CD3 epsilon, CD3 delta, CD3 gamma, CD3 zeta, CD3 alpha and CD3 beta.
  • the AF2 has binding affinity for CD3 epsilon, CD3 delta, CD3 gamma, CD3 zeta, CD3 alpha or CD3 beta.
  • the origin of the antigen binding fragments contemplated by the disclosure can be derived from a naturally occurring antibody or fragment thereof, a non-naturally occurring antibody or fragment thereof, a humanized antibody or fragment thereof, a synthetic antibody or fragment thereof, a hybrid antibody or fragment thereof, or an engineered antibody or fragment thereof.
  • Methods for generating an antibody for a given target marker are well known in the art.
  • the monoclonal antibodies can be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975], or can be made by recombinant DNA methods (U.S. Pat. No. 4,816,567].
  • VH and VL variable regions of heavy and light chains of an antibody
  • scFv single chain variable regions
  • CDR complementarity determining regions
  • dAbs domain antibodies
  • antigen binding fragments for the composition embodiments disclosed herein is intended to include portions or fragments of antibodies that retain the ability to bind the antigens that are the ligands of the corresponding intact antibody.
  • the antigen binding fragment can be, but is not limited to, CDRs and intervening framework regions, variable or hypervariable regions of light and/or heavy chains of an antibody (VL, VH), variable fragments (Fv), Fab * fragments, F(ab')2 fragments, Fab fragments, single chain antibodies (scAb), VHH camelid antibodies, single chain variable fragment (scFv), linear antibodies, a single domain antibody, complementarity determining regions (CDR), domain antibodies (dAbs), single domain heavy chain immunoglobulins of the BHH or BNAR type, single domain light chain immunoglobulins, or other polypeptides known in the art containing a fragment of an antibody capable of binding an antigen.
  • the antigen binding fragments having CDR-H and CDR-L can be configured in a (CDR-H)-(CDR-L) or a (CDR-H)-(CDR-L) orientation, N-terminus to C-terminus.
  • the VL and VH of two antigen binding fragments can also be configured in a single chain diabody configuration; i.e., the VL and VH of the AF1 and AF2 configured with linkers of an appropriate length to permit arrangement as a diabody.
  • CD3 binding AF2 of the disclosure have been specifically modified to enhance their stability in the polypeptide embodiments described herein.
  • Protein aggregation of antibodies continues to be a significant problem in their developability and remains a major area of focus in antibody production.
  • Antibody aggregation can be triggered by partial unfolding of its domains, leading to monomer-monomer association followed by nucleation and aggregate growth.
  • the aggregation propensities of antibodies and antibody-based proteins can be affected by the external experimental conditions, they are strongly dependent on the intrinsic antibody properties as determined by their sequences and structures.
  • the present disclosure provides an AF2 having the capability to specifically bind CD3 in which the AF2 has at least one amino acid substitution of a hydrophobic amino acid in a framework region relative to the parental antibody or antibody fragment wherein the hydrophobic amino acid is selected from isoleucine, leucine or methionine.
  • the CD3 AP2 has at least two amino acid substitutions of hydrophobic amino acids in one or more framework regions wherein the hydrophobic amino acids are selected from isoleucine, leucine or methionine.
  • the isoelectric point of a polypeptide can be determined mathematically (e.g., computationally) or experimentally by an in vitro assay.
  • the isoelectric points of the AF1 and AF2 are designed to be within a particular range of each other, thereby' promoting stability.
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein comprising CDR-L and CDR-H, wherein the AF2 (a) specifically binds to cluster of differentiation 3 T cell receptor (CD3); and (b) comprises CDR-H 1 , CDR-H2, and CDR-H3, having amino acid sequences of SEQ ID NOS: 742, 743, and 744, respectively.
  • CD3 cluster of differentiation 3 T cell receptor
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein comprising CDR- L and CDR-H, wherein the AF2 (a) specifically binds to cluster of differentiation 3 T cell receptor (CD3); (b) comprises CDR-H 1, CDR-H2, and CDR-H3, having amino acid sequences of SEQ ID NOS: 742, 743, and 744, respectively; and (c) comprises CDR-L wherein the CDR-L comprises a CDR-L 1 having an amino acid sequence of SEQ ID NOS: 735 or 736, a CDR-L2 having an amino acid sequence of SEQ ID NOS: 738 or 739, and a CDR-L3 having an amino acid sequence of SEQ ID NO: 740.
  • CD3 cluster of differentiation 3 T cell receptor
  • AF2 comprises a FR-L1 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:746, a FR-L2 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO: 747, a FR-L3 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of any one of SEQ ID NOS:748
  • the AF2 for use in any of the polypeptide embodiments described herein comprises light chain framework regions (FR-L) and heavy chain framework regions (FR-H) wherein AF2 comprises a FR-L1 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:746, a FR-L2 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:747, a FR-L3 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:74
  • the AF2 for use in any of the polypeptide embodiments described herein comprises light chain framework regions (FR-L) and heavy chain framework regions (FR-H) wherein AF2 comprises a FR-L1 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:746, a FR-L2 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:747, a FR-L3 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:
  • the AF2 of the human or animal polypeptide embodiments described herein comprises light chain framework regions (FR-L) and heavy chain framework regions (FR-H) wherein AF2 comprises a FR-L1 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:746, a FR- L2 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:747, a FR-L3 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:750,
  • FR-H4 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:764.
  • the AF2 of the human or animal polypeptide embodiments described herein comprises light chain framework regions (FR-L) and heavy chain framework regions (FR-H) wherein AF2 comprises a FR-L1 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO: 746, a FR-L2 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO:747, a FR-L3 exhibiting at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to the amino acid sequence of SEQ ID NO: 75
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein wherein the AF2 comprises a variable heavy (VH) amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to an amino acid sequence of SEQ ID NO:766 or SEQ ID NO:769.
  • VH variable heavy
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein wherein the AF2 comprises a variable light (VL) amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to an amino acid sequence of any one of SEQ ID NOS: 765, 767, 768, 770, or 771.
  • VL variable light
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein wherein the AF2 comprises a variable heavy (VH) amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity' or is identical to an amino acid sequence of SEQ ID NO:766 or SEQ ID NO:769 and a variable light (VL) amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity or is identical to an amino acid sequence of any one of SEQ ID NOS: 765, 767, 768, 770, or 771.
  • VH variable heavy
  • VL variable light
  • the present disclosure provides an AF2 for use in any of the polypeptide embodiments described herein wherein the AF2 comprises an amino acid sequence having at least 95%, 96%, 97%, 98%, 99% sequence identity or is identical to an amino acid sequence of any one of SEQ ID NOS:776- 780.
  • the present disclosure provides AF2 antigen binding fragments that bind to the CD3 protein complex that have enhanced stability compared to CD3 binding antibodies or antigen binding fragments known in the art.
  • the CD3 antigen binding fragments of the disclosure are designed to confer a higher degree of stability on the chimeric bispecific antigen binding fragment compositions into which they are integrated, leading to improved expression and recovery of the fusion protein, increased shelf-life and enhanced stability when administered to a human or animal.
  • the CD3 AF2 of the present disclosure are designed to have a higher degree of thermal stability compared to certain CD3-binding antibodies and antigen binding fragments known in the art.
  • the CD3 AF2 utilized as components of the chimeric bispecific antigen binding fragment compositions into which they are integrated exhibit favorable pharmaceutical properties, including high thermostability and low aggregation propensity, resulting in improved expression and recovery during manufacturing and storage, as well promoting long serum half-life.
  • Biophysical properties such as thermostability are often limited by the antibody variable domains, which differ greatly in their intrinsic properties.
  • High thermal stability is often associated with high expression levels and other desired properties, including being less susceptible to aggregation (Buchanan A, et al. Engineering a therapeutic IgG molecule to address cysteinylation, aggregation and enhance thermal stability and expression. MAbs 2013; 5:255].
  • Thermal stability' is determined by measuring the “melting temperature” (T m ), which is defined as the temperature at which half of the molecules are denatured.
  • T m melting temperature
  • the melting temperature of each heterodimer is indicative of its thermal stability.
  • the melting point of the heterodimer can be measured using techniques such as differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47- 52).
  • the thermal stability of the heterodimer can be measured using circular dichroism (Murray et al. (2002) J. Chromalogr Sci 40:343-9), or as described in the Examples, below.
  • Thermal denaturation curves of the CD3 binding fragments and the anti-CD3 bispecific antibodies comprising said anti-CD3 binding fragment and a reference binding of the present disclosure show that the constructs of the present disclosure are more resistant to thermal denaturation than the antigen binding fragment consisting of a sequence shown in SEQ ID NO:781 or a control bispecific antibody wherein said control bispecific antigen binding fragment comprises SEQ ID NO:781 and a reference antigen binding fragment that binds to an EGFR embodiment described herein.
  • the polypeptides of any of the human or animal composition embodiments described herein comprise an anti-CD3 AF2 of the embodiments described herein, wherein the T m of the AF2 is at least 2°C greater, or at least 3°C greater, or at least 4°C greater, or at least 5°C greater, or at least 6°C greater, or at least 7°C greater, or at least 8°C greater, or at least 9°C greater, or at least 10°C greater than the T m of an antigen binding fragment consisting of a sequence of SEQ ID NO:781 , as determined by an increase in melting temperature in an in vitro assay.
  • the polypeptides of any of the human or animal composition embodiments described herein comprise an AF2 that specifically binds human or cyno CD3 with a dissociation constant (Ka) constant between about 10 nM and about 400 nM, or between about 50 nM and about 350 nM, or between about 100 nM and 300 nM, as determined in an in vitro antigen-binding assay comprising a human or cyno CD3 antigen.
  • Ka dissociation constant
  • the polypeptides of any of the human or animal composition embodiments described herein comprise an AF2 that specifically binds human or cyno CD3 with a dissociation constant (K d ) weaker than about 10 nM, or about 50 nM, or about 100 nM, or about 150 nM, or about 200 nM, or about 250 nM, or about 300 nM, or about 350 nM, or weaker than about 400 nM as determined in an in vitro antigen-binding assay.
  • K d dissociation constant
  • polypeptides of any of the human or animal composition embodiments described herein comprise an AF2 that specifically binds human or cyno CD3 with at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or at least 10-fold weaker binding affinity than an antigen binding fragment consisting of an amino acid sequence of SEQ ID NO: 781, as determined by the respective dissociation constants (K d ) in an in vitro antigen-binding assays.
  • the present disclosure provides bispecific polypeptides comprising an AF2 that exhibits a binding affinity to CD3 that is at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 50-fold, 100-fold, or at least 1000-fold at weaker relative to that of the AFl EGFR embodiments described herein that are incorporated into the human or animal polypeptides, as determined by the respective dissociation constants (K d ) in an in vitro antigen-binding assay.
  • K d dissociation constants
  • binding affinity of the human or animal compositions for the target ligands can be assayed using binding or competitive binding assays, such as Biacore assays with chip-bound receptors or binding proteins or ELISA assays, as described in US Patent 5,534,617, assays described in the Examples herein, radio-receptor assays, or other assays known in the art.
  • the binding affinity constant can then be determined using standard methods, such as Scatchard analysis, as described by van Zoelen, et al., Trends Pharmacol Sciences (1998] 19)12):487, or other methods known in the art.
  • the present disclosure provides AF2 that bind to CD3 and are incorporated into chimeric, bispecific polypeptide compositions that are designed to have an isoelectric point (pi) that confer enhanced stability on the compositions of the disclosure compared to corresponding compositions comprising CD3 binding antibodies or antigen binding fragments known in the art.
  • the polypeptides of any of the human or animal composition embodiments described herein comprise AF2 that bind to CD3 wherein the AF2 exhibits a pi that is between 6.0 and 6.6, inclusive.
  • polypeptides of any of the human or animal composition embodiments described herein comprise AF2 that bind to CD3 wherein the AF2 exhibits a pi that is at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 pH unit lower than the pi of a reference antigen binding fragment consisting of a sequence shown in SEQ ID NO: 781.
  • the polypeptides of any of the human or animal composition embodiments described herein comprise an AF2 that binds to CD3 fused to an AFl that binds to an EGFR antigen wherein the AF2 exhibits a pI that is within at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, or 1.5 pH units of the pi of the AFl that binds EGFR antigen or an epitope thereof.
  • polypeptides of any of the human or animal composition embodiments described herein comprise an AF2 that binds to CD3 fused to an AFl that binds to an EGFR antigen wherein the AF2 exhibits a pi that is within at least about 0.1 to about 1.5, or at least about 0.3 to about 1.2, or at least about 0.5 to about 1.0, or at least about 0.7 to about 0.9 pH units of the pi of the API.
  • the resulting fused antigen binding fragments will confer a higher degree of stability on the chimeric bispecific antigen binding fragment compositions into which they are integrated, leading to improved expression and enhanced recovery of the fusion protein in soluble, non- aggregated form, increased shelf-life of the formulated chimeric bispecific polypeptide compositions, and enhanced stability when the composition is administered to a human or animal.
  • having the AF2 and the AF1 within a relatively narrow pi range of can allow for the selection of a buffer or other solution in which both the AF2 and AF1 are stable, thereby promoting overall stability of the composition.
  • the VL and VH of the antigen binding fragments are fused by relatively long linkers, comprising 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 hydrophilic amino acids that, when joined together, have a flexible characteristic.
  • the VL and VH of any of the scFv embodiments described herein are linked by relatively long linkers of hydrophilic amino acids that are GSGEGSEGEGGGEGSEGEGSGEGGEGEGSG (SEQ ID NO: 8058], TGSGEGSEGEGGGEGSEGEGSGEGGEGEGSGT (SEQ ID NO: 8059),
  • GATPPETGAETESPGETT GGS AESEPPGEG (SEQ ID NO: 8060, or
  • GSAAPTAGTTPSASPAPPTGGSSAAGSPST (SEQ ID NO: 8061).
  • the AF1 and AF2 are linked together by a short linker of hydrophilic amino acids having 3, 4, 5, 6, or 7 amino acids.
  • the short linker sequences are SGGGGS (SEQ ID NO: 8062), GGGGS (SEQ ID NO: 8063), GGSGGS (SEQ ID NO: 8064), GGS, or GSP.
  • compositions comprising a single chain diabody in which after folding, the fust domain (VL or VH) is paired with the last domain (VH or VL) to form one scFv and the two domains in the middle are paired to form the other scFv in which the first and second domains, as well as the third and last domains, are fused together by one of the foregoing short linkers and the second and the third variable domains are fused by one of the foregoing relatively long linkers.
  • the selection of the short linker and relatively long linker is to prevent the incorrect pairing of adjacent variable domains, thereby facilitating the formation of the single chain diabody configuration comprising the VL and VH of the first antigen binding fragment and the second antigen binding fragment.
  • the invention provides chimeric polypeptide assembly compositions comprising a binding domain with binding affinity to the tumor-specific marker EpCAM.
  • the binding domain comprises VL and VH derived form a monoclonal antibody to EpCAM.
  • Monoclonal antibodies to EpCAM are known in the art. Exemplary, non-limiting examples of EpCAM monoclonal antibodies and the VL and VH sequences thereof are set forth in Table 6f.
  • the invention provides a chimeric polypeptide assembly composition comprising a binding domain with binding affinity to the tumor-specific marker EpCAM comprising anti-EpCAM VL and VH sequences set forth in Table 61 in another embodiment, the invention provides a chimeric polypeptide assembly composition, wherein the first portion first binding domain comprises VH and VL regions wherein each VH and VL regions exhibit at least about 90%, or 91%, or 92%, or 93%, or 94%, or 95%, or 96%, or 97%, or 98%, or 99% identity to or is identical to paired VL and VH sequences of the 4D5MUCB anti-EpCAM antibody set forth in Table 61 In another embodiment, the invention provides a chimeric polypeptide assembly' composition comprising a binding domain with binding affinity 7 to the tumor-specific marker comprising the CDR-L1 region, the CDR-L2 region, the CDR-L3 region, the CDR-H1 region, the CDR-H2 region, and the CDR-H3
  • Epithelial cell adhesion molecule (EpCAM, also known as 17-1 A antigen) is a 40-kDa membrane- integrated glycoprotein composed of 314 amino acids expressed in certain epithelia and on many human carcinomas (see, Balzar, The biology of the 17-1A antigen (Ep-CAM), J. Mol. Med. 1999, 77:699-712). Because of their epithelial cell origin, tumor cells from most carcinomas express EpCAM on their surface (more so than normal, healthy cells), including the majority of primary, metastatic, and disseminated non-small cell lung carcinoma cells (Passlick, B., ct al. The 17-1 A antigen is expressed on primary, metastatic and disseminated non-small cell lung carcinoma cells. Int.
  • bispecific chimeric polypeptide assembly compositions with a first portion having a binding domain specific for EpCAM and a binding domain specific for CD3.
  • the technical problem to be solved was to provide means and methods for the generation of improved compositions exhibiting the properties of being well-tolerated and more convenient medicaments (less frequent dosing) for the effective treatment and or amelioration of tumorous diseases.
  • the solution to said technical problem is achieved by the embodiments disclosed herein and characterized in the claims.
  • the present invention relates to chimeric polypeptide assembly compositions whereby said composition comprises a first portion comprising a bispecific single chain antibody composition comprising at least two binding domains, whereby one of said domains binds to an effector cell antigen, such as CD3 antigen and a second domain binds to EpCAM antigen, wherein said binding domains comprise VL and VH specific for EpCAM and VL and VH specific for human CD3 antigen.
  • said binding domain specific for EpCAM has a K d value of greater than 10 '7 to 10 10 M, as determined in an in vitro binding assay.
  • the binding domains are in a scFv format.
  • the binding domains are in a single chain diabody format.
  • the invention provides chimeric polypeptide assembly compositions comprising a first portion binding domain with binding affinity to a tumor-specific marker and a second binding domain binds to an effector cell antigen, such as CD3 antigen
  • Tumor-specific markers comprising these embodiments of the invention include but are not limited to CCR5, CD19, HER-2, HER-3, HER-4, EGFR, PSMA, CEA, MUC1, MUC2, MUC3, MUC4, MUC5AC, MUC5B, MUC7, ⁇ hCG, Lewis-Y, CD-20, CD33, CD30, ganglioside GD3, 9-0-Acelyl-GD3, Globo H, fucosyl GM1, GD-2, carbonic anhydrase IX, CD44v6, Sonic Hedgehog, Wue-I, plasma cell antigen 1, melanoma chondroitin sulfate proteoglycan, CCR8, 6-transmembrane epithelial antigen of prostate (STEAP
  • the invention provides a chimeric polypeptide assembly composition comprising a first portion binding domain with binding affinity to the tumor-specific marker comprising anti-marker VL and VH sequences.
  • VL and VH sequences specific for certain of these tumor markers are set forth in Table 6f.
  • the invention provides a chimeric polypeptide assembly composition comprising a first portion binding domain with binding affinity to the tumor-specific marker comprising the CDR-L1 region, the CDR-L2 region, the CDR-L3 region, the CDR-H1 region, the CDR- H 2 region, and the CDR-H3 region, wherein each is derived from the respective VL and VH sequences.
  • said binding has a K d value of greater than 10 '7 to 10 ⁇ 10 M, as determined in an in vitro binding assay.
  • the chimeric polypeptide assembly composition can comprise any one of the foregoing binding domains or sequence variants thereof so long as the variants exhibit binding specificity for the described antigen.
  • a sequence variant would be created by substitution of an amino acid in the VL or VH sequence with a different amino acid.
  • deletion variants one or more amino acid residues in a VL or VH sequence as described herein are removed. Deletion variants, therefore, include all fragments of a binding domain polypeptide sequence.
  • substitution variants one or more amino acid residues of a VL or VH (or CDR) polypeptide are removed and replaced with alternative residues.
  • the substitutions are conservative in nature and conservative substitutions of this type are well known in the art.
  • the compositions comprising the first and the second binding domains disclosed herein can be utilized in any of the methods disclosed herein.
  • the XTEN polypeptide component of the fusion proteins disclosed herein are designed to behave like denatured peptide sequences under physiological conditions, despite the extended length of the polymer.
  • “Denatured” describes the state of a peptide in solution that is characterized by a large conformational freedom of the peptide backbone. Most peptides and proteins adopt a denatured conformation in the presence of high concentrations of denaturants or at elevated temperature. Peptides in denatured conformation have, for example, characteristic circular dichroism (CD) spectra and are characterized by a lack of long-range interactions as determined by NMR. ‘Denatured conformation” and “unstructured conformation” are used synonymously herein.
  • CD characteristic circular dichroism
  • the invention provides XTEN polypeptides that, under physiologic conditions, can resemble denatured sequences largely devoid in secondary structure. In other cases, the XTEN polypeptides can be substantially devoid of secondary- structure under physiologic conditions. “Largely devoid,” as used in this context, means that less than 50% of the XTEN amino acid residues of each XTEN polypeptide contribute to secondary- structure as measured or determined by the means described herein.
  • substantially devoid means that at least about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or at least about 99% of the XTEN amino acid residues of the XTEN sequence do not contribute to secondary structure, as measured or determined by the means described herein.
  • XTEN secondary structure can be measured spectrophotometrically, e.g., by circular dichroism spectroscopy in the “far-UV” spectral region (190-250 nm). Secondary- structure elements, such as alpha-helix and beta-sheet, each give rise to a characteristic shape and magnitude of CD spectra. Secondary structure can also be predicted for a polypeptide sequence via certain computer programs or algorithms, such as the well-known Chou-Fasman algorithm (Chou, P. Y., et al.
  • the XTEN polypeptides used in the inventive fusion protein compositions can have an alpha-helix percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm.
  • the XTEN polypeptides comprising the fusion protein compositions can have a beta-sheet percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm.
  • the XTEN sequences of the fusion protein compositions can have an alpha-helix percentage ranging from 0% to less than about 5% and a beta-sheet percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm.
  • the XTEN polypeptides comprising the fusion protein compositions can have an alpha-helix percentage less than about 2% and a beta-sheet percentage less than about 2%.
  • the XTEN sequences of the fusion protein compositions can have a high degree of random coil percentage, as determined by a GOR algorithm.
  • an XTEN polypeptide can have at least about 80%, more preferably at least about 90%, more preferably at least about 91%, more preferably at least about 92%, more preferably at least about 93%, more preferably at least about 94%, more preferably at least about 95%, more preferably at least about 96%, more preferably at least about 97%, more preferably at least about 98%, and most preferably at least about 99% random coil, as determined by a GOR algorithm.
  • the XTEN polypeptides can have an unstructured characteristic imparted by incorporation of amino acid residues with a net chaige and/or reducing the proportion of hydrophobic amino acids in the XTEN polypeptide.
  • the overall net charge and net charge density can be controlled by modifying the content of chaiged amino acids in the XTEN polypeptides.
  • the net charge density of the XTEN of the compositions can be above +0.1 or below -0.1 charges/residue.
  • the net charge of a XTEN polypeptide can be about 0%, about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10% about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, or about 20% or more.
  • the XTEN polypeptides can be designed to have a net negative charge to minimize non-specific interactions between the XTEN polypeptide-containing compositions and various surfaces such as blood vessels, healthy tissues, or various receptors.
  • the XTEN polypeptide can adopt open conformations due to electrostatic repulsion between individual amino acids of the XTEN polypeptide that individually carry a high net negative charge and that are distributed across the sequence of the XTEN polypeptide.
  • Such a distribution of net negative charge in the extended sequence lengths of XTEN polypeptide can lead to an unstructured conformation that, in turn, can result in an effective increase in hydrodynamic radius.
  • the invention provides XTEN polypeptides in which the XTEN polypeptides contain about 8, 10, 15, 20, 25, or even about 30% glutamic acid.
  • the XTEN polypeptides of the compositions of the present invention generally have no or a low content of positively charged amino acids.
  • the XTEN polypeptides can have less than about 10% amino acid residues with a positive charge, or less than about 7%, or less than about 5%, or less than about 2% amino acid residues with a positive charge.
  • the invention contemplates constructs where a limited number of amino acids with a positive charge, such as lysine, can be incorporated into XTEN polypeptides to permit conjugation between the epsilon amine of the lysine and a reactive group on a peptide, a linker bridge, or a reactive group on a drug or small molecule to be conjugated to the XTEN polypeptide backbone.
  • a fusion proteins can be constructed that comprises one or more XTEN polypeptides, a biologically active protein, plus a chemotherapeutic agent useful in the treatment of metabolic diseases or disorders, wherein the maximum number of molecules of the agent incorporated into the XTEN polypeptide component is determined by the numbers of lysines or other amino acids with reactive side chains (e.g., cysteine) incorporated into the XTEN.
  • an XTEN polypeptide can comprise charged residues separated by other residues such as serine or glycine, which can lead to better expression or purification behavior.
  • XTEN polypeptides of the human or animal compositions can have an isoelectric point (pi) of 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, or even 6.5.
  • the XTEN polypeptide has an isoelectric point between 1.5 and 4.5.
  • the XTEN incorporated into the BPXTEN fusion protein compositions of the present invention would cany a net negative charge under physiologic conditions that can contribute to the unstructured conformation and reduced binding of the XTEN polypeptide component to mammalian proteins and tissues.
  • hydrophobic amino acids can impart structure to a polypeptide
  • the invention provides that the content of hydrophobic amino acids in the XTEN polypeptides typically is less than 5%, or less than 2%, or less than 1 % hydrophobic amino acid content.
  • the amino acid content of methionine and tryptophan in the XTEN component of a BPXTEN fusion protein is typically less than 5%, or less than 2%, and most preferably less than 1%.
  • the XTEN polypeptide has a sequence that has less than 10% amino acid residues with a positive charge, or less than about 7%, or less that about 5%, or less than about 2% amino acid residues with a positive charge, the sum of methionine and tryptophan residues is less than 2%, and the sum of asparagine and glutamine residues is less than 10% of the total XTEN polypeptide.
  • the XTEN polypeptide can have a high hydrodynamic radius, conferring a corresponding increased Apparent Molecular Weight to the BPXTEN fusion protein which incorporates the XTEN polypeptide.
  • the linking of an XTEN polypeptide to BP sequences can result in BPXTEN compositions that can have increased hydrodynamic radii, increased Apparent Molecular Weight, and increased Apparent Molecular Weight Factor compared to a BP not linked to an XTEN polypeptide.
  • compositions in which a XTEN polypeptide with a high hydrodynamic radius is incorporated into a fusion protein comprising one or more BP can effectively enlaige the hydrodynamic radius of the composition beyond the glomerular pore size of approximately 3-5 nm (corresponding to an apparent molecular weight of about 70 kDA) (Caliceti. 2003. Pharmacokinetic and biodistribution properties of polyethylene glycol)-protein conjugates. Adv. Drug Deliv. Rev. 55:1261-1277], resulting in reduced renal clearance of circulating proteins.
  • an XTEN polypeptide can adopt open conformations due to electrostatic repulsion between individual charges of the peptide or the inherent flexibility imparted by the particular amino acids in the sequence that lack potential to confer secondary structure.
  • the open, extended and unstructured conformation of the XTEN polypeptide can have a greater proportional hydrodynamic radius compared to polypeptides of a comparable sequence length and/or molecular weight that have secondary and/or tertiary structure, such as typical globular proteins.
  • Methods for determining the hydrodynamic radius are well known in the art, such as by the use of size exclusion chromatography (SEC), as described in U.S. Patent Nos. 6,406,632 and 7,294,513.
  • the BPXTEN fusion protein can be configured with an XTEN polypeptide, wherein the fusion protein can have a hydrodynamic radius of at least about 5 nm, or at least about 8 nm, or at least about 10 nm, or 12 nm, or at least about 15 nm.
  • the large hydrodynamic radius conferred by XTEN polypeptides in an BPXTEN fusion protein can lead to reduced renal clearance of the resulting fusion protein, leading to a corresponding increase in terminal half-life, an increase in mean residence time, and/or a decrease in renal clearance rate.
  • an XTEN polypeptide of a chosen length and sequence can be selectively incorporated into a BPXTEN to create a fusion protein that has, under physiologic conditions, an Apparent Molecular Weight of at least about 150 kDa, or at least about 300 kDa, or at least about 400 kDa, or at least about 500 kDA, or at least about 600 kDa, or at least about 700 kDA, or at least about 800 kDa, or at least about 900 kDa, or at least about 1000 kDa, or at least about 1200 kDa, or at least about 1500 kDa, or at least about 1800 kDa, or at least about 2000 kDa, or at least about 2300 kDa or more.
  • an XTEN polypeptide of a chosen length and sequence can be selectively linked to a BP to result in a BPXTEN fusion protein that has, under physiologic conditions, an Apparent Molecular Weight Factor of at least three, alternatively of at least four, alternatively of at least five, alternatively' of at least six, alternatively of at least eight, alternatively of at least 10, alternatively of at least 15, or an Apparent Molecular Weight Factor of at least 20 or greater.
  • the BPXTEN fusion protein has, under physiologic conditions, an Apparent Molecular Weight Factor that is about 4 to about 20, or is about 6 to about 15, or is about 8 to about 12, or is about 9 to about 10 relative to the actual molecular weight of the fusion protein.
  • the (fusion) polypeptide exhibits an apparent molecular weight factor under physiological conditions that is greater than about 6.
  • the (fusion) polypeptide has a terminal half-life that is at least two-fold longer, or at least three-fold longer, or at least four-fold longer, or at least five-fold longer, compared to the biologically active polypeptide not linked to an XTEN polypeptide. In some embodiments, the (fusion) polypeptide has a terminal half-life that is at least two-fold longer compared to the biologically active polypeptide not linked to an XTEN polypeptide.
  • Administration of a therapeutically effective dose of any of the embodiments of BPXTEN fusion proteins described herein to a human or animal in need thereof can result in a gain in time of at least two-fold, or at least three-fold, or at least four-fold, or at least five-fold or more spent within a therapeutic window for the fusion protein compared to the corresponding BP not linked to the XTEN polypeptide of and administered at a comparable dose to a human or animal.
  • the invention provides compositions in which the XTEN polypeptides have a low degree of immunogenicity or are substantially non-immunogenic.
  • factors can contribute to the low immunogenicity of XTEN polypeptides, eg., the substantially non-repetitive sequence, the unstructured conformation thereof, the high degree of solubility, the low degree or lack of self-aggregation, the low degree or lack of proteolytic sites within the sequence, and the low degree or lack of epitopes in XTEN polypeptides.
  • polypeptide having highly repetitive short amino acid sequences e.g., wherein a 200 amino acid-long sequence contain on average 20 repeats or more of a limited set of 3- or 4-mers
  • contiguous repetitive amino acid residues e.g., wherein 5- or 6-mcr sequences have identical amino acid residues
  • XTEN polypeptides are substantially non-repetitive, wherein the XTEN amino acid sequence has no three contiguous amino acids that are identical amino acid types, unless the amino acid is serine, in which case no more than three contiguous amino acids can be serine residues; and wherein the XTEN amino acid sequence contains no 3-amino acid sequences (3-mers) that occur more than 16, more than 14, more than 12, or more than 10 times within a 200 amino acid-long sequence of the XTEN polypeptide
  • 3-amino acid sequences (3-mers) that occur more than 16, more than 14, more than 12, or more than 10 times within a 200 amino acid-long sequence of the XTEN polypeptide
  • Conformational epitopes are formed by regions of the protein surface that are composed of multiple discontinuous amino acid sequences of the protein antigen.
  • the precise folding of the protein brings these sequences into a well-defined, stable spatial configurations, or epitopes, that can be recognized as “foreign’- by the host humoral immune system, resulting in the production of antibodies to the protein or triggering a cell- mediated immune response.
  • the immune response to a protein in an individual is heavily influenced by T-cell epitope recognition that is a function of the peptide binding specificity of that individual’s HLA-DR allotype.
  • T-cell receptor on the surface of the T-cell, together with the cross-binding of certain other co-receptors such as the CD4 molecule, can induce an activated state within the T-cell. Activation leads to the release of cytokines further activating other lymphocytes such as B cells to produce antibodies or activating T killer cells as a full cellular immune response.
  • a peptide to bind a given MHC Class II molecule for presentation on the surface of an APC is dependent on a number of factors; most notably its primary sequence.
  • a lower degree of immunogenicity can be achieved by designing XTEN polypeptides that resist antigen processing in antigen presenting cells, and/or choosing sequences that do not bind MHC receptors well.
  • the invention provides BPXTEN fusion proteins with substantially non-repetitive XTEN polypeptides designed to reduce binding with MHC II receptors, as well as avoiding formation of epitopes for T-cell receptor or antibody binding, resulting in a low degree of immunogenicity.
  • Avoidance of immunogenicity is, in part, a direct result of the conformational flexibility of XTEN polypeptides; i.e., the lack of secondary structure due to the selection and order of amino acid residues.
  • sequences having a low tendency to adapt compactly folded conformations in aqueous solution or under physiologic conditions that could result in conformational epitopes.
  • the administration of fusion proteins comprising XTEN potypeptides(s) would generally not result in the formation of neutralizing antibodies to the XTEN polypeptide, and can also reduce the immunogenicity of the BP fusion partner in the BPXTEN compositions.
  • the XTEN polypeptides utilized in the human or animal fusion proteins can be substantially free of epitopes recognized by human T cells.
  • epitopes recognized by human T cells.
  • Assays for human T cell epitopes have been described (Stickler, M., et al. (2003) J Immunol Methods, 281 : 95-108].
  • peptide sequences that can be oligomerized without generating T cell epitopes or non-human sequences.
  • the XTEN polypeptides are substantially non-immunogenic by the restriction of the numbers of epitopes of the XTEN polypeptide predicted to bind MHC receptors. With a reduction in the numbers of epitopes capable of binding to MHC receptors, there is a concomitant reduction in the potential for T cell activation as well as T cell helper function, reduced B cell activation or upregulation and reduced antibody production.
  • the low degree of predicted T-cell epitopes can be determined by epitope prediction algorithms such as, e.g., TEPITOPE (Stumiolo, T., et al. (1999) Nat Biotechnol, 17: 555-61), as shown in Example 74 of International Patent Application Publication No. WO 2010/144502 A2, which is incorporated by reference in its entirety.
  • the TEPITOPE score of a given peptide frame within a protein is the log of the K d (dissociation constant, affinity, off-rate) of the binding of that peptide frame to multiple of the most common human MHC alleles, as disclosed in Stumiolo, T. et al. (1999) Nature Biotechnology 17:555].
  • an XTEN polypeptide incorporated into a BPXTEN does not have a predicted T-cell epitope at a TEPITOPE score of about -5 or greater, or -6 or greater, or -7 or greater, or -8 or greater, or at a TEPITOPE score of -9 or greater.
  • a score of “-9 or greater” would encompass TEPITOPE scores of 10 to -9, inclusive, but would not encompass a score of -10, as -10 is less than -9.
  • the inventive XTEN polypeptides can be rendered substantially non-immunogenic by the restriction of known proteolytic sites from the sequence of the XTEN polypeptide, reducing the processing of XTEN polypeptides into small peptides that can bind to MHC II receptors.
  • the XTEN polypeptide can be rendered substantially non-immunogenic by the use a sequence that is substantially devoid of secondary structure, conferring resistance to many proteases due to the high entropy of the structure.
  • an XTEN polypeptide of a BPXTEN fusion protein can have >100 nM Kd binding to a mammalian receptor, or greater than 500 nM K d , or greater than 1 ⁇ Kd towards a mammalian cell surface or circulating polypeptide receptor.
  • XTEN polypeptides can limit the ability of B cells to bind to or be activated by XTEN polypeptides. While an XTEN polypeptide can make contacts with many different B cells over its extended sequence, each individual B cell can only make one or a small number of contacts with an individual XTEN polypeptide. As a result, XTEN polypeptides typically can have a much lower tendency to stimulate proliferation of B cells and thus an immune response. In one embodiment, the BPXTEN can have reduced immunogenicity as compared to the corresponding BP that is not fused.
  • the administration of up to three parenteral doses of a BPXTEN to a mammal can result in detectable anti-BPXTEN IgG at a senim dilution of 1 :100 but not at a dilution of 1:1000.
  • the administration of up to three parenteral doses of an BPXTEN to a mammal can result in detectable anti-BP IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
  • the administration of up to three parenteral doses of an BPXTEN to a mammal can result in detectable anti-XTEN IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
  • the mammal can be a mouse, a rat, a rabbit, or a cynomolgus monkey.
  • An additional feature of certain embodiments of XTEN polypeptides with substantially non-repetitive sequences relative to those less non-repetitive sequences can be that non-repetitive XTEN polypeptides form weaker contacts with antibodies (e.g. monovalent interactions), thereby resulting in less likelihood of immune clearance wherein the BPXTEN compositions can remain in circulation for an increased period of time.
  • the (fusion) polypeptide is less immunogenic compared to the biologically active polypeptide not linked to an XTEN polypeptide, wherein immunogenicity is ascertained by measuring production of IgG antibodies that selectively bind to the biologically active polypeptide after administration of comparable doses to a human or animal.
  • the BP component either becomes biologically active or has an increase in biological activity upon its release from the XTEN polypeptide(s) by cleavage of an optional cleavage sequence incorporated within spacer sequences into the BPXTEN, as described more fully hereinbelow.
  • any spacer sequence group is optional in the fusion proteins encompassed by the invention.
  • the spacer can be provided to enhance expression of the fusion protein from a host cell or to decrease steric hindrance wherein the BP component can assume its desired tertiary structure and/or interact appropriately with its target molecule.
  • the spacer comprises one or more peptide sequences that are between I to 50 amino acid residues in length, or about 1 to 25 residues, or about 1 to 10 residues in length.
  • Spacer sequences exclusive of cleavage sites, can comprise any of the 20 natural L amino acids, and preferably comprises hydrophilic amino acids that are sterically unhindered that can include, but not be limited to, glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P).
  • the spacer can be polyglycines or polyalanines, or predominately a mixture of combinations of glycine and alanine residues.
  • the spacer polypeptide exclusive of a cleavage sequence is largely to substantially devoid of secondary structure.
  • one or both spacer sequences in a BPXTEN fusion protein composition can each further contain a cleavage sequence, which can be identical or can be different, wherein the cleavage sequence can be acted on by a protease to release the BP from the fusion protein.
  • the incorporation of the cleavage sequence into the BPXTEN is designed to permit release of a BP that becomes active or more active upon its release from the XTEN polypeptide.
  • the cleavage sequences are located sufficiently close to the BP sequences, generally within 18, or within 12, or within 6, or within 2 amino acids of the BP sequence terminus, wherein any remaining residues attached to the BP after cleavage do not appreciably interfere with the activity (e g., such as binding to a receptor) of the BP, yet provide sufficient access to the protease to be able to effect cleavage of the cleavage sequence.
  • the cleavage site is a sequence that can be cleaved by a protease endogenous to the mammalian human or animal wherein the BPXTEN can be cleaved after administration to a human or animal.
  • the BPXTEN can serve as a prodrug or a circulating depot for the BP.
  • cleavage sites contemplated by the invention include, but are not limited to, a polypeptide sequence cleavablc by a mammalian endogenous protease selected from FXIa, FXlIa, kallikrein, FVIla, FIXa, FXa, Flla (thrombin), Elastase-2, granzyme B, MMP-12, MMP-13, MMP-17 or MMP-20, or by non-mammalian proteases such as TEV, enterokinase.
  • PreScissionTM protease ihinovirus 3C protease
  • sortase A Sequences known to be cleaved by the foregoing proteases are known in the art.
  • cleavage sequences and cleavage sites within the sequences are set forth in Table 7a, as well as sequence variants.
  • thrombin activate clotting factor II
  • LTPRSLLV sequence LTPRSLLV
  • Active Flla is produced by cleavage of FII by FXa in the presence of phospholipids and calcium and is downstream from factor IX in the coagulation pathway.
  • incorporation of other sequences into BPXTEN that are acted upon by endogenous proteases would provide for sustained release of BP that can, in certain cases, provide a higher degree of activity for the BP from the “prodrug” form of the BPXTEN.
  • the known cleavage sequence can have one or more deletions or insertions or one or two or three amino acid substitutions for any one or two or three amino acids in the known sequence, wherein the deletions, insertions or substitutions result in reduced or enhanced susceptibility but not an absence of susceptibility to the protease, resulting in an ability to tailor the rate of release of the BP from the XTEN. Exemplary substitutions are shown in Table 7a.
  • the BPXTEN fusion protein can comprise spacer sequences that can further comprise one or more cleavage sequences configured to release the BP from the fusion protein when acted on by a protease.
  • the one or snore cleavage sequences can be a sequence having at least about 80% (e.g., at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100%) sequence identity to a sequence set forth in Table 7a.
  • the disclosure provides BP release segment peptides (or release segment (RS)) that are substrates for one or more mammalian proteases associated with or produced by disease tissues or cells found in proximity to disease tissues.
  • proteases can include, but not be limited to the classes of proteases such as metalloproteinases, cysteine proteases, aspartate proteases, and serine proteases, including, but not limited to, the proteases set forth in Table 7b.
  • the RS are useful for, amongst other things, incorporation into the human or animal recombinant polypeptides, conferring a prodrag format that can be activated by the cleavage of the RS by mammalian proteases.
  • the RS are incorporated into the human or animal recombinant polypeptide compositions, linking the incorporated binding moieties to the XTEN (the configurations of which are described more fully, below) wherein upon cleavage of the RS by action of the one or more proteases for which the RS are substrates, the binding moieties and XTEN are released from the composition and the binding moieties, no longer shielded by the XTEN, regain their full potential to bind their ligands.
  • the compositions are also referred to herein as activatable antibody compositions (AAC).
  • the disclosure provides activatable recombinant polypeptides comprising a first release segment (RSI) sequence having at least 88%, or at least 94%, or 100% sequence identity, when optimally aligned, to a sequence selected from the sequences set forth in Table 8a, wherein the RSI is a substrate for one or more mammalian proteases.
  • RSI first release segment
  • the disclosure provides activatable recombinant polypeptides comprising a RS I and a second release segment (RS2) sequence, each having at least 88%, or at least 94%, or 100% sequence identity, when optimally aligned, to a sequence selected from the sequences set forth in Table 8a, wherein the RSI and the RS2 each are a substrate for one or more mammalian proteases.
  • RS2 second release segment
  • disclosure provides activatable recombinant polypeptides comprising a first RS (RSI) sequence having at least 90%, at least 93%, at least 97%, or 100% identity, when optimally aligned, to a sequence selected from the sequences set forth in Table 8b, wherein the RS is a substrate for one or more mammalian proteases.
  • RSI RS
  • the disclosure provides activatable recombinant polypeptides comprising a RSI and a second release segment (RS2) sequence, each having at least 88%, or at least 94%, or 100% sequence identity, when optimally aligned, to a sequence selected from the sequences set forth in Table 8b, wherein the RSI and the RS2 are each a substrate for one or more mammalian proteases,
  • the two release segments can be identical or the sequences can be different.
  • the present disclosure contemplates release segments that are substrates for one, two or three different classes of proteases selected from metalloproteinases, cysteine proteases, aspartate proteases, and serine proteases, including the proteases set forth in Table 7b.
  • the RS serve as substrates for proteases found in close association with or are co- localized with disease tissues or cells, such as but not limited to tumors, cancer cells, and inflammatory tissues, and upon cleavage of the RS, the binding moieties that are olherwise shielded by the XTEN of the human or animal recombinant polypeptide compositions (and thus have a lower binding affinity for their respective ligands) are released from the composition and regain their full potential to bind the target and/or effector cell ligands.
  • disease tissues or cells such as but not limited to tumors, cancer cells, and inflammatory tissues
  • the RS of the human or animal recombinant polypeptide compositions comprises an amino acid sequence that is a substrate for a cellular protease located within a targeted cell, including but not limited to the proteases set forth in Table 7b.
  • the RS that are substrates for two or three classes of proteases were designed with sequences that are capable of being cleaved in different locations of the RS sequence by the different proteases.
  • the RS that are substrates for two, three, or more classes of proteases have two, three, or a plurality of distinct cleavage sites in the RS sequence, but cleavage by a single protease nevertheless results in the release of the binding moieties and the XTEN from the recombinant polypeptide composition comprising the RS.
  • the RS of the disclosure for incorporation into the human or animal recombinant polypeptide compositions is a substrate for one or more proteases including meprin, neprilysin (CD10), PSMA, BMP-1, A disintegrin and metalloproteinases (ADAMs), ADAMS, ADAM9, ADAM10, ADAM12, ADAM15, ADAM17 (TACE), ADAM 19, ADAM28 (MDC-L), ADAM with thrombospondin motifs (ADAMTS), ADAMTS1, ADAMTS4, ADAMTS5, MMP-1 (collagenase 1), matrix metalloproteinase- 1 (MMP-I), matrix metalloproteinase-2 (MMP-2, gelatmase A), matrix metalloproteinasc-3 (MMP-3, strome!ysin 1), matrix metal!oproteinase-7 (MMP-7, Matrilysin 1), matrix metal!oproteinase-8 (MMP-8,
  • proteases including me
  • the RS is a substrate for ADAMI7. In one embodiment, the RS is a substrate for BMP-1. In one embodiment, the RS is a substrate for cathepsin. In one embodiment, the RS is a substrate for HtrAl. In one embodiment, the RS is a substrate for legumain. In one embodiment, the RS is a substrate for MMP-1. In one embodiment, the RS is a substrate for MMP-2. In one embodiment, the RS is a substrate for MMP-7. In one embodiment, the RS is a substrate for MMP-9. In one embodimenL the RS is a substrate for MMP-11. In one embodiment, the RS is a substrate for MMP-I4.
  • the RS is a substrate for uPA. In one embodiment, the RS is a substrate for matriptase. In one embodiment, the RS is a substrate for MT -SP1. In one embodimenL the RS is a substrate for neutrophil elastasc. In one embodiment, the RS is a substrate for thrombin. In one embodiment RS is a substrate for TMPRSS3. In one embodimenL the RS is a substrate for TMPRSS4.
  • the RS of the human or animal recombinant polypeptide compositions is a substrate for at least two proteases that are legumain, MMP-1, MMP-2, MMP-7, MMP-9, MMP-11, MMP-14, uPA, and matriptase.
  • the RS of the human or animal recombinant polypeptide compositions is a substrate for legumain, MMP-1, MMP-2, MMP- 7, MMP-9, MMP-11, MMP-14, uPA, and matriptase.
  • the RS for incorporation into the human or animal recombinant polypeptides can be designed to be selectively sensitive in order to have different rates of cleavage and different cleavage efficiencies to the various proteases for which they are substrates.
  • the disclosure provides RS that have had the individual amino acid sequences engineered to have a higher or lower cleavage efficiency for a given protease in order to ensure that the recombinant polypeptide is preferentially converted from the prodrug form to the active form (i.e., by the separation and release of the binding moieties and XTEN from the recombinant polypeptide after cleavage of the RS) when in proximity to the target cell or tissue and its colocalized proteases compared to the rate of cleavage of the RS in healthy tissue or the circulation wherein the released antibody fragment binding moieties have a greater ability to bind to ligands in the diseased tissues compared to the prodrug form that remains in circulation.
  • the therapeutic index of the resulting compositions can be improved
  • cleavage efficiency is defined as the log2 value of the ratio of the percentage of the test substrate comprising the RS cleaved to the percentage of the control substrate AC 1611 cleaved when each is human or animal to the protease enzyme in biochemical assay's (further detailed in the Examples) in which reaction in conducted wherein the initial substrate concentration is 6 ⁇ , the reactions are incubated at 37°C for 2 hours before being stopped by adding EDTA, with the amount of digestion products and uncleaved substrate analyzed by non-reducing SDS-PAGE to establish the ratio of the percentage cleaved.
  • cleavage efficiency is calculated as follows: Thus, a cleavage efficiency of -1 means that the amount of test substrate cleaved was 50% compared to that of the control substrate, while a cleavage efficiency of +1 means that the amount of test substrate cleaved was 200% compared to that of the control substrate. A higher rate of cleavage by the test protease relative to the control would result in a higher cleavage efficiency, and a slower rate of cleavage by the test protease relative to the control would result in a lower cleavage efficiency.
  • a control RS sequence AC 1611 (RSR- 1517], having the amino acid sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261), was established as having an appropriate baseline cleavage efficiency by the proteases legumain, MMP-2, MMP-7, MMP-9, MMP-14, uPA, and matriptase, when tested in in vitro biochemical assays for rates of cleavage by the individual proteases.
  • the disclosure provides RS in which the RS is cleaved by a protease selected from legumain, MMP-1, MMP-2, MMP-7, MMP-9, MMP- 11, MMP-14, uPA, or matriptase with at least a 0.2 log:, or 0.4 log:, or 0.8 log:, or 1.0 log: higher cleavage efficiency in an in vitro biochemical competitive assay compared to the cleavage by the same protease of a control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • a protease selected from legumain, MMP-1, MMP-2, MMP-7, MMP-9, MMP- 11, MMP-14, uPA, or matriptase with at least a 0.2 log:, or 0.4 log:, or 0.8 log:, or 1.0 log: higher cleavage efficiency in an in vitro biochemical competitive assay compared to the cleavage by the
  • the disclosure provides RS in which the RS is cleaved by a protease selected from legumain, MMP-1 , MMP-2, MMP-7, MMP-9, MMP-11 , MMP-14, uPA, or matriptase with at least a 0.2 log:, or 0.4 log:, or 0.8 log:, or 1.0 log: lower cleavage efficiency in an in vitro biochemical competitive assay compared to the cleavage by the same protease of a control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • a protease selected from legumain, MMP-1 , MMP-2, MMP-7, MMP-9, MMP-11 , MMP-14, uPA, or matriptase with at least a 0.2 log:, or 0.4 log:, or 0.8 log:, or 1.0 log: lower cleavage efficiency in an in vitro biochemical competitive assay compared to the cle
  • the disclosure provides RS in which the rate of cleavage of the RS by a protease selected from legumain, MMP-1, MMP-2, MMP-7, MMP-9, MMP-11, MMP-14, uPA, or matriptase is at least 2-fold, or at least 4-fold, or at least 8 fold, or at least 16-fold faster compared to the control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • a protease selected from legumain, MMP-1, MMP-2, MMP-7, MMP-9, MMP-11, MMP-14, uPA, or matriptase is at least 2-fold, or at least 4-fold, or at least 8 fold, or at least 16-fold faster compared to the control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • the disclosure provides RS in which the rate of cleavage of the RS by a protease selected from legumain, MMP-I, MMP-2, MMP-7, MMP-9, MMP-I 1, MMP-14, uPA, or matriptase is at least 2-fold, or at least 4-fold, or at least 8 fold, or at least 16-fold slower compared to the control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • a protease selected from legumain, MMP-I, MMP-2, MMP-7, MMP-9, MMP-I 1, MMP-14, uPA, or matriptase is at least 2-fold, or at least 4-fold, or at least 8 fold, or at least 16-fold slower compared to the control sequence RSR-1517 having the sequence EAGRSANHEPLGLVAT (SEQ ID NO: 8261).
  • the disclosure provides AAC comprising multiple RS wherein each RS sequence is selected from the group of sequences set forth in Table 8a and the RS are linked to each other by 1 to 6 amino acids selected from glycine, serine, alanine, and threonine.
  • the AAC comprises a first RS and a second RS different from the first RS wherein each RS sequence is selected from the group of sequences set forth in Table 8a and the RS are linked to each other by 1 to 6 amino acids selected from glycine, serine, alanine, and threonine.
  • the AAC comprises a first RS, a second RS different from the first RS, and a third RS different from the first and the second RS wherein each sequence is selected from the group of sequences set forth in Table 8a and the first and the second and the third RS are linked to each other by 1 to 6 amino acids selected from glycine, serine, alanine, and threonine. It is specifically intended that the multiple RS of the AAC can be concatenated to form a sequence that can be cleaved by multiple proteases at different rates or efficiency of cleavage.
  • the disclosure provides AAC comprising an RSI and an RS2 selected from the group of sequences set forth in Tables 8a-8b and an XTEN 1 and XTEN 2, such as those described hereinabove or described elsewhere herein, wherein the RSI is fused between the XTEN1 and the binding moieties and the RS2 is fused between the XTEN2 and the binding moieties.
  • compositions would be more readily cleaved by diseased target tissues that express multiple proteases, compared with healthy tissues or when in the normal circulation, with the result that the resulling fragments bearing the binding moieties would more readily penetrate the target tissue; e.g., a tumor, and have an enhanced ability to bind and link the target cell and the effector cell (or just the target cell in the case of AAC designed with a single binding moiety.
  • the RS of the disclosure are useful for inclusion in recombinant polypeptides as therapeutics for treatment of cancers, autoimmune diseases, inflammatory diseases and other conditions where localized activation of the recombinant polypeptide is desirable.
  • the human or animal compositions address an unmet need and are superior in one or more aspects including enhanced terminal half-life, targeted delivery, and improved therapeutic ratio with reduced toxicity to healthy tissues compared to conventional antibody therapeutics or bispecific antibody therapeutics that are active upon injection.
  • the (fusion) polypeptide comprises a first release segment (RSI) located between the (first) XTEN and the biologically active polypeptide.
  • the polypeptide further comprises a second release segment (RS2) located between the biologically active polypeptide and the second XTEN.
  • RSI and RS2 are identical in sequence.
  • RSI and RS2 arc not identical in sequence.
  • the RSI comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence set forth in Tables 8a-8b.
  • the RS2 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence set forth in Tables 8a- 8b.
  • the RSI and RS2 are each a substrate for cleavage by multiple proteases at one, two, or three cleavage sites within each release segment sequence.
  • the (fusion) polypeptide further comprises one or more reference fragments releasable from the polypeptide upon digestion by the protease.
  • the one or more reference fragments each comprise a portion of the biologically active polypeptide.
  • the one or more reference fragments is a single reference fragment that differs in sequence and molecular weight from all other peptide fragments that are releasable from the polypeptide upon digestion of the polypeptide by the protease.
  • each polypeptide of the first set of polypeptides comprises a barcode fragment that (a) is releasable from the polypeptide by digestion with a protease and (b) has a sequence and molecular weight that differs from the sequence and molecular weight of all other fragment] that are releasable from the first set of polypeptides.
  • the second set of polypeptides lack the barcode fragment of the first set of polypeptides.
  • both the first set of polypeptides and the second set of polypeptides each comprise a reference fragment that (a) is common to the first set of polypeptides and the second set of polypeptides and (b) releasable by digestion with the protease.
  • the ratio of the first set of polypeptides to polypeptides comprising the reference fragment is greater than 0.70. In some embodiments, the ratio of the first set of polypeptides to polypeptides comprising the reference fragment is greater than 0.8, 0.9, 0.95, or 0.98. In some embodiments, the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the protease is a protease that cleaves on the C-tcrminal side of glutamic acid residues. In some embodiments, the protease is a Glu-C protease. In some embodiments, the protease is not trypsin.
  • the polypeptides of varying lengths comprise polypeptides comprising at least one extended recombinant polypeptide (XTEN), such as any described hereinabove or described anywhere else herein.
  • the first set of polypeptides comprises a full-length polypeptide, wherein the barcode fragment is a portion of the full-length polypeptide.
  • the full-length polypeptide is a (fusion) polypeptide, such as any described hereinabove or described anywhere else herein.
  • the barcode fragment lacks (does not comprise) both the N -terminal amino acid and C-terminal amino acid of the full-length polypeptide.
  • the mixture of polypeptides of varying lengths differ from one another due to N-terminal truncation, C-terminal truncation, or both N- and C-terminal truncation of a full-length polypeptide.
  • the first set of polypeptides and the second set of polypeptides can differ in one or more pharmacological properties. Non-limiting exemplary' properties include.
  • Disclosed herein includes a method for assessing, in a mixture comprising polypeptides of varying length, a relative amount of a first set of polypeptides in the mixture to a second set of polypeptides in the mixture, wherein (1) each polypeptide of the first set of polypeptides shares a barcode fragment that occurs once and only once in the polypeptide and (2) each polypeptide of the second set of polypeptides lacks the barcode fragment that is shared by polypeptides of the first set, wherein individual polypeptides of both the first of polypeptides and the second set of polypeptides each comprises a reference fragment.
  • the method can comprise contacting the mixture with a protease to produce a plurality of proteolytic fragments that result from cleavage of the first set of polypeptides and the second set of polypeptides, wherein the plurality of proteolytic fragments comprises a plurality of reference fragments, and a plurality of barcode fragments.
  • the method can further comprise determining a ratio of the amount of barcode fragments to the amount of reference fragments, thereby assessing the relative amounts of the first set of polypeptides to the second set of polypeptides.
  • the barcode fragment occurs no more than once in each polypeptide of the first set of polypeptides.
  • the reference fragment occurs no more than once in each polypeptide of the first set of polypeptides and the second set of polypeptides.
  • the plurality of proteolytic fragments comprises a plurality of reference fragments, and a plurality of barcode fragments.
  • the protease cleaves the first and second sets of polypeptides (or the polypeptides of varying length) on the C- terminal side of glutamic acid residues that are not followed by a proline residue.
  • the protease is a Glu-C protease. In some embodiments, the protease is not trypsin.
  • the step of determining a ratio of the amount of barcode fragments to the amount of reference fragments comprises quantifying barcode fragments and reference fragments from the mixture after it has been contacted with the protease. In some embodiments, the barcode fragments and the reference fragments are identified based on their respective masses. In some embodiments, the barcode fragments and the reference fragments are identified via mass spectrometry. In some embodiments, the barcode fragments and reference fragments are identified via liquid chromatography-mass spectrometry (LC-MS). In some embodiments, the step of determining a ratio of the barcode fragments to the reference fragments comprises isobaric labeling.
  • the step of determining a ratio of the barcode fragments to the reference fragments comprises spiking the mixture with one or both of an isotope-labeled reference fragment and an isotope labeled barcode fragment.
  • the polypeptides of varying lengths comprise polypeptides that comprise at least one extended recombinant polypeptide (XTEN), as described hereinabove or described anywhere else herein.
  • the XTEN is characterized in that (i) it comprises at least 150 amino acids; (ii) at least 90% of the amino acid residues of the XTEN are selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P); and (iii) it comprises at least 4 different types of amino acids selected from G, A, S, T, E, and P.
  • the barcode fragment when present, is a portion of the XTEN.
  • the mixture of polypeptides of varying lengths comprises a polypeptide as any described hereinabove or described anywhere else herein.
  • the polypeptides of varying length comprise a full-length polypeptide and truncated fragments thereof. In some embodiments, the polypeptides of varying length consist essentially of the full-length polypeptide and truncated fragments thereof. In some embodiments, the mixture of polypeptides of varying lengths differ from one another due to N-terminal truncation, C-terminal truncation, or both N- and C- terminal truncation of a full-length polypeptide. In some embodiments, the full-length polypeptide is a polypeptide as described hereinabove or described anywhere else herein. In some embodiments, the ratio of the amount of barcode fragments to reference fragments is greater than 0.5, 0.6, 0.7, 0.8, 0.9, 0.95, 0.98, or 0.99.
  • isobaric labeling can be used for determining a ratio of the barcode fragments to the reference fragments.
  • isobaric labeling is a mass spectrometry strategy used in quantitative proteomics, wherein peptides or proteins (or portions thereof) are labeled with various chemical groups that are isobaric (identical in mass) but vary in terms of distribution of heavy isotopes around their structure. These tags, commonly referred to as tandem mass tags, are designed so that the mass tag is cleaved at a specific linker region upon high-energy collision-induced dissociation (CID) during tandem mass spectrometry, thereby yielding reporter ions of different masses.
  • CID collision-induced dissociation
  • the enhanced ability to detect and quantify truncation products can generate knowledge than can aid in designing manufacturing processes to include purification steps to minimize the presence of unwanted variants in the purified drug substance/product.
  • the disclosure herein includes a nucleic acid.
  • the nucleic acid can comprise a polynucleotide (or polynucleotide sequence) encoding a (fusion) polypeptide, such as any described hereinabove or described anywhere else herein; or the nucleic acid can comprise the reverse complement of such a polynucleotide (or polynucleotide sequence).
  • the disclosure herein includes an expression vector that comprises a polynucleotide sequence, such as any described in the preceding paragraph, and a regulatory sequence operably linked to the polynucleotide sequence.
  • the disclosure herein includes a host cell comprising an expression vector, such as described in the preceding paragraph.
  • the host cell is a prokaryote.
  • the host cell is E. colt.
  • the host cell is a mammalian cell.
  • the disclosure provides methods of manufacturing the human or animal compositions.
  • the method comprises culturing a host cell comprising a nucleic acid construct that encodes a polypeptide or an XTEN -containing composition of any of the embodiments described herein under conditions that promote the expression of the polypeptide or BPXTEN fusion polypeptide, followed by recovery of the polypeptide or BPXTEN fusion polypeptide using standard purification methods (e g., column chromatography, HPLC, and the like) wherein the composition is recovered wherein at least 70%, or at least 80%, or at least 90%, or at least 95%, or at least 97%, or at least 99% of the binding fragments of the expressed polypeptide or BPXTEN fusion polypeptide are correctly folded.
  • standard purification methods e g., column chromatography, HPLC, and the like
  • the expressed polypeptide or BPXTEN fusion polypeptide is recovered in which at least or at least 90%, or at least 95%, or at least 97%, or at least 99% of the polypeptide or BPXTEN fusion polypeptide is recovered in monomeric, soluble form.
  • the disclosure relates to methods of making the polypeptide and BPXTEN fusion polypeptide at high fermentation expression levels of functional protein using an E. coli or mammalian host cell, as well as providing expression vectors encoding the constructs useful in methods to produce the cytotoxically active polypeptide construct compositions at high expression levels.
  • the method comprises the steps of I) preparing the polynucleotide encoding the polypeptides of any of the embodiments disclosed herein, 2) cloning the polynucleotide into an expression vector, which can be a plasmid or other vector under control of appropriate transcription and translation sequences for high level protein expression in a biological system, 3) transforming an appropriate host cell with the expression vector, and 4) culturing the host cell in conventional nutrient media under conditions suitable for the expression of the polypeptide composition.
  • the host cell is E. coli.
  • the expression of the polypeptide results in fermentation titers of at least 0.05 g/L, or at least 0.1 g/L, or at least 0.2 g/L, or at least 0.3 g/L, or at least 0.5 g/L, or at least 0.6 g/L, or at least 0.7 g/L, or at least 0.8 g/L, or at least 0.9 g/L, or at least 1 g/L, or at least 2 g/L, or at least 3 g/L, or at least 4 g/L, or at least 5 g/L of the expression product of the host cell and wherein at least 70%, or at least 80%, or at least 90%, or at least 95%, or at least 97%, or at least 99% of the expressed protein are correctly folded.
  • the term “correctly folded” means that the antigen binding fragments component of the composition have the ability to specifically bind its target ligand.
  • the disclosure provides a method for producing a polypeptide or BPXTEN fusion polypeptide, the method comprising culturing in a fermentation reaction a host cell that comprises a vector encoding a polypeptide comprising the polypeptide or BPXTEN fusion polypeptide under conditions effective to express the polypeptide product at a concentration of more than about 10 milligrams/gram of dry weight host cell (mg/g), or at least about 250 mg/g, or about 300 mg/g, or about 350 mg/g, or about 400 mg/g, or about 450 mg/g, or about 500 mg/g of said polypeptide when the fermentation reaction reaches an optical density' of at least 130 at a wavelength of 600 nm, and wherein the antigen binding fragments of the expressed protein are correctly folded.
  • mg/g milligrams/gram of dry weight host cell
  • the disclosure provides a method for producing a polypeptide or BPXTEN fusion polypeptide, the method comprising culturing in a fermentation reaction a host cell that comprises a vector encoding the composition under conditions effective to express the polypeptide product at a concentration of more than about 10 milligrams/gram of dry weight host cell (mg/g), or at least about 250 mg/g, or about 300 mg/g, or about 350 mg/g, or about 400 mg/g, or about 450 mg/g, or about 500 mg/g of said polypeptide when the fermentation reaction reaches an optical density of at least 130 at a wavelength of 600 nm, and wherein the expressed polypeptide product is soluble.
  • mg/g milligrams/gram of dry weight host cell
  • a pharmaceutical composition comprising a BPXTEN polypeptide, such as any described hereinabove or described anywhere else herein, and one or more pharmaceutically acceptable excipients.
  • the pharmaceutical composition is formulated for intradermal, subcutaneous, intravenous, intra-arterial, intraabdominal, intraperitoneal, intravitreal, intrathecal, or intramuscular administration.
  • the pharmaceutical composition is in a liquid form.
  • the pharmaceutical composition is in a device that is implanted into the eye or another body part.
  • the pharmaceutical composition is in a pre-filled syringe for a single injection.
  • the pharmaceutical composition is formulated as a lyophilized powder to be reconstituted prior to administration.
  • the dose is administered intradermally, subcutaneously, intravenously, intravilreally (or otherwise injected into the eye), intra-arterially, intra-abdominally, intraperitoneally, intrathecally, or intramuscularly.
  • the pharmaceutical composition is administered using a device implanted into the eye or other body part.
  • the human or animal is a mouse, rat, monkey', or human.
  • compositions can be administered for therapy by any suitable route
  • pharmaceutical compositions can also contain other pharmaceutically active compounds or a plurality of compounds of the invention.
  • the pharmaceutical composition can be administered at a therapeutically effective dose.
  • the therapeutically effective dose results in a gain in time spent within a therapeutic window for the fusion protein compared to the corresponding BP of the fusion protein not linked to the fusion protein and administered at a comparable dose to a human or animal.
  • invention provides a method of treating a disease, disorder or condition, comprising administering the pharmaceutical composition described above to a human or animal using multiple consecutive doses of the pharmaceutical composition administered using a therapeutically effective dose regimen
  • BPXTEN polypeptides of the present invention can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the polypeptide is combined in admixture with a pharmaceutically acceptable carrier vehicle, such as aqueous solutions or buffers, pharmaceutically acceptable suspensions and emulsions.
  • a pharmaceutically acceptable carrier vehicle such as aqueous solutions or buffers, pharmaceutically acceptable suspensions and emulsions.
  • Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers, as described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
  • the invention provides a kit to facilitate the use of the BPXTEN polypeptides.
  • the kit comprises, in at least a first container: (a) an amount of a BPXTEN fusion protein composition sufficient to treat a disease, condition or disorder upon administration to a human or animal in need thereof; and (b) an amount of a pharmaceutically acceptable carrier; together in a formulation ready for injection or for reconstitution with sterile water, buffer, or dextrose; together with a label identifying the BPXTEN drug and storage and handling conditions, and a sheet of the approved indications for the drug, instructions for the reconstitution and/or administration of the BPXTEN drug for the use for the prevention and/or treatment of an approved indication, appropriate dosage and safety information, and information identifying the lot and expiration of the drug.
  • the kit can comprise a second container that can carry a suitable diluent for the BPXTEN composition, which provides the user with the appropriate concentration of BPXTEN to
  • a polypeptide such as any described hereinabove or described anywhere else herein, in the preparation of a medicament for the treatment of a disease in a human or animal.
  • the particular disease to be treated depends on the choice of the biologically active proteins.
  • the disease is cancer.
  • Disclosed herein includes a method of treating a disease in a human or animal, the method comprising administering to the human or animal in need thereof one or more therapeutically effective doses of the pharmaceutical composition, such as any described hereinabove or described anywhere else herein.
  • the disease is cancer.
  • the pharmaceutical composition is administered to the human or animal as one or more therapeutically effective doses administered according to a dosage regimen.
  • the human or animal is a mouse, rat, monkey, or human.
  • This example illustrates an exemplary design approach to barcoded XTEN polypeptide by making minimal mutation(s) of the amino acid sequence of a general-purpose XTEN polypeptide (such as one of Table 3b hereinabove).
  • the relevant criteria for performing minimal mutation(s) include one or more of the following: (a) to minimize the sequence change of the corresponding XTEN polypeptide; (b) to minimize the amino acid composition change in the corresponding XTEN polypeptide; (c) to substantially maintain the net charge in the corresponding XTEN polypeptide; (d) to substantially maintain the low immunogenicity of the corresponding XTEN polypeptide; (e) to substantially maintain the pharmacokinetic properties afforded by the XTEN polypeptide.
  • barcoded XTENs were constructed by performing one or more mutations comprising deletion of a glutamic acid residue, insertion of a glutamic acid residue, substitution of a glutamic acid residue, or substitution for a glutamic acid residue, or any combination thereof to the general-purpose XTENs in Tabic
  • This example illustrates the design and selection of barcoded XTEN polypeptide (and the assembly of more than one barcoded XTENs into a set) for fusion to a biologicaUy-active polypeptide.
  • the barcode fragments can indicate truncation(s) of the XTEN polypeptide.
  • a 10-mer peptide sequence “TPGTSTEPSE (SEQ ID NO: 8880)” and a 14-mer peptide sequence “GSAPGSEPATSGSE (SEQ ID NO: 8881)” each occur once and only once in the longer XTEN864, while all other peptide sequences occur two or more times in XTEN864.
  • the 14-mer peptide sequence “GSAPGSEPATSGSE (SEQ ID NO: 8881)” also occurs once and only once in the shorter XTEN288J.
  • the uniqueness of a candidate barcode is assessed in relation to all other peptide fragments releasable from the XTEN polypeptide-containing construct. Accordingly, a barcode sequence in one XTEN polypeptide cannot occur anywhere else in the XTEN polypeptide-containing construct, including any other XTEN polypeptide contained therew'ithin, any biologically-active protein contained therewithin, or any connection between neighboring components thereof.
  • Table 11 shows a peptide “uniqueness” table for the set of two XTEN polypeptides.
  • the selection of a barcode can further involve identify ing and determining the proper location(s) or position(s) of the candidate barcode(s) within the XTEN polypeptide.
  • the location or position of a candidate barcode can be associated with pharmacologically relevant information of the XTEN polypeptide (and the XTEN polypeptide-containing construct as a whole), such as truncation of the XTEN polypeptide beyond a critical length and/or deletion(s) in the XTEN polypeptide.
  • TPGTSTEPSE SEQ ID NO: 8880
  • TPGTSTEPSE SEQ ID NO: 8880
  • AAA-Glu-Barcode Peptide-BBB wherein ‘'AAA” represents Gly, Ala, Ser, Thr or Pro and "BBB” represent Gly, Ala, Ser, or Thr configured to facilitate efficient release of the barcode peptide by GluC digestion.
  • the insertion of each barcode peptide in the XTEN can result in additional unique sequences directly preceding or following the inserted barcode peptides. Table 12. List of suitable barcode peptides
  • Example 3 Design and selection of XTEN(s) in full sequence XTENylated polypeptide constructs [0283] This example illustrates the design of a full-sequence polypeptide construct, containing two XTEN polypeptides, one at the N-tenninus and the other at the C -terminus
  • Table 13 below illustrates XTEN polypeptides used in a representative barcoded BPXTEN (containing barcoded XTEN polypeptides at both the N- and C-termini) and a reference BPXTEN (containing general- purpose XTENs at both the N- and C-termini).
  • a barcoded XTEN polypeptide SEQ ID No. 8014
  • another barcoded XTEN polypeptide SEQ ID No. 8015] is fused at the C-terminus of the BP.
  • a “Ref-N” XTEN polypeptide SEQ ID No.
  • a “Ref-C” XTEN polypeptide (SEQ ID No. 8897] is fused at the C-terminus of the BP.
  • the “Ref-N” XTEN polypeptide (SEQ ID No. 8896) is comparable in length to the barcoded XTEN polypeptide SEQ ID No. 8014; and the ‘‘Ref-C” XTEN polypeptide (SEQ ID No. 8897]is comparable in length to the barcoded XTEN polypeptide SEQ ID No. 8015.
  • the barcoded and reference BPXTENs each contain a reference sequence in the BP component.
  • the reference sequence is unique and differs in molecular weight from all other peptide fragments that are releasable from the corresponding BPXTEN upon complete digestion by GluC protease (e.g., according to Example 5].
  • the uniqueness of the reference sequence is assessed in relation to all other peptide fragments releasable from the BPXTEN construct.
  • Example 4 Recombinant constrnction and production of barcoded XTENyiated fission polypeptides [0285]
  • Examples 4a-4b illustrate the recombinant construction, production, and purification of full-length polypeptides containing barcoded XTEN polypeptide(s) using the methods disclosed herein.
  • Example 4a An XTENyiated fusion polypeptide containing a barcoded XTEN at the C-terminus
  • EXPRESSION Con streets encoding an XTENyiated fusion polypeptide containing an anti-EpCAM single-chain variable fragment (scFv) and a 864 amino acid-long, barcoded XTEN sequence (SEQ ID NO: 8008) at the C-terminus are expressed in a proprietary E. coll AniE098 strain and partitioned into the periplasm via an N-temiinal secretory' leader sequence (MKKNIAFLLASMFVFSIATNAY A-)(SEQ ID NO: 8898), which is cleaved during translocation.
  • Fermentation cultures are grown with animal-free complex medium at 37°C; and the temperature is shifted to 26°C prior to phosphate depletion. During harvest, fermentation whole broth is centrifuged to pellet the cells. At harvest, the total volume and the wet cell weight (WCW; ratio of pellet to supernatant) is recorded, and the pelleted cells are collected and frozen at -80 C C. [0287] RECOVERY : The frozen cell pellet is resuspended in Lysis Buffer (17.7 mM citric acid, 22.3 mM Na 2 HP0 4 , 75 mM NaCl, 2 mM EOT A, pH 4.0) targeting 30% wet cell weight.
  • Lysis Buffer 17.7 mM citric acid, 22.3 mM Na 2 HP0 4 , 75 mM NaCl, 2 mM EOT A, pH 4.0
  • the resuspension is allowed to equilibrate at pH 4 then homogenized via two passes at 800 ⁇ 50 bar while output temperature is monitored and maintained at 15 ⁇ 5°C.
  • the pH of the homogenate is confirmed to be within the specified range (pH 4.0 ⁇ 0.2).
  • CLARIFICATION To reduce endotoxin and host cell impurities, the homogenate is allowed to undergo low-temperature (I0 ⁇ 5°C), acidic (pH 4.0 ⁇ 0.2) flocculation overnight (15-20 hours). To remove the insoluble fraction, the flocculated homogenate is centrifuged for 40 minutes at 16,900 RCF at 2-8 °C, and the supernatant is retained. The supernatant is diluted approximately 3-fold with Milli-Q water (MQ), then adjusted to 7 ⁇ 1 mS/cm with 5 M NaCl.
  • MQ Milli-Q water
  • the supernatant is adjusted to 0.1% (m/m) diatomaceous earth.
  • the supernatant is mixed via impeller and allowed to equilibrate for 30 minutes.
  • a filter train consisting of a depth filter followed by a 0.22 gm filter, is assembled then flushed with MQ. The supernatant is pumped through the filter train while modulating flow to maintain a pressure drop of 25 ⁇ 5 psig.
  • the filtrate is adjusted with 500 mM Na 2 HP0 4 wherein the final ratio of Na 2 HP0 4 to citric acid is 9.33:1, and the pH of the buffered filtrate is confirmed to be within the specified range (pH 7.0 ⁇ 0.2).
  • AEX Capture To separate dimer, aggregate, and large truncates from monomeric product, and to remove endotoxin and nucleic acids, anion exchange (AEX) chromatography is utilized to capture the electronegative C- terminal XTEN domain.
  • the AEX1 stationary phase GE Q Sepharose FF
  • AEX I mobile phase A (12.2 mM Na 2 HP0 4 , 7.8 mM NaH 2 P0 4 , 40 mM NaCl)
  • AEX1 mobile phase B (12.2 mM Na 2 HP0 4 , 7.8 mM NaH 2 P0 4 , 500 mM NaCl) are used herein.
  • the column is equilibrated with AEX1 mobile phase A.
  • the filtrate is loaded onto the column targeting 28 ⁇ 4 g/L-resin, chased with AEX 1 mobile phase A, then washed with a step to 30% B.
  • Bound material is eluted with a gradient from 30% B to 60% B over 20 CV. Fractions are collected in 1 CV aliquots while A220 > 100 mAU above (local) baseline. Elution fractions are analyzed and pooled on the basis of SDS-PAGE and SE-HPLC.
  • IMAC immobilized metal affinity chromatography
  • the column is charged with zinc solution and equilibrated with IMAC mobile phase A.
  • the AEX1 Pool is adjusted to pH 7.8 ⁇ 0.1, 50 ⁇ 5 mS/cm (with 5 M NaCl), and 1 mM imidazole, loaded onto the IMAC column targeting 2 g/L-resin, and chased with I MAC mobile phase A until absorbance at 280 nm (A280) returned to (local) baseline.
  • Bound material is eluted with a step to 25% IMAC mobile phase B.
  • the IMAC Elution collection is initiated when A280 > 10 mAU above (local) baseline, directed into a container pre-spiked with EDTA sufficient to bring 2 CV to 2 mM EDTA, and terminated once 2 CV were collected.
  • the elution is analyzed by SDS-PAGE.
  • Protein-L is used to capture kappa domains present close to the N-terminus of the BPXTEN molecule (specifically the aEpCAM scFv).
  • Protein- L stationary phase GE Capto L
  • Protein-L mobile phase A (16.0 mM citric acid, 20.0 mM Na 2 HP0 4 , pH 4.0 ⁇ 0.1
  • Protein-L mobile phase B 29.0 mM citric acid, 7.0 mM Na 2 HP0 4 , pH 2.60 ⁇ 0.02
  • Protein-L mobile phase C 3.5 mM citric acid, 32.5 mM Na 2 HP0 4 , 250 mM NaCl, pH 7.0 ⁇ 0.l
  • the column is equilibrated with Protein-L mobile phase C.
  • the IMAC Elution is adjusted to pH 7.0 ⁇ 0.1 and 30 ⁇ 3 mS/cra (with 5 M NaCl and MQ) and loaded onto the Protein-L column targeting 2 g/L-resin then chased with Protein-L mobile phase C until absorbance at 280 nm (A280) returns to (local) baseline.
  • the column is washed with Protein-L mobile phase A, and Protein-L mobile phases A and B are used to effect low-pH elution.
  • Bound material is eluted at approximately pH 3.0 and collected into a container pre-spiked with one part 0.5 M Na 2 HP0 4 for every 10 parts collected volume. Fractions are analyzed by SDS-PAGE.
  • HIC Polishing To separate N-terminal variants (4 residues at the absolute N-terminus are not essential for Protein-L binding) and overall conformation variants, hydrophobic interaction chromatography (HIC) is used.
  • HIC stationary phase GE Capto Phenyl ImpRes
  • HIC mobile phase A (20 mM histidine, 0.02% (w/v) polysorbate 80, pH 6.5 ⁇ 0.1
  • HIC mobile phase B (1 M ammonium sulfate, 20 mM histidine, 0.02% (w/v) polysorbate 80, pH 6.5 ⁇ 0.1
  • the column is equilibrated with HIC mobile phase B.
  • the adjusted Protein-L Elution is loaded onto the HIC column targeting 2 g/L-resin and chased with HIC mobile phase B until absorbance at 280 nm (A280) returned to (local) baseline.
  • the column is washed with 50% B.
  • Bound material is eluted with a gradient from 50% B to 0% B over 75 CV. Fractions are collected in 1 CV aliquots while A280 > 3 mAU above (local) baseline. Elution fractions are analyzed and pooled on the basis of SE-HPLC and Hl-HPLC.
  • FORMULATION To exchange the product into formulation buffer and to bring the product to the target concentration (0.5 g/L), anion exchange is again used to capture the C- terminal XTEN.
  • AEX2 stationary phase GE Q Sepharosc FF
  • AEX2 mobile phase A (20 mM histidine, 40 mM NaCl, 0.02% (w/v) polysorbate 80, pH 6.5 ⁇ 0.2
  • AEX2 mobile phase B (20 mM histidine, 1 M NaCl, 0.02% (w/v) polysorbate 80, pH 6.5 ⁇ 0.2
  • AEX2 mobile phase C (12.2 mM Na 2 HP0 4 , 7.8 mM NaH 2 P0 4 , 40 mM NaCl, 0.02% (w/v) polysorbate 80, pH 7.0 ⁇ 0.2) are used herein.
  • the column is equilibrated with AEX2 mobile phase C.
  • the HIC Pool is adjusted to pH 7.0 ⁇ 0.1 and 7 ⁇ 1 mS/cm (with MQ) and loaded onto the AEX2 column targeting 2 g/L-resin then chased with AEX2 mobile phase C until A280 returned to (local) baseline.
  • the column is washed with AEX2 mobile phase A (20 mM histidine, 40 mM NaCl, 0.02% (w/v) polysorbate 80, pH 6.5 ⁇ 0.2).
  • AEX2 mobile phases A and B are used to generate an ⁇ NaCl] step and effect elution. Bound material is eluted with a step to 38% AEX2 mobile phase B.
  • the AEX2 Elution collection is initiated when A280 > 5 mAU above (local) baseline and terminated once 2 column volumes were collected.
  • the AEX2 Elution is 0.22 ⁇ m filtered within a BSC, aliquoled, labeled, and stored at -80°C as Bulk Drug Substance (BDS).
  • BDS Bulk Drug Substance
  • the bulk drug substance (BDS) is confirmed by various analytical methods to meet all lot release criteria.
  • Overall quality is analyzed by SDS-PAGE, the ratio of monomer to dimer and aggregate is analyzed by SE-HPLC, and N-terminal quality and product homogeneity are analyzed by HI-HPLC.
  • Example 4b An XTENylated fusion polypeptide containing a barcoded XTEN at the C-terminus and another barcoded XTEN at the N-terminus
  • EXPRESSION A construct encoding an XTENylated fusion polypeptide containing anti-EGFR singlechain variable fragment (scFv), a 864 amino acid-long barcoded XTEN (SEQ ID NO: 8008] at the C-terminus, and a 288 amino acid-long barcoded XTEN (SEQ ID NO: 8007] at the N-terminus is expressed in a proprietary E. coli AmE098 strain and partitioned into the periplasm via an N-terminal secretory leader sequence (MKKNIAFLLASMFVFSLATNAYA-XSEQ ID NO: 8898], which is cleaved during translocation.
  • scFv anti-EGFR singlechain variable fragment
  • SEQ ID NO: 8008 864 amino acid-long barcoded XTEN
  • SEQ ID NO: 8007 288 amino acid-long barcoded XTEN
  • Fermentation cultures are grown with animal-free complex medium at 37°C and temperature shifted to 26°C prior to phosphate depletion. During harvest, fermentation whole broth is centrifuged to pellet the cells. At harvest, the total volume and the wet cell weight (WCW; ratio of pellet to supernatant) are recorded, and the pelleted cells are collected and frozen at -80°C.
  • WCW wet cell weight
  • CLARIFICATION To reduce endotoxin and host cell impurities, the homogenate is allowed to undergo low-temperature (I0 ⁇ 5°C), acidic (pH 4.4 ⁇ 0.1) flocculation overnight (15-20 hours). To remove the insoluble fraction, the flocculated homogenate is centrifuged for 40 minutes at 8,000 RCF and 2-8°C, and the supernatant is retained. To remove nucleic acid, lipids, and endotoxin and to act as a filter aid, the supernatant is adjusted to 0.1% (m/m) dia!omaceous earth. To keep the filter aid suspended, the supernatant is mixed via impeller and allowed to equilibrate for 30 minutes. A filter train, consisting of a depth filter followed by a 0.22 ⁇ m filter, is assembled then flushed with MQ. The supernatant is pumped through the filter train while modulating flow to maintain a pressure drop of 25 ⁇ 5 psig.
  • Protein-L Capture To remove host cell proteins, endotoxin, and nucleic acid, Protein-L is used to capture the kappa domain present within the aEGFR scFv of the BPXTEN molecule.
  • the Protein-L stationary phase Tosoh TP AF-rProtein L-650F
  • Protein-L mobile phase A (11.5 mM citric acid, 24.5 mM Na 2 HP0 4 , 125 mM NaCl, 0.005% polysorbate 80, pH 5.0
  • Protein-L mobile phase B 11 mM phosphoric acid, 0.005% poly sorb ate 80, pH 2.0
  • the column is equilibrated with Protein-L mobile phase A.
  • the filtrate is adjusted to pH 5.5 ⁇ 0.2 and loaded onto the Protein-L column targeting 2-4 g/L-resin then chased with Protein-L mobile phase A until absorbance at 280 nm (A280) returns to (local) baseline.
  • Bound material is eluted with mobile phase B and collected as a 2 CV fraction pre-spiked with 0.4 CV of 0.5 M Na 2 HP0 4 and is analyzed by SDS-PAGE.
  • IMAC Immobilized Metal Affinity Chromatography
  • His(6) N-terminal polyhistidine tag
  • the IMAC stationary phase GE IMAC Sepharose FF
  • IMAC mobile phase A 12.2 mM Na 2 HP0 4 , 7.8 mM NaH 2 P0 4 , 500 mM NaCl, 0.005% polysorbate 80, pH 7.0
  • IMAC mobile phase B 50 mM histidine, 200 mM NaCl, 0.005% polysorbate 80, pH 6.5] are used herein.
  • the column is equilibrated with IMAC mobile phase A.
  • the Protein-L Elution is adjusted to pH 7.8 ⁇ 0.1 and 50 ⁇ 5 mS/cm (with 5 M NaCl).
  • the adjusted Protein-L Pool is loaded onto the IMAC column targeting 2 g/L-resin and chased with IMAC mobile phase A until absorbance at 280 nm (A280) returned to (local) baseline.
  • Bound material is eluted with IMAC mobile phase B.
  • the IMAC Elution is collected as a 2 CV fraction pre-spiked with 0.02 CV 200 mM EDTA and is analyzed by SDS-PAGE.
  • C-tag Intermediate Purification To ensure C-terminal integrity, C-tag Affinity Chromatography is used to capture the C-terminal -EPEA tag (SEQ ID NO: 8033).
  • the C-tag stationary phase (Thermo C-tagXL), C- tag mobile phase A (50 mM histidine, 200 mM NaCl, 0.005% polysorbate 80, pH 6.5], and C-tag mobile phase B (20 mM Tris, 0.6 M MgCl 2 , 0.005% polysorbate 80, pH 7.0) are used herein.
  • the column is equilibrated with C-tag mobile phase A.
  • the IMAC Elution is loaded onto the C-tag column targeting 2 g/L-resin and chased with C-tag mobile phase A until absorbance at 280 nm (A280) returned to (local) baseline. Bound material is eluted with a C-tag mobile phase B. The C-tag Elution is collected as a 2 CV fraction and is analyzed by SDS-PAGE.
  • AEX Polishing To separate dimer and aggregate from monomeric product Anion Exchange (AEX) chromatography is utilized to capture the electronegative N- and C-terminal XTEN domains.
  • the AEX1 stationary phase (B1A QA-80), AEX1 mobile phase A (50 mM histidine, 200 mM NaCl, 0.005% polysorbate 80, pH 6.5], and AEX1 mobile phase B (50 mM histidine, 500 mM NaCl, 0.005% polysorbate 80, pH 6.5] are used herein.
  • the column is equilibrated with AEX mobile phase A.
  • the C-tag elution is diluted to 10 mS/cm with MQ, loaded targeting 2 g/L-resin, and then chased with AEX mobile phase A until absorbance at 280 nm retumed to (local) baseline.
  • Bound material is eluted with a gradient from 0% B to 100% B over 60 CV. Fractions are collected in 1 CV aliquots while A280 > 2 mAU above (local) baseline. Elution fractions are analyzed by SDS-PAGE and SE-HPLC, and fractions found to be > 98% monomer are pooled (AEX Pool) for further processing.
  • FORMULATION To exchange the product into formulation buffer and to bring the product to the target concentration (0.5 g/L), Ultrafiltration/Diafillration (UF/DF) is used. Using a 10 kDa membrane with an area of 0.1 m 2 and a TMP target of 15 psi, the AEX pool is concentrated to 0.5 g/L, then diluted 10-fold with Formulation Buffer (50 mM histidine, 200 mM NaCl, 0.005% po!ysorbate 80, pH 6.5]. The AEX pool is concentrated 10-fold and diluted 10-fold two more times.
  • Formulation Buffer 50 mM histidine, 200 mM NaCl, 0.005% po!ysorbate 80, pH 6.5.
  • the recovered Formulated product is 0.22 pm filtered within a BSC, aliquoted, labeled, and stored at -80°C as Bulk Drug Substance (BDS).
  • BDS Bulk Drug Substance
  • the BDS is confirmed by various analytical methods to meet all Lot Release criteria.
  • Overall quality is analyzed by SDS-PAGE, the ratio of monomer to dimer and aggregate is analyzed by SE-HPLC, and N-terminal quality and product homogeneity is analyzed by HI-HPLC. Identity is confirmed by ESI-MS.
  • This example illustrates the release of barcode fragments) and reference fragment(s) from a polypeptide mixture that contain vary ing lengths or truncated forms of the XTEN -containing construct using the methods disclosed herein.
  • a sample of XTEN-containing construct is reduced and alkylated via incubation in DTT and then iodoacetamide, sequentially.
  • the samples are then buffer exchanged and desalted using a size-exclusion spin cartridge.
  • Glu-C protease is added to the samples at an enzyme to substrate ratio of 1 :5 and the samples are incubated at 37°C for digestion. Samples are then moved to 4°C to halt the proteolytic reaction and placed in autosampler vials for analysis.
  • This example illustrates mass spectrometry' methods used to generate quantitative measurements of individual barcode peptides.
  • An LC- Parallel Reaction Monitoring (PRM) method is programmed into a high- resolution accurate mass (HRAM) mass spectrometer. Unlike traditional Data-Dependent Acquisition (DDA) mass spectrometry methods, PRM methods focus on a specific set of 15-30 peptides in one run, sequencing each by MS-MS once per duty' cycle. As such, this method generates extracted Ion Chromatograms (XICs) for the unfragmented precursor ions of the intact peptide, as well as for each fragment ion of the peptide to confirm its sequence.
  • XICs Ion Chromatograms
  • Fragment ion XICs are often more sensitive and selectively quantitative than the precursor ion fragments.
  • the LC-PRM method used includes the light and heavy versions of seven barcode peptides. Chromatographic peak areas of all fragment ions of these 14 peptides are measured post-acquisition and the strongest fragment ion is used for quantitative measurement. Peak area ratios of the XTEN barcode peptides to the PAT barcode peptides are then calculated for relative XTEN:PAT abundance at various points across the XTEN molecules.
  • Example 7 Stable isotope labeling to quantify the peptides by mass spectrometry (MS)
  • This example illustrates the stable-isotope labeling schema to enable absolute (rather than relative) quantitation of barcode peptides from XTEN-containing polypeptides.
  • a standard Heavy labeled Amino acid quantitative schema is employed wherein synthetic analogues of barcode peptides in which the C-lerminal Glutamic Acid is replaced with the ( 13 C)sH7( 15 N)0 3 heavy labeled analogue are procured from a specialized vendor.
  • a calibration curve is prepared where a known amount of XTEN barcode containing polypeptide is serially diluted into a matrix where the heavy-labeled synthetic peptide is held at a constant concentration. Accurate quantitation can be performed by calibrating chromatographic peak area heavy: light ratios from the curve against research samples containing the same spike-level of heavy labeled peptide.
  • This example illustrates the quantification of length variants or truncation variants in a mixture of XTEN-containing polypeptides.
  • a barcode peptide “SGPGSTPAESGSE” (SEQ ID NO: 8899) is located 76 amino acids into the representative barcoded BPXTEN sequence described in and obtained from Example 3 to indicate a severe truncation of the XTEN at the N-terminal end of the BPXTEN.
  • a potential barcode fragment ‘'SPAGSPTSTESGTSE” (SEQ ID NO: 8260) is located at the N-terminus.
  • the abundance measurement ratio of each barcode peptide relative to a unique reference peptide sequence from the biologically active protein (e.g., an scFv fragment) sequence following the procedure of Example 6 indicates the total amount of the full-length polypeptides and the variants having truncations that could affect pharmacological efficacy in the sample mixture.
  • the abundance measurement of at least one reference fragment is used to indicate the total amount of all variants of the polypeptide in the sample mixture. Accordingly, differential abundance between the reference fragment and the barcode fragments informs the amount of truncated polypeptide variants.
  • the LC-MS data are analyzed to determine the ratio of the amount of the barcode fragment to the reference fragment, indicating the relative amount of pharmacologically-efficacious variants in the polypeptide mixture.
  • a set of two (or three) barcodes are used to indicate different levels of truncation of the polypeptide.
  • the LC-MS data are used to determine the ratio of the amount of each barcode fragment to the amount of the reference fragment, thereby quantifying the distribution of truncation variants in the polypeptide mixture.
  • Example 9. Quantification of truncation of XTEN-containing polypeptide [0311] A step in the purification of AC2329 is QIR Anion Exchange Chromatography. The second half of the main elution peak from this column contains the full-length protein, w'hilc the first half of the peak contains a mixture of full-length protein as well as many truncated forms.
  • fractions were taken.
  • One fraction included only the second half of the peak, heretofore referred to as the “full-length” fraction.
  • the second fraction included the first half of the peak, heretofore referred to as the Synthetic Protein and Truncates” fraction, set forth herein:
  • each of the 400 nM samples were then digested with I mg/mL GluC (Roche 10791156001) in reaction buffer containing 50mM Tris-HCl pH 7.5 + 0.1% Rapigest (Waters 186001861), GluC digest was performed overnight at 37°C in a shaking incubator. Following digestion, formic acid was added to a final concentration of 10% and incubated at 37°C for 45 min. Rapigest precipitates were removed by centrifugation at 16,000 x g for 10 min, and a heavy peptide standard mix was added to a final concentration of 400 nM. LC-MS analysis of each digest was performed as described. Each sample was measured in duplicate.
  • Digests were analyzed using a 30-minute gradient method on a Waters HSS-T3 column (176003994) using a V anquish (Thermo) UHPLC system connected to a Q-Exactive Plus mass Spectrometer (Thermo).
  • the MS method consisted of a top-ten DDA method in which the top ten peptides were sequenced by MSMS analysis after each MS scan.
  • Resultant data files were processed using Skyline Software (MacCoss Lab, UW) software in which the heavy-peptide normalized concentrations of each barcode peptide could be calculated and measured.
  • Each measurement is the XIC area ofN-Barcode SGPGSTPAE (SEQ ID No. 8029) and, C-Barcode GSAPGTE (SEQ ID No. 8023) normalized to a 400nM Spike of its corresponding heavy isotope labeled Synthetic peptide.
  • Dilution 1 has the lowest amount of truncates and dilution 9 has the highest amount.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Physics & Mathematics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Plant Pathology (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
PCT/US2020/060378 2019-11-13 2020-11-13 Barcoded xten polypeptides and compositions thereof, and methods for making and using the same Ceased WO2021097186A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
JP2022526756A JP7725466B2 (ja) 2019-11-13 2020-11-13 バーコード化されたxtenポリペプチドおよびその組成物、ならびにその作製および使用方法
EP20820695.3A EP4058466A1 (en) 2019-11-13 2020-11-13 Barcoded xten polypeptides and compositions thereof, and methods for making and using the same
PH1/2022/551163A PH12022551163A1 (en) 2019-11-13 2020-11-13 Barcoded xten polypeptides and compositions thereof, and methods for making and using the same
AU2020382621A AU2020382621A1 (en) 2019-11-13 2020-11-13 Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same
IL292863A IL292863A (en) 2019-11-13 2020-11-13 Barcoded xanthan polypeptides and their compositions, and methods for their preparation and use
KR1020227019674A KR20220131221A (ko) 2019-11-13 2020-11-13 바코드화된 xten 폴리펩티드 및 이의 조성물, 및 이의 제조 방법 및 사용 방법
US17/776,478 US12617815B2 (en) 2020-11-13 Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same
CN202080090841.XA CN115175920B (zh) 2019-11-13 2020-11-13 加条形码的xten多肽及其组合物以及其制备和使用方法
MX2022005676A MX2022005676A (es) 2019-11-13 2020-11-13 Polipéptidos xten con código de barras y composiciones de estos, y métodos para preparar y usar los mismos.
BR112022009217A BR112022009217A2 (pt) 2019-11-13 2020-11-13 Polipeptídeos xten com código de barras e composições destes, e métodos para produzir e usar os mesmos
CA3157605A CA3157605A1 (en) 2019-11-13 2020-11-13 Barcoded xten polypeptides and compositions thereof, and methods for making and using the same
CONC2022/0008004A CO2022008004A2 (es) 2019-11-13 2022-06-06 Polipéptidos xten con código de barras y composiciones de estos, y métodos para preparar y usar los mismos
JP2025130787A JP2025179058A (ja) 2019-11-13 2025-08-05 バーコード化されたxtenポリペプチドおよびその組成物、ならびにその作製および使用方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962934980P 2019-11-13 2019-11-13
US62/934,980 2019-11-13

Publications (1)

Publication Number Publication Date
WO2021097186A1 true WO2021097186A1 (en) 2021-05-20

Family

ID=73740585

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/060378 Ceased WO2021097186A1 (en) 2019-11-13 2020-11-13 Barcoded xten polypeptides and compositions thereof, and methods for making and using the same

Country Status (12)

Country Link
EP (1) EP4058466A1 (https=)
JP (2) JP7725466B2 (https=)
KR (1) KR20220131221A (https=)
CN (1) CN115175920B (https=)
AU (1) AU2020382621A1 (https=)
BR (1) BR112022009217A2 (https=)
CA (1) CA3157605A1 (https=)
CO (1) CO2022008004A2 (https=)
IL (1) IL292863A (https=)
MX (1) MX2022005676A (https=)
PH (1) PH12022551163A1 (https=)
WO (1) WO2021097186A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021263058A1 (en) * 2020-06-25 2021-12-30 Amunix Pharmaceuticals, Inc. Her-2 targeted bispecific compositions and methods for making and using the same
WO2023092099A1 (en) * 2021-11-19 2023-05-25 Ardeagen Corporation Gpc3 binding agents, conjugates thereof and methods of using the same
EP3990497A4 (en) * 2019-06-26 2023-07-19 Amunix Pharmaceuticals, Inc. CD3 ANTIGEN-BINDING FRAGMENTS AND COMPOSITIONS COMPRISING THEM
WO2025122957A1 (en) 2023-12-08 2025-06-12 Amunix Pharmaceuticals, Inc. Protease activatable cytokines and methods for making and using the same
US12617815B2 (en) 2020-11-13 2026-05-05 Amunix Pharmaceuticals, Inc. Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same

Citations (64)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987001728A1 (en) 1985-09-12 1987-03-26 Biotechnology Research Partners, Ltd. Recombinant fibroblast growth factors
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4826763A (en) 1985-01-22 1989-05-02 Novo Industri A/S Process for preparing glucagon or fragments or derivatives thereof in yeast
US5075222A (en) 1988-05-27 1991-12-24 Synergen, Inc. Interleukin-1 inhibitors
US5114923A (en) 1988-05-31 1992-05-19 California Biotechnology Inc. Recombinant techniques for production of novel natriuretic and vasodilator peptides
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US5175146A (en) 1989-12-05 1992-12-29 Vical, Inc. Synthetic calcitonin peptides
US5234906A (en) 1991-01-10 1993-08-10 Amylin Pharmaceuticals, Inc. Hyperglycemic compositions
US5324639A (en) 1990-09-04 1994-06-28 The Salk Institute Biotechnology/Industrial Assoc, Inc. Production of insulin-like growth factor-1 in methylotrophic yeast cells
US5364840A (en) 1989-12-05 1994-11-15 Vical, Inc. Synthetic calcitonin peptides
US5364934A (en) 1991-02-01 1994-11-15 Genentech, Inc. Plasma carboxypeptidase
US5374618A (en) 1983-06-15 1994-12-20 Celltech Limited Calcitonin peptides, and gene related pharmaceutical compositions
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5521283A (en) 1995-01-31 1996-05-28 Eli Lilly And Company Anti-obesity proteins
US5532336A (en) 1995-01-31 1996-07-02 Eli Lilly And Company Anti-obesity proteins
US5534617A (en) 1988-10-28 1996-07-09 Genentech, Inc. Human growth hormone variants having greater affinity for human growth hormone receptor at site 1
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US5604203A (en) 1993-03-29 1997-02-18 University Of Cincinnati Analogs of peptide YY and uses thereof
US5631230A (en) 1989-09-21 1997-05-20 Arizona Technology Development Corporation Receptor selective analogues of cholecystokinin-8
US5674710A (en) 1988-05-31 1997-10-07 Scios, Inc. Recombinant techniques for production of human brain natriuretic peptide
US5686411A (en) 1991-03-08 1997-11-11 Amylin Pharmaceuticals, Inc. Amylin agonist peptides and uses therefor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1998052976A1 (en) 1997-05-21 1998-11-26 Biovation Limited Method for the production of non-immunogenic proteins
US5843446A (en) 1993-04-27 1998-12-01 United Biomedical, Inc. Immunogenic LHRH peptide constructs and synthetic universal immune stimulators for vaccines
US5885573A (en) 1993-06-01 1999-03-23 Arch Development Corporation Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies
WO2000003317A1 (en) 1998-07-13 2000-01-20 Metron Designs Ltd. High resolution pulse width setting from relatively low frequency clocks
WO2000057183A1 (en) * 1999-03-23 2000-09-28 Biovation Limited Protein isolation and analysis
US6214797B1 (en) 1995-06-13 2001-04-10 The Salk Institute For Biological Studies Urocortin peptides, nucleic acid encoding same methods for using same
US20010027181A1 (en) 2000-03-31 2001-10-04 Masafumi Kitakaze Treatment or prophylaxis of ischemic heart disease
US6320022B1 (en) 1995-08-18 2001-11-20 The United States Of America As Represented By The Department Of Health And Human Services Adrenomedullin peptides
US20020042367A1 (en) 1997-11-25 2002-04-11 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US6406632B1 (en) 1998-04-03 2002-06-18 Symyx Technologies, Inc. Rapid characterization of polymers
WO2002079232A2 (en) 2001-03-30 2002-10-10 Merck Patent Gmbh Reducing the immunogenicity of fusion proteins
US6491916B1 (en) 1994-06-01 2002-12-10 Tolerance Therapeutics, Inc. Methods and materials for modulation of the immunosuppresive activity and toxicity of monoclonal antibodies
US20030228309A1 (en) 2000-11-08 2003-12-11 Theodora Salcedo Antibodies that immunospecifically bind to TRAIL receptors
US6716626B1 (en) 1999-11-18 2004-04-06 Chiron Corporation Human FGF-21 nucleic acids
US6806063B2 (en) 2000-02-11 2004-10-19 Maxygen Aps Factor VII or VIIa-like molecules
US6858409B1 (en) 1988-05-27 2005-02-22 Amgen Inc. Nucleic acids encoding interleukin-1 inhibitors and processes for preparing interleukin-1 inhibitors
US6965013B2 (en) 2002-11-26 2005-11-15 The Board Of Trustees Of The Leland Stanford Junior University Intermedin and its uses
US6967237B2 (en) 2000-05-30 2005-11-22 Merck & Co., Inc. Ghrelin analogs
WO2005118635A2 (en) 2004-06-03 2005-12-15 Novimmune S.A. Anti-cd3 antibodies and methods of use thereof
US7112659B2 (en) 1995-11-22 2006-09-26 Amgen, Inc. OB fusion protein compositions and methods
US7166575B2 (en) 2002-12-17 2007-01-23 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
WO2007033230A2 (en) 2005-09-12 2007-03-22 Novimmune S.A. Anti-cd3 antibody formulations
US7294513B2 (en) 2002-07-24 2007-11-13 Wyatt Technology Corporation Method and apparatus for characterizing solutions of small particles
US7385026B1 (en) 1999-07-23 2008-06-10 Kenji Kangawa Modified ghrelin polypeptides
US20080261886A1 (en) 2001-07-16 2008-10-23 Novo Nordisk Healthcare A/G Single-Dose Administration of Factor VIIa
WO2010091122A1 (en) 2009-02-03 2010-08-12 Amunix, Inc. Extended recombinant polypeptides and compositions comprising same
WO2010144502A2 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Growth hormone polypeptides and methods of making and using same
WO2010144508A1 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Glucose-regulating polypeptides and methods of making and using same
US20110046061A1 (en) 2009-02-03 2011-02-24 Amunix Operating, Inc. Coagulation factor VII compositions and methods of making and using same
WO2011028344A2 (en) 2009-08-25 2011-03-10 Amunix Operating Inc. Interleukin-1 receptor antagonist compositions and methods of making and using same
US20110077199A1 (en) 2009-02-03 2011-03-31 Amunix, Inc. Growth hormone polypeptides and methods of making and using same
US20110172146A1 (en) 2009-02-03 2011-07-14 Amunix Operating, Inc. Growth hormone polypeptides and methods of making and using same
US8044175B2 (en) 2003-03-03 2011-10-25 Dyax Corp. Peptides that specifically bind HGF receptor (CMET) and uses thereof
US8067532B2 (en) 2007-01-19 2011-11-29 Kai Pharmaceuticals, Inc. Modifications of peptide compositions to increase stability and delivery efficiency
US20120034228A1 (en) 2008-10-01 2012-02-09 Micromet Ag CROSS-SPECIES-SPECIFIC PSCAxCD3, CD19xCD3, C-METxCD3, ENDOSIALINxCD3, EPCAMxCD3, IGF-1RxCD3 OR FAPALPHAxCD3 BISPECIFIC SINGLE CHAIN ANTIBODY
WO2014011819A2 (en) 2012-07-11 2014-01-16 Amunix Operating Inc. Factor viii complex with xten and von willebrand factor protein, and uses thereof
WO2015023891A2 (en) 2013-08-14 2015-02-19 Biogen Idec Ma Inc. Factor viii-xten fusions and uses thereof
WO2016077505A2 (en) * 2014-11-11 2016-05-19 Amunix Operating Inc. Targeted xten conjugate compositions and methods of making same
US9601471B2 (en) 2015-04-23 2017-03-21 Apple Inc. Three layer stack structure
US9622308B2 (en) 2015-04-24 2017-04-11 Panasonic Intellectual Property Management Co., Ltd. Lighting device, illumination device, and lighting fixture
US20180030531A1 (en) * 2016-07-29 2018-02-01 The Regents Of The University Of California Methods for determining gene functions
WO2019126576A1 (en) * 2017-12-21 2019-06-27 Amunix Pharmaceuticals, Inc. Release segments and binding compositions comprising same

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020119490A1 (en) * 2000-12-26 2002-08-29 Aebersold Ruedi H. Methods for rapid and quantitative proteome analysis
AU2015200260A1 (en) * 2009-06-08 2015-02-12 Amunix Operating Inc. Glucose-regulating polypeptides and methods of making and using same
WO2016145416A2 (en) * 2015-03-11 2016-09-15 The Broad Institute, Inc. Proteomic analysis with nucleic acid identifiers
AU2016253964B2 (en) * 2015-04-27 2022-07-07 Abvitro Llc Methods of sequencing, determining, pairing, and validating therapeutic agents and disease specific antigens
WO2019074841A1 (en) * 2017-10-09 2019-04-18 Pioneer Hi-Bred International, Inc. TYPE I-E CRISPR-CAS SYSTEMS FOR EUCARYOTE GENOME EDITION

Patent Citations (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5374618A (en) 1983-06-15 1994-12-20 Celltech Limited Calcitonin peptides, and gene related pharmaceutical compositions
US4826763A (en) 1985-01-22 1989-05-02 Novo Industri A/S Process for preparing glucagon or fragments or derivatives thereof in yeast
WO1987001728A1 (en) 1985-09-12 1987-03-26 Biotechnology Research Partners, Ltd. Recombinant fibroblast growth factors
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US5075222A (en) 1988-05-27 1991-12-24 Synergen, Inc. Interleukin-1 inhibitors
US6858409B1 (en) 1988-05-27 2005-02-22 Amgen Inc. Nucleic acids encoding interleukin-1 inhibitors and processes for preparing interleukin-1 inhibitors
US5114923A (en) 1988-05-31 1992-05-19 California Biotechnology Inc. Recombinant techniques for production of novel natriuretic and vasodilator peptides
US5948761A (en) 1988-05-31 1999-09-07 Scios, Inc. Recombinant canine brain natriuretic peptide
US5674710A (en) 1988-05-31 1997-10-07 Scios, Inc. Recombinant techniques for production of human brain natriuretic peptide
US5534617A (en) 1988-10-28 1996-07-09 Genentech, Inc. Human growth hormone variants having greater affinity for human growth hormone receptor at site 1
US5631230A (en) 1989-09-21 1997-05-20 Arizona Technology Development Corporation Receptor selective analogues of cholecystokinin-8
US5364840A (en) 1989-12-05 1994-11-15 Vical, Inc. Synthetic calcitonin peptides
US5175146A (en) 1989-12-05 1992-12-29 Vical, Inc. Synthetic calcitonin peptides
US5324639A (en) 1990-09-04 1994-06-28 The Salk Institute Biotechnology/Industrial Assoc, Inc. Production of insulin-like growth factor-1 in methylotrophic yeast cells
US5234906A (en) 1991-01-10 1993-08-10 Amylin Pharmaceuticals, Inc. Hyperglycemic compositions
US5364934A (en) 1991-02-01 1994-11-15 Genentech, Inc. Plasma carboxypeptidase
US5686411A (en) 1991-03-08 1997-11-11 Amylin Pharmaceuticals, Inc. Amylin agonist peptides and uses therefor
US7271238B2 (en) 1991-03-08 2007-09-18 Amylin Pharmaceuticals, Inc. Amylin agonist peptides and uses therefor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5604203A (en) 1993-03-29 1997-02-18 University Of Cincinnati Analogs of peptide YY and uses thereof
US5843446A (en) 1993-04-27 1998-12-01 United Biomedical, Inc. Immunogenic LHRH peptide constructs and synthetic universal immune stimulators for vaccines
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5885573A (en) 1993-06-01 1999-03-23 Arch Development Corporation Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies
US6491916B1 (en) 1994-06-01 2002-12-10 Tolerance Therapeutics, Inc. Methods and materials for modulation of the immunosuppresive activity and toxicity of monoclonal antibodies
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US5532336A (en) 1995-01-31 1996-07-02 Eli Lilly And Company Anti-obesity proteins
US5521283A (en) 1995-01-31 1996-05-28 Eli Lilly And Company Anti-obesity proteins
US6214797B1 (en) 1995-06-13 2001-04-10 The Salk Institute For Biological Studies Urocortin peptides, nucleic acid encoding same methods for using same
US6320022B1 (en) 1995-08-18 2001-11-20 The United States Of America As Represented By The Department Of Health And Human Services Adrenomedullin peptides
US7112659B2 (en) 1995-11-22 2006-09-26 Amgen, Inc. OB fusion protein compositions and methods
WO1998052976A1 (en) 1997-05-21 1998-11-26 Biovation Limited Method for the production of non-immunogenic proteins
US20020042367A1 (en) 1997-11-25 2002-04-11 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US6406632B1 (en) 1998-04-03 2002-06-18 Symyx Technologies, Inc. Rapid characterization of polymers
WO2000003317A1 (en) 1998-07-13 2000-01-20 Metron Designs Ltd. High resolution pulse width setting from relatively low frequency clocks
WO2000057183A1 (en) * 1999-03-23 2000-09-28 Biovation Limited Protein isolation and analysis
US7385026B1 (en) 1999-07-23 2008-06-10 Kenji Kangawa Modified ghrelin polypeptides
US6716626B1 (en) 1999-11-18 2004-04-06 Chiron Corporation Human FGF-21 nucleic acids
US6806063B2 (en) 2000-02-11 2004-10-19 Maxygen Aps Factor VII or VIIa-like molecules
US20010027181A1 (en) 2000-03-31 2001-10-04 Masafumi Kitakaze Treatment or prophylaxis of ischemic heart disease
US6967237B2 (en) 2000-05-30 2005-11-22 Merck & Co., Inc. Ghrelin analogs
US20030228309A1 (en) 2000-11-08 2003-12-11 Theodora Salcedo Antibodies that immunospecifically bind to TRAIL receptors
WO2002079232A2 (en) 2001-03-30 2002-10-10 Merck Patent Gmbh Reducing the immunogenicity of fusion proteins
US20080261886A1 (en) 2001-07-16 2008-10-23 Novo Nordisk Healthcare A/G Single-Dose Administration of Factor VIIa
US7294513B2 (en) 2002-07-24 2007-11-13 Wyatt Technology Corporation Method and apparatus for characterizing solutions of small particles
US6965013B2 (en) 2002-11-26 2005-11-15 The Board Of Trustees Of The Leland Stanford Junior University Intermedin and its uses
US7166575B2 (en) 2002-12-17 2007-01-23 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
US8044175B2 (en) 2003-03-03 2011-10-25 Dyax Corp. Peptides that specifically bind HGF receptor (CMET) and uses thereof
WO2005118635A2 (en) 2004-06-03 2005-12-15 Novimmune S.A. Anti-cd3 antibodies and methods of use thereof
WO2007033230A2 (en) 2005-09-12 2007-03-22 Novimmune S.A. Anti-cd3 antibody formulations
US8067532B2 (en) 2007-01-19 2011-11-29 Kai Pharmaceuticals, Inc. Modifications of peptide compositions to increase stability and delivery efficiency
US20120034228A1 (en) 2008-10-01 2012-02-09 Micromet Ag CROSS-SPECIES-SPECIFIC PSCAxCD3, CD19xCD3, C-METxCD3, ENDOSIALINxCD3, EPCAMxCD3, IGF-1RxCD3 OR FAPALPHAxCD3 BISPECIFIC SINGLE CHAIN ANTIBODY
WO2010091122A1 (en) 2009-02-03 2010-08-12 Amunix, Inc. Extended recombinant polypeptides and compositions comprising same
US20100239554A1 (en) 2009-02-03 2010-09-23 Amunix Inc. a Delaware Corporation Extended recombinant polypeptides and compositions comprising same
US20110046061A1 (en) 2009-02-03 2011-02-24 Amunix Operating, Inc. Coagulation factor VII compositions and methods of making and using same
US20100323956A1 (en) 2009-02-03 2010-12-23 Amunix, Inc. Glucose-regulating polypeptides and methods of making and using same
US20110077199A1 (en) 2009-02-03 2011-03-31 Amunix, Inc. Growth hormone polypeptides and methods of making and using same
US20110172146A1 (en) 2009-02-03 2011-07-14 Amunix Operating, Inc. Growth hormone polypeptides and methods of making and using same
WO2010144508A1 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Glucose-regulating polypeptides and methods of making and using same
WO2010144502A2 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Growth hormone polypeptides and methods of making and using same
US20110046060A1 (en) 2009-08-24 2011-02-24 Amunix Operating, Inc., Coagulation factor IX compositions and methods of making and using same
WO2011028228A1 (en) 2009-08-24 2011-03-10 Amunix Operating Inc. Coagulation factor vii compositions and methods of making and using same
WO2011028229A1 (en) 2009-08-24 2011-03-10 Amunix Operating Inc. Coagulation factor ix compositions and methods of making and using same
WO2011028344A2 (en) 2009-08-25 2011-03-10 Amunix Operating Inc. Interleukin-1 receptor antagonist compositions and methods of making and using same
WO2014011819A2 (en) 2012-07-11 2014-01-16 Amunix Operating Inc. Factor viii complex with xten and von willebrand factor protein, and uses thereof
WO2015023891A2 (en) 2013-08-14 2015-02-19 Biogen Idec Ma Inc. Factor viii-xten fusions and uses thereof
WO2016077505A2 (en) * 2014-11-11 2016-05-19 Amunix Operating Inc. Targeted xten conjugate compositions and methods of making same
US9601471B2 (en) 2015-04-23 2017-03-21 Apple Inc. Three layer stack structure
US9622308B2 (en) 2015-04-24 2017-04-11 Panasonic Intellectual Property Management Co., Ltd. Lighting device, illumination device, and lighting fixture
US20180030531A1 (en) * 2016-07-29 2018-02-01 The Regents Of The University Of California Methods for determining gene functions
WO2019126576A1 (en) * 2017-12-21 2019-06-27 Amunix Pharmaceuticals, Inc. Release segments and binding compositions comprising same

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1980
"Reviewed in Becker", JCEM, vol. 89, no. 4, 2004, pages 1512 - 1525
BALZAR: "The biology of the 17-1A antigen (Ep-CAM", J. MOL. MED., vol. 77, 1999, pages 699 - 712, XP000925817, DOI: 10.1007/s001099900038
BANNER ET AL., CELL, vol. 73, 1993, pages 431
BELL, PROC NATL ACAD SCI U S A., vol. 82, 1985, pages 6450 - 4
BUCHANAN A ET AL.: "Engineering a therapeutic IgG molecule to address cysteinylation, aggregation and enhance thermal stability and expression", MABS, vol. 5, 2013, pages 255, XP055260333, DOI: 10.4161/mabs.23392
BURGESS, W. H.MACIAG, T., ANN. REV. BIOCHEM., vol. 58, 1989, pages 575 - 606
CALICETI: "Pharmacokinetic and biodistribution properties of poly(ethylene glycol)-protein conjugates", ADV. DRUG DELIV. REV., vol. 55, 2003, pages 1261 - 1277, XP003001867, DOI: 10.1016/S0169-409X(03)00108-X
CHATENOUD, CLIN. TRANSPLANT, vol. 7, 1993, pages 422 - 430
CHATENOUD, NAT. REV. IMMUNOL., vol. 3, 2003, pages 123 - 132
CHEN ET AL., PHANN RES, vol. 20, 2003, pages 1952 - 60
CHOU, P. Y. ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 222 - 45
COUDER ET AL., INT. J. PEPTIDE PROTEIN RES., vol. 41, 1993, pages 181 - 184
COULIER, F. ET AL., PROG. GROWTH FACTOR RES., vol. 5, 1994, pages 1
DATABASE Geneseq [online] 26 September 2013 (2013-09-26), "XTEN polypeptide AE576A, SEQ ID 140.", XP002802129, retrieved from EBI accession no. GSP:BAS02085 Database accession no. BAS02085 *
DATABASE Geneseq [online] 30 June 2016 (2016-06-30), "Cysteine/Lysine engineered XTEN polypeptide, SEQ ID 391.", XP002802132, retrieved from EBI accession no. GSP:BDA30593 Database accession no. BDA30593 *
DATABASE Geneseq [online] 8 August 2019 (2019-08-08), "Anti-EpCAM-anti-CD3 bispecific scFV-XTEN fusion protein AC1955, SEQ 1019.", XP002802127, retrieved from EBI accession no. GSP:BGL92133 Database accession no. BGL92133 *
DATABASE Geneseq [online] 8 August 2019 (2019-08-08), "Neoplasm treatment related XTEN protein AE292, SEQ 922.", XP002802128, retrieved from EBI accession no. GSP:BGL92036 Database accession no. BGL92036 *
DATABASE Geneseq [online] 8 August 2019 (2019-08-08), "Neoplasm treatment related XTEN protein AE684A, SEQ 889.", XP002802131, retrieved from EBI accession no. GSP:BGL92003 Database accession no. BGL92003 *
DATABASE Geneseq [online] 8 August 2019 (2019-08-08), "Neoplasm treatment related XTEN protein AE712, SEQ 900.", XP002802130, retrieved from EBI accession no. GSP:BGL92014 Database accession no. BGL92014 *
FU ET AL., ENDOCRINOLOGY, vol. 145, 2004, pages 2504 - 2603
GAMIER JGIBRAT JFROBSON B.: "GOR method for predicting protein secondary structure from amino acid sequence", METHODS ENZYMOL, vol. 266, 1996, pages 540 - 553
GASTL, LANCET, vol. 356, 2000, pages 1981 - 1982
GENETICS AND MOLECULAR BIOLOGY, vol. 26, 2003, pages 295 - 300
GEORGE ET AL., PROTEIN ENGINEERING, vol. 15, 2003, pages 871 - 879
GHIRLANDO ET AL., IMMUNOL LETT, vol. 68, 1999, pages 47 - 52
HEROLD ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 346, 2002, pages 1692 - 1698
ISHIMITSU ET AL., BIOCHEM. BIOPHYS. RES. COMMUN, vol. 203, 1994, pages 631 - 639
KANGAWA ET AL., BBRC, vol. 121, 1984, pages 585
KODA, LANCET, vol. 339, 1992, pages 1179 - 1180
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KOJIMA ET AL., NATURE, vol. 402, 1999, pages 656 - 660
KUMAR, TRANSPLANT. PROC., vol. 30, 1998, pages 1351 - 1352
MARTIN, I.G.: "Expression of the 17-1A antigen in gastric and gastro-oesophageal junction adenocarcinomas: a potential immunotherapeutic target?", J CLIN PATHOL, vol. 52, 1999, pages 701 - 704
MIYAMOTO KANA ET AL: "Peptide barcoding for establishment of new types of genotype-phenotype linkages", PLOS ONE, vol. 14, no. 4, 23 April 2019 (2019-04-23), pages e0215993, XP055777160, DOI: 10.1371/journal.pone.0215993 *
MURRAY ET AL., J. CHROMATOGR SCI, vol. 40, 2002, pages 343 - 9
PACKEISEN J ET AL.: "Detection of surface antigen 17-1A in breast and colorectal cancer", HYBRIDOMA, vol. 18, no. 1, 1999, pages 37 - 40, XP009016649
PASSLICK, B. ET AL.: "The 17-1 A antigen is expressed on primary, metastatic and disseminated non-small cell lung carcinoma cells", INT. J. CANCER, vol. 87, no. 4, 2000, pages 548 - 552, XP002253131, DOI: 10.1002/1097-0215(20000815)87:4<548::AID-IJC14>3.0.CO;2-9
R RAFAEL ET AL., J CLIN INVEST, vol. 99, no. 9, 1997, pages 2100 - 2109
RAWLINGS N.D. ET AL., NUCLEIC ACIDS RES., vol. 36, 2008, pages D320
SEXTON, CURRENT MEDICINAL CHEMISTRY, vol. 6, 1999, pages 1067 - 1093
SGRO, C.: "Side-effects of a monoclonal antibody, muromonab CD3/orthoclone OKT3: bibliographic review", TOXICOLOGY, vol. 105, 1995, pages 23 - 29
SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225
SMITH, JA: "Nonmitogenic Anti-CD3 Monoclonal Antibodies Deliver a Partial T Cell Receptor Signal and Induce Clonal Anergy", J. EXP. MED., vol. 185, 1997, pages 1413 - 1422, XP002093848, DOI: 10.1084/jem.185.8.1413
STICKLER, M. ET AL., J IMMUNOL METHODS, vol. 281, 2003, pages 95 - 108
STURNIOLO, T. ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 555 - 61
STURNIOLO, T. ET AL., NATURE BIOTECHNOLOGY, vol. 17, 1999, pages 555
SUDOH ET AL., BBRC, vol. 159, 1989, pages 1420
TUNNACLIFFE, INT. IMMUNOL., vol. 1, 1989, pages 546 - 50
VAN ZOELEN ET AL., TRENDS PHARMACOL SCIENCES, vol. 19, no. 12, 1998, pages 487
WONG, JT: "The mechanism of anti-CD3 monoclonal antibodies. Mediation of cytolysis by inter-T cell bridging", TRANSPLANTATION, vol. 50, 1990, pages 683 - 689

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3990497A4 (en) * 2019-06-26 2023-07-19 Amunix Pharmaceuticals, Inc. CD3 ANTIGEN-BINDING FRAGMENTS AND COMPOSITIONS COMPRISING THEM
WO2021263058A1 (en) * 2020-06-25 2021-12-30 Amunix Pharmaceuticals, Inc. Her-2 targeted bispecific compositions and methods for making and using the same
EP4172179A4 (en) * 2020-06-25 2024-11-20 Amunix Pharmaceuticals, Inc. HER-2 TARGETED BISPECIFIC COMPOSITIONS AND METHODS OF MAKING AND USING THE SAME
US12215156B2 (en) 2020-06-25 2025-02-04 Amunix Pharmaceuticals, Inc. HER-2 targeted bispecific compositions and methods for making and using the same
AU2021297984B2 (en) * 2020-06-25 2025-09-11 Amunix Pharmaceuticals, Inc. HER-2 targeted bispecific compositions and methods for making and using the same
AU2021297984C1 (en) * 2020-06-25 2025-12-11 Amunix Pharmaceuticals, Inc. HER-2 targeted bispecific compositions and methods for making and using the same
US12617815B2 (en) 2020-11-13 2026-05-05 Amunix Pharmaceuticals, Inc. Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same
WO2023092099A1 (en) * 2021-11-19 2023-05-25 Ardeagen Corporation Gpc3 binding agents, conjugates thereof and methods of using the same
WO2025122957A1 (en) 2023-12-08 2025-06-12 Amunix Pharmaceuticals, Inc. Protease activatable cytokines and methods for making and using the same

Also Published As

Publication number Publication date
JP2025179058A (ja) 2025-12-09
CN115175920B (zh) 2025-10-31
CA3157605A1 (en) 2021-05-20
JP7725466B2 (ja) 2025-08-19
KR20220131221A (ko) 2022-09-27
CN115175920A (zh) 2022-10-11
EP4058466A1 (en) 2022-09-21
US20230287040A1 (en) 2023-09-14
BR112022009217A2 (pt) 2022-08-02
MX2022005676A (es) 2022-10-27
PH12022551163A1 (en) 2023-09-25
JP2023501478A (ja) 2023-01-18
CO2022008004A2 (es) 2022-10-21
IL292863A (en) 2022-07-01
AU2020382621A1 (en) 2022-06-02

Similar Documents

Publication Publication Date Title
US20230324389A1 (en) Compositions and methods related to activatable therapeutic agents
CN115175920B (zh) 加条形码的xten多肽及其组合物以及其制备和使用方法
CN104768571B (zh) 多价异多聚体支架设计和构建体
AU2026200173A1 (en) Activatable Cytokine Constructs And Related Compositions And Methods
TWI671318B (zh) 介白素-2融合蛋白及其用途
JP2020072733A (ja) synTacポリペプチド及びその使用
CN110177875B (zh) 包含抗原结合结构域和运送部分的多肽
EP3656792A1 (en) Immunoglobulin fc variants
CN114127277A (zh) 蛋白酶底物和包含蛋白酶切割序列的多肽
JP2024164077A (ja) 翻訳後修飾が低減したペプチドリンカー
CN120380013A (zh) 掩蔽多肽、可活化的新型前药及其使用方法
IL323985A (en) Compositions targeting epidermal growth factor receptor and methods for making and using the same
US12617815B2 (en) Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same
US20250223313A1 (en) Methods of contaminant removal from protein isolates
TW202321459A (zh) 可活化治療劑相關之組合物及方法
RU2815452C2 (ru) Полипептид, включающий антигенсвязывающий домен и транспортирующий сегмент
TWI921298B (zh) 含有抗原結合域及運輸部分之多胜肽
HK40064164A (en) Protease substrate, and polypeptide including protease cleavage sequence
HK40105110A (zh) 包含抗原结合结构域和运送部分的多肽
HK40044319A (en) Peptidic linker with reduced post-translational modification
HK40031719B (zh) 包括抗原结合结构域和运送部分的多肽
HK40006054B (zh) 包含抗原结合结构域和运送部分的多肽
HK40007165A (en) Ligand-binding molecule having adjustable ligand binding activity
HK1234664B (zh) Syntac多肽及其用途
HK1234664A1 (en) Syntac polypeptides and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20820695

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3157605

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022526756

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022009217

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2020382621

Country of ref document: AU

Date of ref document: 20201113

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2022/0008004

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: DZP2022000349

Country of ref document: DZ

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020820695

Country of ref document: EP

Effective date: 20220613

ENP Entry into the national phase

Ref document number: 112022009217

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220512

WWP Wipo information: published in national office

Ref document number: NC2022/0008004

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 522432551

Country of ref document: SA

WWW Wipo information: withdrawn in national office

Ref document number: 788187

Country of ref document: NZ

WWG Wipo information: grant in national office

Ref document number: 202080090841.X

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 522432551

Country of ref document: SA