WO2021019222A1 - P2x7 receptor targeted therapy - Google Patents
P2x7 receptor targeted therapy Download PDFInfo
- Publication number
- WO2021019222A1 WO2021019222A1 PCT/GB2020/051791 GB2020051791W WO2021019222A1 WO 2021019222 A1 WO2021019222 A1 WO 2021019222A1 GB 2020051791 W GB2020051791 W GB 2020051791W WO 2021019222 A1 WO2021019222 A1 WO 2021019222A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- receptor
- cancer
- individual
- antibody
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/407—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with other heterocyclic ring systems, e.g. ketorolac, physostigmine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/475—Quinolines; Isoquinolines having an indole ring, e.g. yohimbine, reserpine, strychnine, vinblastine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/517—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/66—Phosphorus compounds
- A61K31/675—Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/243—Platinum; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the invention relates to methods of treating cancer, particular cancers which have developed a resistance to chemotherapeutics.
- chemoresistance is a persistent problem during chemotherapy treatment.
- AML acute myeloid leukemia
- AML acute myeloid leukemia
- 5-year overall survival rate is 40% in young adults and around 10% for elderly patients.
- Response rates dramatically vary with ageing, from 40% to 55% in patients older than 60 years and from 24% to 33% in patients older than 70 years.
- hypotheses have been proposed to account for the phenomenon of chemoresistance.
- the hypotheses include altered transport of the drug across the plasma membrane, genetic responses, enhanced DNA repair, alteration in target molecules, access to target cells, metabolic effects and growth factors.
- small pumps on the surface of cancer cells that actively move chemotherapy drugs from inside the cell to the outside have been identified.
- Research on p-glycoprotein and other such chemotherapy efflux pumps is currently ongoing.
- Medications inhibiting the function of p-glycoprotein have been explored to enhance the efficacy of chemotherapy.
- this approach failed during clinical evaluation. It is nevertheless increasingly recognized that the causes of chemoresistance and relapse reside within a small number of cells that undergo further mutations as part of the transformation processes acting in cancer.
- tumourigenesis The recent renaissance in understanding the role of clonal evolution in tumourigenesis illuminates the challenge of acquired resistance and has led to two major models of tumourigenesis—the cancer stem cell and clonal evolution models. These are not necessarily mutually exclusive and can be complementary. Both indicate that the main obstacle to durable cures is cancer heterogeneity.
- existing anti cancer therapy largely fails to account for either model.
- Recent advances in targeted therapy are promising, but since cancer heterogeneity and evolution present multiple, moving targets, development of resistance is common. Unfortunately, little progress has been made in targeting the chemoresistant cells responsible for relapse.
- the present invention provides a method of treating cancer in an individual who has not responded, or no longer responds, to chemotherapy and/or radiotherapy, the method comprising
- the individual no longer responds to one or more chemotherapeutic agents selected from the group consisting of oxazaphosphorines, topoisomerase I inhibitors, topoisomerase II inhibitors, thymidylate synthase inhibitors, proteasome inhibitors, antifolates, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, purine antagonists, antimetabolites, antibiotics, epipodophyllotoxins, platinum based agents, ribonucleotide reductase inhibitors, vinca alkaloids, substituted ureas, hydrazine derivatives, adrenocortical suppressants, endostatin, camptothecins, oxaliplatin, doxorubicin and
- the one or more chemotherapeutic agents are selected from the group consisting of doxorubicin, cisplatin, vincristine, dacarbazine (DTIC), cyclophosphamide, CPT-11 , oxaliplatin, gemcitabine and 5-fluorouracil/leucovorin.
- the one or more chemotherapeutic agents are selected from the group consisting of 5FU, Folinic acid, Bleomycin, Etoposide, Cisplatin, Capecitabin, Oxaliplatin, dacarbazine, Cyclophosphamide, Vincristine, Doxorubicin, Irinotecan, Gemcitabine, Mitomycin-C, Gemcitabine, Carboplatin, Paclitaxel, pemetrexed, hydroxyethyl-chloroethyl nitrosourea (FleCNU), Tamoxifen, Methotrexat, Epirubicin, Vindesine, Erlotinib, Bevacizumab, Cetuximab.
- the individual has any cancer as described herein.
- the cancer is selected from the group consisting of colorectal cancer, testicular cancer, sarcoma, melanoma, bladder cancer, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, ovarian cancer, and breast cancer.
- the individual has colon cancer.
- the individual has ovarian cancer.
- the P2X7 receptor targeted therapy results in a reduction in the viability of a cancer cell expressing a P2X7 receptor that has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the P2X7 receptor targeted therapy may be a direct or indirect inhibitor of P2X7 receptor activity or expression level, wherein the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the inhibitor may be an interfering RNA capable of reducing the level of P2X7 receptor in a cancer cell.
- An inhibitor of a P2X7 receptor may be selected from the group consisting of a small molecule, an antibody, a peptide or an interfering RNA.
- the inhibitor of a P2X7 receptor may be a molecule that induces an immune response in the individual to a P2X7 receptor that is expressed by the individual, preferably a P2X7 receptor expressed on a cancer cell.
- the present invention provides a method of treating cancer in an individual who has not responded, or no longer responds, to chemotherapy and/or radiotherapy, the method comprising
- administering a P2X7 receptor targeted therapy to the individual comprises providing in the individual a whole antibody or a fragment thereof comprising a variable domain for binding to a P2X7 receptor that is expressed by the individual, wherein the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the antibody fragment is selected from the group consisting of a dAb, Fab, Fd, Fv, F(ab’)2, scFv or any other antibody fragment format described herein.
- the antibody or fragment thereof does not bind to functional P2X7 receptors (i.e. P2X7 receptors that do not have an impaired response to ATP and are therefore capable of forming an apoptotic pore under normal physiological conditions).
- the antibody or fragment thereof binds to the amino acid sequence as set forth in any one of SEQ ID NOs: 1 to 11 , more preferably, SEQ ID NO: 2 to 5.
- the antibody or fragment thereof comprises the amino acid sequences of any antibody described in PCT/AU2002/000061 or PCT/AU2002/001204 (or in any one of the corresponding US patents US 7,326,415, US 7,888,473, US 7,531 ,171 , US 8,080,635, US 8,399,617, US 8,709,425, US 9,663,584, or US 10,450,380), PCT/AU2007/001540 (or in corresponding US patent US 8,067,550), PCT/AU2007/001541 (or in corresponding US publication US 2010- 0036101 ), PCT/AU2008/001364 (or in any one of the corresponding US patents US 8,440,186, US 9,181 ,320, US 9,944,701 or US 10,597,451 ), PCT/AU2008/001365 (or in any one of the corresponding US patents US 8,293,491 or US 8,658,385), PCT/AU2009/000869 (or in any one of the corresponding US
- the antibody comprises the CDR amino acid sequences of 2-2-1 described in PCT/AU2010/001070 (or in any one of the corresponding US patents US 9,127,059, US 9,688,771 , or US 10,053,508) or BPM09 described in PCT/AU2007/001541 (or in corresponding US publication US 2010-0036101 ) and produced by the hybridoma AB253 deposited with the European Collection of Cultures (ECACC) under Accession no. 06080101.
- the present invention provides a method of treating cancer in an individual who has not responded, or no longer responds, to chemotherapy and/or radiotherapy, the method comprising
- the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions, thereby treating cancer in the individual.
- a cell based therapy that targets P2X7 receptor expressing cancer cells may be a cytotoxic cell that has the capacity to bind to a P2X7 receptor expressing cancer cell, for example a CAR-T cell.
- the cytotoxic cell preferably a CAR-T cell, expresses a chimeric antigen receptor including an antigen-recognition domain and a signalling domain, wherein the antigen-recognition domain recognises a dysfunctional or non-functional P2X7 receptor (i.e. a P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions).
- a P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the dysfunctional or non-functional P2X7 receptor has a reduced capacity to bind ATP compared to an ATP- binding capacity of a wild-type (functional) P2X7 receptor.
- the dysfunctional or non-functional P2X7 receptor may have a conformational change that renders the receptor dysfunctional or non-functional.
- the antigen-recognition domain may recognise an epitope that includes proline at amino acid position 210 of the P2X7 receptor.
- the antigen-recognition domain may recognise an epitope that includes one or more amino acid residues spanning from glycine at amino acid position 200 to cysteine at amino acid position 216 of the dysfunctional P2X7 receptor.
- the antigen-recognition domain may comprise amino acid sequence homology to the amino acid sequence of an antibody, or a fragment thereof, that binds to the dysfunctional or non-functional P2X7 receptor, including any antibody, or fragment thereof, as described herein.
- the antigen-recognition domain may include amino acid sequence homology to the amino acid sequence of a fragment-antigen binding (Fab) portion, a single-chain variable fragment (scFv), or a single-antibody domain (dAb) of an antibody that binds to a dysfunctional or non-functional P2X7 receptor.
- the antigen-recognition domain may include amino acid sequence homology to the amino acid sequence of a multivalent single-chain variable fragment (scFv) that binds to a dysfunctional or non-functional P2X7 receptor.
- the multivalent single- chain variable fragment (scFv) may be di-valent or tri-valent scFv.
- the signalling domain may include a portion derived from an activation receptor.
- the activation receptor is a member of the CD3 co receptor complex.
- the portion derived from the CD3 co-receptor complex is CD3-zeta.
- the activation receptor is an Fc receptor and then preferably the portion derived from the Fc receptor is Fc epsilon Rl or Fc gamma Rl.
- the signalling domain may include a portion derived from a co stimulatory receptor.
- the signalling domain may include a portion derived from an activation receptor and a portion derived from a co-stimulatory receptor.
- the co-stimulatory receptor may be selected from the group consisting of CD27, CD28, CD30, CD40, DAP 10, 0X40, 4-1 BB (CD137) and ICOS.
- the cytotoxic cell any one of:
- PBMC Peripheral Blood Mononuclear Cell
- the present invention also provides a method of treating cancer in an individual who has not responded, or no longer responds, to chemotherapy and/or radiotherapy, the method comprising
- the immune response is formed by providing an immunogen in the individual in the form of a P2X7 receptor, or a fragment of a P2X7 receptor that is capable of inducing an immune response to a P2X7 receptor in the individual, wherein the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the fragment of a P2X7 receptor has an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to 11. More preferably, SEQ ID NO: 2 to 5.
- the immunogen may contain at least one sequence that is capable of being presented on a major histocompatibility complex class II molecule and/or is capable of interacting with a T or B-cell receptor or a B-cell membrane bound-immunoglobulin.
- the individual is human, in which case the immunogen is provided in the form of a human P2X7 receptor, or fragment thereof that is capable of inducing an immune response to a P2X7 receptor.
- the immune response that is formed in the individual is specific for a P2X7 receptor that has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- antibodies or cellular components that are reactive with non-functional P2X7 receptors i.e. with one or more sites unable to bind ATP
- functional P2X7 receptors i.e. ATP binding receptors
- the immunogen is provided in an initial administration to the individual, thereby forming a response that includes IgM production in the individual.
- immunogen is provided in an initial administration to the individual, thereby forming a response that includes IgM production, and at a later time, in a further administration to the initial administration, thereby forming a response that includes IgG production.
- the immune response may be a humoral and/or cellular response.
- a humoral response may include the transformation of B-cells into plasma cells, which secrete antibody, Th2 activation and cytokine production, germinal centre formation and isotype switching, affinity maturation of B-cells and/or memory cell generation.
- a cellular response may include activating antigen-specific cytotoxic T- lymphocytes, activating macrophages and natural killer cells and/or stimulating cells to secrete cytokines.
- the humoral and/or cellular response formed in the individual may treat or ameliorate a cancer in the individual, or minimise the progression of cancer in the individual.
- the present invention also provides a method of treating cancer in an individual, the method comprising
- the present invention also provides a method of treating cancer in an individual, the method comprising
- the chemotherapeutic agent and/or radiotherapy may be administered simultaneously with the antibody or fragment thereof.
- the chemotherapy and antibody or fragment thereof are administered simultaneously.
- the radiotherapy and antibody or fragment thereof are administered simultaneously.
- the chemotherapeutic agent and/or radiotherapy may be administered sequentially to the antibody or fragment thereof.
- the chemotherapeutic agent may be administered prior to the antibody or fragment thereof.
- the chemotherapeutic agent may be any described herein.
- the chemotherapeutic agent is selected from the group consisting of oxazaphosphorines, topoisomerase I inhibitors, topoisomerase II inhibitors, thymidylate synthase inhibitors, proteasome inhibitors, antifolates, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, purine antagonists, antimetabolites, antibiotics, epipodophyllotoxins, platinum based agents, ribonucleotide reductase inhibitors, vinca alkaloids, substituted ureas, hydrazine derivatives, adrenocortical suppressants, endostatin, camptothecins, oxaliplatin,
- the chemotherapeutic agent is selected from the group consisting of doxorubicin, cisplatin, vincristine, dacarbazine (DTIC), cyclophosphamide, CPT-11 , oxaliplatin, gemcitabine and 5-fluorouracil/leucovorin.
- the chemotherapeutic agent is selected from the group consisting of 5FU, Folinic acid, Bleomycin, Etoposide, Cisplatin, Capecitabin, Oxaliplatin, dacarbazine, Cyclophosphamide, Vincristine, Doxorubicin, Irinotecan, Gemcitabine, Mitomycin-C, Gemcitabine, Carboplatin, Paclitaxel, pemetrexed, hydroxyethyl- chloroethyl nitrosourea (HeCNU), Tamoxifen, Methotrexat, Epirubicin, Vindesine, Erlotinib, Bevacizumab, Cetuximab.
- 5FU Fluorubicin
- Bleomycin Bleomycin
- Etoposide Cisplatin
- Capecitabin Capecitabin
- Oxaliplatin dacarbazine
- Cyclophosphamide Cyclophosphamide
- Vincristine Doxorubicin
- the present invention also provides a method of treating cancer in an individual, the method comprising
- the present invention also provides a method of treating cancer in an individual, the method comprising
- the immune response is formed by providing an immunogen in the individual in the form of a P2X7 receptor, or a fragment of a P2X7 receptor that is capable of inducing an immune response to a P2X7 receptor in the individual, wherein the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the fragment of a P2X7 receptor has an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to 11 , more preferably, SEQ ID NO: 2 to 5.
- the chemotherapeutic agent and the immunogen may be administered simultaneously.
- the chemotherapeutic agent and the immunogen may be administered sequentially.
- the chemotherapeutic agent may be administered prior to the immunogen.
- the chemotherapeutic agent may be any described herein.
- the chemotherapeutic agent is selected from the group consisting of nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, antimetabolites, antibiotics, epipodophyllotoxins, platinum coordination complexes, vinca alkaloids, substituted ureas, methyl hydrazine derivatives, adrenocortical suppressants, endostatin, taxols, camptothecins, oxaliplatin, doxorubicin and doxorubicin analogs.
- the chemotherapeutic agent is selected from the group consisting of doxorubicin, cisplatin, vincristine, dacarbazine (DTIC), cyclophosphamide, CPT-11 , oxaliplatin, gemcitabine and 5-fluorouracil/leucovorin.
- the cancer may be a blood born cancer or a solid tumour.
- the cancer may be any one described herein, including one selected from the group consisting of brain cancer, oesophageal cancer, mouth cancer, tongue cancer, thyroid cancer, lung cancer, stomach cancer, pancreatic cancer, kidney cancer, colon cancer, rectal cancer, prostate cancer, bladder cancer, cervical cancer, epithelial cell cancers, skin cancer, neuroblastoma, leukaemia, lymphoma, myeloma, breast cancer, ovarian cancer, endometrial cancer and testicular cancer.
- FIG. 1 Chemotherapy treatment in myeloma RPMI-8226 and neuroblastoma Kelly cell lines.
- C Effect of increasing doses of doxorubicin on Kelly cell viability measured using CTB assay.
- CTB CellTitre-Blue
- FIG. 2 Chemotherapy treatment in functional myeloma RPMI-8226 and non functional neuroblastoma Kelly cell lines and induction of nfP2X7 as detected by BPM09.
- Figure 3 Change in nfP2X7 antibody (here BPM09) binding to live ovarian A2780 parental cells and A2780 cells, which have acquired resistance to Doxorubicin and Cisplatin.
- FIG. 4 BPM09 membrane scored after immunohistochemistry in a set of 200 patient derived xenograft models, which were previously treated or not with chemotherapy or radiotherapy. Similar analysis is performed in the colorectal dataset (37 samples).
- Figure 5 Effect of 5Fu on nfP2X7 antibodies (here polyclonal mouse antibody) mediated complement dependent cytotoxicity on Kelly cells.
- Figure 6 A) Data showing that FIMGB1 can drive the increase in nfP2X7.
- Condition Media from RPMI-8226 treated with Doxorubicin does not act via ATP Detailed description of the embodiments
- the present inventors have surprisingly identified that chemotherapy or radiotherapy increases the level of P2X7 receptors that cannot form an apoptotic pore on live cells. Further, the inventors have identified that there is increased level of P2X7 receptors that cannot form an apoptotic pore on cells that have developed complete or partial resistance to chemotherapy. These findings are independent of the type of chemotherapy as chemotherapeutics of distinct structural classes that have distinct mechanisms of action, all result in increased level of P2X7 receptors that cannot form an apoptotic pore. Further, the findings apply to a wide variety of cancers irrespective of tissue origin (e.g. blood borne or solid). Lastly, the inventors have shown that this increased level driven by chemotherapy occurs in both cell lines and primary cells derived from patient samples.
- the inventors have also shown that cancer cells pre-treated with chemotherapy, which therefore have an increased level of P2X7 receptors that cannot form an apoptotic pore, are sensitive to various interventions that target the P2X7 receptor.
- “Purinergic receptof” generally refers to a receptor that uses a purine (such as ATP) as a ligand.
- P2X7 receptof generally refers to a purinergic receptor formed from three protein subunits or monomers, with at least one, preferably all 3, of the monomers having an amino acid sequence substantially as shown in SEQ ID NO: 1. To the extent that P2X7 receptor is formed from three monomers, it is a“trimer” or“trimeric”.“P2X7 receptof may be a functional or non-functional receptor as described below.
- P2X7 receptof encompasses naturally occurring variants of P2X7 receptor, e.g., wherein the P2X7 monomers are splice variants, allelic variants and isoforms including naturally- occurring truncated or secreted forms of the monomers forming the P2X7 receptor (e.g., a form consisting of the extracellular domain sequence or truncated form of it), naturally- occurring variant forms (e.g., alternatively spliced forms) and naturally- occurring allelic variants.
- the native sequence P2X7 monomeric polypeptides disclosed herein are mature or full-length native sequence polypeptides comprising the full-length amino acids sequence shown in SEQ ID No:1.
- the P2X7 receptor may have an amino acid sequence that is modified, for example various of the amino acids in the sequence shown in SEQ ID No:1 may be substituted, deleted, or a residue may be inserted.
- “Functional P2X7 receptof generally refers to a form of the P2X7 receptor having a binding site or cleft for binding to ATP. When bound to ATP, the receptor forms a non- selective cation channel that converts to a pore -like structure that enables the increased influx of calcium ions and also molecules of up to 1000 Da into the cytosol, one consequence of which may be programmed cell death. In normal homeostasis, expression of functional P2X7 receptors is generally limited to cells that undergo programmed cell death such as thymocytes, dendritic cells, lymphocytes, macrophages and monocytes. There may also be some expression of functional P2X7 receptors on erythrocytes and other cell types.
- Non-functional P2X7 receptof or“nfP2XT’ generally refers to a form of a P2X7 receptor having a conformation whereby the receptor is unable to form an apoptotic pore, but which is still able to operate as a non-selective channel.
- the isomerisation may arise from any molecular event that leads to misfolding of the monomer, including for example, mutation of monomer primary sequence or abnormal post translational processing.
- One consequence of the isomerisation is that the receptor is unable to extend the opening of the channel. In these circumstances, the receptor cannot form a pore and this limits the extent to which calcium ions and molecules of up to 1000 Da may enter the cytosol.
- Non-functional P2X7 receptors are expressed on a wide range of epithelial and haematopoietic cancers.
- Cancer associated -P2X7 receptors are generally P2X7 receptors that are found on cancer cells (including, pre-neoplastic, neoplastic, malignant, benign or metastatic cells), but not on non-cancerous or normal cells.
- E200 epitope generally refers to an epitope exposed on a non-functional P2X7 receptor. In humans the sequence is GHNYTTRNILPGLNITC (SEQ ID NO: 5).
- E300 epitope generally refers to an epitope exposed on a non-functional P2X7 receptor. In humans the sequence is KYYKENNVEKRTLIKVF (SEQ ID NO: 8).
- Composite epitope generally refers to an epitope that is formed from the juxtaposition of the E200 and E300 epitopes or parts of these epitopes.
- a“P2X7 receptor targeted therapy’ is any therapy that directly or in-directly results in a reduction in the viability of a cancer cell expressing a P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the therapy comprises the administration of a molecule that binds to, induces an immune response to, or reduces the level of a P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the molecule that binds to a P2X7 receptor is an antibody or cell-based therapy.
- the molecule that induces an immune response to P2X7 receptor is an immunogen in the individual in the form of a P2X7 receptor, or a fragment of a P2X7 receptor that is capable of inducing an immune response to a P2X7 receptor in the individual, wherein the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the molecule that reduces the level of P2X7 receptor is an interfering RNA.
- Inhibition of a P2X7 receptor that has an impaired response to ATP may also include a reduction in the level or amount of P2X7 receptor protein, RNA or DNA in a cell, preferably a cancer cell.
- the molecule may be specific for a P2X7 receptor and only have some low level inhibitory activity against other P2X receptors.
- Antibodies or“ immunoglobulins” or“ Igs” are gamma globulin proteins that are found in blood, or other bodily fluids of vertebrates that function in the immune system to bind antigen, hence identifying and/or neutralizing foreign objects.
- Antibodies are generally a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. Each L chain is linked to a H chain by one covalent disulfide bond. The two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges.
- H and L chains define specific Ig domains. More particularly, each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and g chains and four CH domains for m and e isotypes. Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end. The VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CH1 ).
- Antibodies can be assigned to different classes or isotypes.
- immunoglobulins There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated a, d, e, g, and m, respectively.
- the g and a classes are further divided into subclasses on the basis of relatively minor differences in CH sequence and function, e.g., humans express the following subclasses: lgG1 , lgG2, lgG3, lgG4, lgA1 , and lgA2.
- the L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
- the constant domain includes the Fc portion which comprises the carboxy- terminal portions of both H chains held together by disulfides.
- the effector functions of antibodies such as ADCC are determined by sequences in the Fc region, which region is also the part recognized by Fc receptors (FcR) found on certain types of cells.
- variable region or " variable domain" including the amino -terminal domains of the heavy or light chain of the antibody.
- the variable domain of the heavy chain may be referred to as "VH.”
- the variable domain of the light chain may be referred to as "VL.”
- the V domain contains an“antigen binding site " which affects antigen binding and defines specificity of a particular antibody for its particular antigen.
- V regions span about 110 amino acid residues and consist of relatively invariant stretches called framework regions (FRs) (generally about 4) of 15- 30 amino acids separated by shorter regions of extreme variability called " hypervariable regions " (generally about 3) that are each generally 9-12 amino acids long.
- the FRs largely adopt a b-sheet configuration and the hypervariable regions form loops connecting, and in some cases forming part of, the b-sheet structure.
- Hypervariable region refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six hypervariable regions; three in the VH (HI, H2, H3), and three in the V L (LI, L2, L3).
- Framework' or "FR” residues are those variable domain residues other than the hypervariable region residues herein defined.
- An“antigen binding site” generally refers to a molecule that includes at least the hypervariable and framework regions that are required for imparting antigen binding function to a V domain.
- An antigen binding site may be in the form of an antibody or an antibody fragment, (such as a dAb, Fab, Fd, Fv, F(ab’) 2 or scFv) in a method described herein.
- An " intact ' or“whole” antibody is one which comprises an antigen-binding site as well as a CL and at least heavy chain constant domains, CHI, CH2 and CH3.
- the constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof.
- “whole antibody fragments Including a variable domain” include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies, single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- The“Fab fragment’ consists of an entire L chain along with the variable region domain of the FI chain (VH), and the first constant domain of one heavy chain (CHI). Each Fab fragment is monovalent with respect to antigen binding, i.e. , it has a single antigen-binding site.
- A“Fab' fragment’ differs from Fab fragments by having additional few residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
- Fab'- SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- A“F(ab')2 fragment’ roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
- Fv is the minimum antibody fragment which contains a complete antigen- recognition and binding site. This fragment consists of a dimer of one heavy and one light chain variable region domain in tight, non-covalent association.
- one heavy and one light chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a " dimeric " structure analogous to that in a two-chain Fv species. From the folding of these two domains emanate six hypervariable loops (3 loops each from the FI and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody.
- "Single-chain Fv” also abbreviated as “sFv” or "scFv” are antibody fragments that comprise the VH and VL antibody domains connected to form a single polypeptide chain.
- the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- A“single variable domain” is half of an Fv (comprising only three CDRs specific for an antigen) that has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- “Diabodies” refers to antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
- the small antibody fragments are prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10 residues) between the VH and VL domains such that interchain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e. , fragment having two antigen-binding sites.
- Diabodies may be bivalent or bispecific.
- Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
- Triabodies and tetrabodies are also generally known in the art.
- an “isolated antibody” is one that has been identified and separated and/or recovered from a component of its pre-existing environment. Contaminant components are materials that would interfere with therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- a "human antibody” refers to an antibody that possesses an amino acid sequence that corresponds to that of an antibody produced by a human. Fluman antibodies can be produced using various techniques known in the art, including phage -display libraries. Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled.
- Humanized' forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
- donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
- framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. , the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site or determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. Monoclonal antibodies may be prepared by the hybridoma methodology. The "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques.
- anti-P2X7 receptor antibody or "an antibody that binds to P2X7 receptor” refers to an antibody that is capable of binding P2X7 receptor with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting P2X7 receptor, typically non-functional P2X7 receptor.
- the extent of binding of an P2X7 receptor antibody to an unrelated protein is less than about 10% of the binding of the antibody to P2X7 receptor as measured, e.g., by a radioimmunoassay (RIA), Enzyme-Linked Immunosorbent Assay (ELISA), Biacore or Flow Cytometry.
- RIA radioimmunoassay
- ELISA Enzyme-Linked Immunosorbent Assay
- Biacore Biacore
- an antibody that binds to P2X7 receptor has a dissociation constant (Kd) of ⁇ 1 uM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
- Kd dissociation constant
- An anti non-functional P2X7 receptor antibody is generally one having some or all of these serological characteristics and that binds to non-functional P2X7 receptors but not to functional P2X7 receptors.
- affinity matured' antibody is one with one or more alterations in one or more hypervariable region thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
- Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
- Affinity matured antibodies are produced by procedures known in the art.
- blocking antibody or an " antagonist ' antibody is one that inhibits or reduces biological activity of the antigen it binds.
- Preferred blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
- an "agonist antibody', as used herein, is an antibody, which mimics at least one of the functional activities of a polypeptide of interest.
- Binding affinity' generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity' refers to intrinsic binding affinity, which reflects a 1 :1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention.
- Epitope generally refers to that part of an antigen that is bound by the antigen binding site of an antibody.
- An epitope may be ⁇ inea in the sense that the hypervariable loops of the antibody CDRs that form the antigen binding site bind to a sequence of amino acids as in a primary protein structure.
- the epitope is a“conformational epitope” i.e. one in which the hypervariable loops of the CDRs bind to residues as they are presented in the tertiary or quaternary protein structure. ‘Treatment generally refers to both therapeutic treatment and prophylactic or preventative measures.
- Subjects requiring treatment include those already having a benign, pre- cancerous, or non-metastatic tumour as well as those in which the occurrence or recurrence of cancer is to be prevented.
- the objective or outcome of treatment may be to reduce the number of cancer cells; reduce the primary tumour size; inhibit (i.e. , slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumour metastasis; inhibit, to some extent, tumour growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
- Efficacy of treatment can be measured by assessing the duration of survival, time to disease progression, the response rates (RR), duration of response, and/or quality of life.
- the method is particularly useful for delaying disease progression.
- the method is particularly useful for extending survival of the human, including overall survival as well as progression free survival.
- the method is particularly useful for providing a complete response to therapy whereby all signs of cancer in response to treatment have disappeared. This does not always mean the cancer has been cured.
- the method is particularly useful for providing a partial response to therapy whereby there has been a decrease in the size of one or more tumours or lesions, or in the extent of cancer in the body, in response to treatment.
- Pre - cancerous or“pre - neoplasia” generally refers to a condition or a growth that typically precedes or develops into a cancer.
- a "pre -cancerous” growth may have cells that are characterized by abnormal cell cycle regulation, proliferation, or differentiation, which can be determined by markers of cell cycle.
- the cancer is pre-cancerous or pre -neoplastic.
- the cancer is a secondary cancer or metastases.
- the secondary cancer may be located in any organ or tissue, and particularly those organs or tissues having relatively higher hemodynamic pressures, such as lung, liver, kidney, pancreas, bowel and brain.
- cancers include blastoma (including medulloblastoma and retinoblastoma), sarcoma (including liposarcoma and synovial cell sarcoma), neuroendocrine tumours (including carcinoid tumours, gastrinoma, and islet cell cancer), mesothelioma, schwannoma (including acoustic neuroma), meningioma, adenocarcinoma, melanoma, leukemia or lymphoid malignancies, lung cancer including small-cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer (including metastatic breast cancer), colon cancer, rectal
- a condition or symptom associated’ [with the cancer] may be any pathology that arises as a consequence of, preceding, or proceeding from the cancer.
- the condition or relevant symptom may be microbial infection.
- the condition or symptom may relate to organ dysfunction of the relevant organ having tumour metastases.
- the methods of treatment described herein are for the minimisation or treatment of a condition or symptom in an individual that is associated with a cancer in the individual.
- A“non self molecule such as a“non self antigen binding site, or“non self antibody generally refers to a molecule that has been produced outside of, or exogenous to, a body in which the molecule is to be provided, for example, for treatment.
- synthetic or recombinant molecules are“non self’.
- a molecule that is generated in one individual and administered to another individual for treatment is“non self.
- “Non self antigen binding sites and antibodies may be used in accordance with the invention for adoptive transfer of immunity, for example, as occurs in antibody infusion.
- a molecule that is generated inside an individual that is to be treated with that molecule is generally a“self or“ endogenous " molecule.
- One example of a“self molecule is an antigen binding site or antibody that is generated, or arises from an adaptive immune response to immunogen.
- level of non self-antigen binding sites in circulation in the individual generally refers to the concentration of antigen binding site in a body fluid, preferably peripheral blood.
- A“substantially undetectable level of non self-antigen binding sites in circulation” generally refers to a concentration of exogenous antigen binding sites (i.e. those that have been administered by adoptive transfer) that is at least half of the concentration of the antigen binding sites in circulation at the time of administration of the antigen binding sites, preferably 25%, or 10%, or 5% or 1 % of said concentration, or otherwise less than 0.001 mg/kg of the individual.
- the phrase may also refer to a circumstance where antigen binding sites that have been given for the purpose of cancer immunotherapy cannot be detected at all.
- a cancer that is“substantially undetectable" generally refers to a circumstance where therapy has depleted the size, volume or other physical measure of a cancer so that using relevant standard detection techniques such as in vivo imaging, the cancer, as a consequence of the therapy, is not clearly detectable.
- the phrase also refers to the circumstance where the cancer cannot be detected at all.
- forming an immune response generally refers to invoking or inducing antigen specific immunity via the adaptive immune system.
- induction of antigen specific immunity is distinguished from adoptive transfer of immunity, standard cancer immunotherapy by administration of exogenous or non self antibody being one example of the latter.
- the individuals selected for treatment according to a method described above are those who have received, or who are continuing to receive chemotherapy, for treatment of cancer.
- the individual may have received any one or more of the chemotherapies described herein including oxazaphosphorines, topoisomerase I inhibitors, topoisomerase II inhibitors, proteasome inhibitors, antifolates, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, purine antagonists, antimetabolites, antibiotics, epipodophyllotoxins, platinum based agents, ribonucleotide reductase inhibitors, vinca alkaloids, substituted ureas, hydrazine derivatives, adrenocortical suppressants, endostatin, camptothecins,
- the individual may have received chemotherapy leading to a reduced tumour mass but one that is still clinically or biochemically detectable.
- the cancer may have substantially diminished in size, mass or other physical measure as a consequence of chemotherapy.
- the individual selected for treatment according to a method described above may or may not have detectable cancer at the time of treatment.
- an individual selected for treatment is one who has not responded, or no longer responds, to chemotherapy.
- the purpose of the treatment according to the above described methods is to at least minimise the progression of cancer.
- One approach to treatment is by induction or formation of an immune response in the individual to a non-functional P2X7 receptor. Therefore, the individual selected for this form of treatment must be capable of generating an immune response sufficient for meeting this purpose.
- the desired immune response includes a capacity to produce either or both of circulating IgM and IgG when the individual is challenged by cancer, as in recurrence of cancer.
- P2X7 receptor targeted therapy is administration of antigen binding sites, or antibodies, that bind to a P2X7 receptor that has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the antigen binding site is one that discriminates between functional and non-functional P2X7 receptors, so as to bind to non-functional receptors, but not to functional receptors.
- antigen binding sites are those that bind to the E200 epitope, E300 epitope or composite epitope as for example in PCT/AU2002/000061 and PCT/AU2002/001204 (or in any one of the corresponding US patents US 7,326,415, US 7,888,473, US 7,531 ,171 , US 8,080,635, US 8,399,617, US 8,709,425, US 9,663,584, or US 10,450,380), in PCT/AU2007/001540 (or in corresponding US patent US 8,067,550), PCT/AU2007/001541 (or in corresponding US publication US 2010-0036101 ), PCT/AU2008/001364 (or in any one of the corresponding US patents US 8,440,186, US 9,181 ,320, US 9,944,701 or US 10,597,451 ), PCT/AU2008/001365 (or in any one of the corresponding US patents US 8,293,491 or US 8,658,385), PCT/AU
- the antigen binding cite comprises the CDR amino acid sequences of 2-2-1 described in PCT/AU2010/001070 (or in any one of the corresponding US patents US 9,127,059, US 9,688,771 , or US 10,053,508) or BPM09 described in PCT/AU2007/001541 (or in corresponding US publication US 2010- 0036101 ) and produced by the hybridoma AB253 deposited with the European Collection of Cultures (ECACC) under Accession no. 06080101.
- the antigen binding site may take the form of a whole antibody, or a whole antibody fragment such as a Fab, a Fab’, a F(ab’)2, and Fv, a single chain Fv, or a single variable domain.
- the antigen binding site may be syngeneic, allogeneic or xenogeneic.
- the antigen binding site is non self or exogenous meaning that it has been found or isolated outside of the individual who is treated according to the methods of the invention.
- the antigen binding site may be affinity matured.
- the antigen binding site may have multiple specificities or valencies.
- the antigen binding site may be adapted so as to be suited to administration by a selected method.
- the antibody may be a whole antibody of any isotype.
- the antibody may be one obtained from monoclonal or polyclonal antisera.
- the antibody may be produced by hybridoma, or by recombinant expression, or may be obtained from serum for example as obtainable from a mammal, particularly a human or mouse.
- the antibody may also be obtained from an avian.
- the antibody may be chimeric, i.e. one containing human variable domains and non-human constant domains.
- it may be humanized, i.e. one formed by grafting non-human CDRs onto a human antibody framework.
- the antibody may be fully human.
- the antibody may be modified with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer.
- the antibody fragment is selected from the group consisting of a dAb, Fab, Fd, Fv, F(ab’) 2 , scFv and CDR.
- Dosage amount, dosage frequency, routes of administration etc are described in detail below.
- the route of administration may be, for example, oral, parenteral (e.g. intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intradermal, rectal or vaginal), by inhalation or topical.
- parenteral e.g. intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intradermal, rectal or vaginal
- One form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip, comprising a buffer (e.g. acetate, phosphate or citrate buffer), a surfactant (e.g. polysorbate), optionally a stabilizer agent (e.g. human albumin).
- a buffer e.g. acetate, phosphate or citrate buffer
- surfactant e.g. polysorbate
- optionally a stabilizer agent e.g. human albumin
- Preparations for parenteral administration includes sterile aqueous (aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media) or non-aqueous (non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate) solutions, suspensions, and emulsions.
- Pharmaceutically acceptable carriers include 0.01-0.1 M and preferably 0.05M phosphate buffer or 0.9% saline.
- Other common parenteral vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions, in such cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., 16th ed. (1980).
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like.
- isotonic agents for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminium monostearate and gelatin.
- sterile injectable solutions can be prepared by incorporating an active compound (e.g., antigen binding site) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization.
- an active compound e.g., antigen binding site
- dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying, freeze-drying and spray drying, which yields a powder of an active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
- the preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit. Such articles of manufacture will preferably have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to disorders.
- Effective doses of the compositions of the present invention, for treatment of disorders, as described herein, vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Treatment dosages may be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
- the dosage can range, e.g., from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg (e.g., 0.02 mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, I mg/kg, 2 mg/kg, etc.), of the host body weight.
- dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg, preferably at least 1 mg/kg.
- Doses intermediate in the above ranges are also intended to be within the scope of the invention.
- Subjects can be administered such doses daily, on alternative days, weekly or according to any other schedule determined by empirical analysis.
- An exemplary treatment entails administration in multiple dosages over a prolonged period, for example, of at least six months. Additional exemplary treatment regimens entail administration once per every two weeks or once a month or once every 3 to 6 months. Exemplary dosage schedules include 1-10 mg/kg or 15 mg/kg on consecutive days, 30 mg/kg on alternate days or 60 mg/kg weekly. In some methods, two or more antigen binding sites with different binding specificities are administered simultaneously, in which case the dosage of each antigen binding site administered falls within the ranges indicated.
- the antibody for binding to a non-functional P2X7 receptor expressed on a cell can be administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of target polypeptide or target molecule in the patient. In some methods, dosage is adjusted to achieve a plasma polypeptide concentration of 1 -1000 ug/mL and in some methods 25-300 ug/mL. Alternatively, the antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. The half-life of an antibody can also be prolonged via fusion to a stable polypeptide or moiety, e.g., albumin or PEG.
- a stable polypeptide or moiety e.g., albumin or PEG.
- humanized antibodies show the longest half- life, followed by chimeric antibodies and nonhuman antibodies.
- the antibody can be administered in unconjugated form.
- the antibody can be administered multiple times in conjugated form.
- a relatively high dosage e.g., up to 400 mg/kg of anti P2X7 binding molecule, e.g., antibody per dose
- at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease.
- the amounts can be several logs lower (i.e. 2 to 3 logs lower) where the antibody is conjugated to a radioisotope or cytotoxic drug.
- Therapeutic agents can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal or intramuscular means for prophylactic and/or therapeutic treatment, in some methods, agents are injected directly into a particular tissue where non-functional P2X7 receptor cells have accumulated, for example intracranial injection. Intramuscular injection or intravenous infusion are preferred for administration of antibody.
- An antibody can optionally be administered in combination with other agents that are effective in treating the disorder or condition in need of treatment (e.g., prophylactic or therapeutic). Examples are agents commonly used for chemotherapy or radiotherapy in oncology. Additionally or alternatively, the antibody or agent may be administered before, during or after surgical intervention for resection or removal of tumour or tissue. Immunogens and forming an immune response
- P2X7 receptor targeted therapy is the formation of an immune response in an individual to be treated to a P2X7 receptor, especially a non-functional P2X7 receptor.
- the immunogen which is used for the purpose, is one which elicits
- the immunogen may include or consist of a peptide including a sequence of a P2X7 receptor.
- the peptide may contain at least one sequence that is capable of being presented on a major histocompatibility complex class II molecule or, that is capable of interacting with a B-cell receptor or a B-cell membrane bound-immunoglobulin.
- the peptide typically includes a sequence of a human P2X7 receptor or fragment thereof.
- PCT/AU2002/000061 A range of peptide immunogens are known and discussed in PCT/AU2002/000061 , or PCT/AU2002/001204 (or in any one of the corresponding US patents US 7,326,415, US 7,888,473, US 7,531 ,171 , US 8,080,635, US 8,399,617, US 8,709,425, US 9,663,584, or US 10,450,380), PCT/AU2008/001364 (or in any one of 5 the corresponding US patents US 8,440,186, US 9,181 ,320, US 9,944,701 or US 10,597,451 ), and PCT/AU2009/000869 (or in any one of the corresponding US patents US 8,597,643, US 9,328,155 or US 10,238,716), the contents of which are incorporated in entirety.
- Exemplary peptide immunogens within these specifications which include 0 epitopes for generating an immune response to a non-functional P2X7 receptor are described below.
- the immunisation regime involves 2 or more immunisations.
- the objective may be to develop an IgM response to immunisation.
- a second immunisation may be to develop an IgG response.
- Further immunisations may be to boost the IgG response, as discussed further below.
- the peptide may be provided in an amount of about 0.1 to 2 mg per administration, preferably about 0.25 to 1 mg, preferably about 0.5mg.
- a further administration of about 0.25 to 1 mg peptide may be applied as a boost.
- a first immunisation is performed when the circulating level of antigen binding sites that had been administered for antibody immunotherapy is substantially undetectable. In other words, circulating antibody to the relevant cancer biomarker cannot be detected in peripheral blood.
- the level of IgM production is then monitored over the following weeks. At about 4 to 5 weeks after first immunisation, the level of IgM antibody is likely to have decreased to negligible circulating levels. At this point, a second immunisation is then performed and the level of IgG production is monitored over the following weeks.
- the level of antibody produced may be 0.1 -25 mg/kg, for example from 0.1 to 10mg/kg, preferably 5mg/kg, or from 10 to 25 mg/kg, preferably 15 mg/kg and more than 10mg/kg. Whether this amount is detected in circulation will depend on whether there is existing tumour mass. Where there is existing tumour mass capable of binding to antibody formed by the humoral response, the level of antibody detected in circulation may be at the lower end of this range, or indeed outside the lower end of the range (i.e. less than 0.1 mg/kg), or otherwise substantially undetectable.
- the level of antibody formed from the humoral response may be at the higher end of this range, although in certain embodiments, in these circumstances, an amount of about 5mg/kg antibody may be sufficient. Further testing of immunity over the following months/years may be performed and boosting immunisations may be provided as required.
- boosts may depend on the patient status and response. Where scans or lack of free circulating antibody are indicative of extant tumour burden, then boosts may be performed monthly, ideally to ensure sufficient reaction of the immune system. Where the free levels of antibody in serum rise, the boosts may then be eased off and perhaps applied 6-12 monthly subject to clinical observation.
- the immune response may target a biomarker that is different to the biomarker that has been targeted by antibody immunotherapy.
- anti CD20 antibody may be used for antibody immunotherapy and a non functional P2X7 immunogen used for generating an immune response.
- a single biomarker is targeted by antibody immunotherapy and immunisation.
- a monoclonal antibody directed to one epitope on a P2X7 receptor (such as the E300 epitope) may be used for antibody immunotherapy, and an immunogen for forming an immune response that targets a different epitope (such as the E200 epitope) on P2X7 may be used for immunisation.
- a peptide immunogen for use in a method of the invention herein may have a length of 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16 ,17, 18, 19, 20, 21 , 22, 23, 24, 25 or 26 residues.
- the immunogen for forming an immune response according to a method of the invention is a peptide having a sequence of a P2X7 receptor that may or may not have Pro210 in cis conformation.
- the immunogen may be in the form of a P2X7 extracellular domain or any one or more of the P2X7 isoforms.
- the immunogen may be provided for administration in a soluble form or associated with a solid phase such as a cell membrane, bead, or other surface.
- Methods for screening peptides that can be used as an immunogen to form an immune response according to the methods of the invention herein are disclosed herein.
- One example includes the use of erythrocytes in a rosetting assay. In this assay an antibody that binds to functional receptors is used as a positive control in which rossettes are observed. A test antibody is determined not to bind to functional receptors if it fails to form rossettes. It is determined to bind to non-functional receptors if it is observed to bind to a non-functional receptor- expressing cell line, including those discussed herein.
- the peptides of the invention can be made by any number of techniques known in the art including solid phase synthesis and recombinant DNA technology.
- a carrier is a substance that may be conjugated to a peptide epitope thereby enhancing immunogenicity. Some carriers do this by binding to multiple peptides so as to provide an antigen of increased molecular weight to the host in which the immune response is to be developed.
- Preferred carriers include bacterial toxins or toxoids.
- Other suitable carriers include the N. meningitides outer membrane protein, albumin such as bovine serum albumin, synthetic peptides, heat shock proteins, KLH, Pertussis proteins, protein D from H. influenza and toxin A, B or C from C. difficile.
- the carrier is a bacterial toxin or toxoid
- diphtheria or tetanus toxoids are preferred.
- the carrier contains functional groups that can react with the peptide of the invention, or may be modified to be capable of reacting with the peptide.
- the immunogen may be administered subcutaneously, intradermally and/or intramuscularly.
- the composition for forming an immune response to a P2X7 receptor for use in the methods of the invention described herein includes an adjuvant or compound for potentiating an immune response.
- adjuvants A large number of adjuvants are known; See also Allison (1998, Dev. Biol. Stand., 92:3-11 ; incorporated herein by reference), Unkeless et al. (1998, Annu. Rev. Immunol., 6:251 -281 ), and Phillips et al. (1992, Vaccine, 10:151-158).
- Exemplary adjuvants that can be utilized in accordance with the invention include, but are not limited to, cytokines, aluminium salts (e.g., aluminium hydroxide, aluminium phosphate, etc.; Baylor et al., Vaccine, 20:S18, 2002), gel-type adjuvants (e.g., calcium phosphate, etc.); microbial adjuvants (e.g., immunomodulatory DNA sequences that include CpG motifs; endotoxins such as monophosphoryl lipid A (Ribi et al., 1986, Immunology and Immunopharmacology of bacterial endotoxins, Plenum Publ. Corp., NY, p407, 1986); exotoxins such as cholera toxin, E.
- cytokines e.g., aluminium hydroxide, aluminium phosphate, etc.; Baylor et al., Vaccine, 20:S18, 2002
- gel-type adjuvants e.g., calcium phosphate,
- Other exemplary adjuvants include some polymers (e.g., polyphosphazenes; described in U.S.
- Patent 5,500,161 Q57, saponins (e.g., QS21 , Ghochikyan et al., Vaccine, 24:2275, 2006), squalene, tetrachlorodecaoxide, CPG 7909 (Cooper et al., Vaccine, 22:3136, 2004), poly[di(carboxylatophenoxy)phosphazene] (PCCP; Payne et al., Vaccine, 16:92, 1998), interferon-g (Cao et al., Vaccine, 10:238, 1992), block copolymer P1205 (CRL1005; Katz et al., Vaccine,.
- saponins e.g., QS21 , Grochikyan et al., Vaccine, 24:2275, 2006
- squalene tetrachlorodecaoxide
- CPG 7909 Poly[di(carboxy
- IL-2 interleukin-2
- PMMA polymethyl methacrylate
- a peptide immunogen containing a sequence of a P2X7 receptor is provided on the surface of a bacteriophage for immunisation of an individual according to a method of the invention described herein.
- Another P2X7 receptor targeted therapy includes a cell-based therapy.
- the present invention provides a method of treating cancer in an individual who has not responded, or no longer responds, to chemotherapy, the method
- the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions, thereby treating cancer in the individual.
- a cell-based therapy that targets P2X7 receptor expressing cancer cells may be a CAR-T cell or other cytotoxic cell that has the capacity to bind to a P2X7 receptor expressing cancer cell.
- Chimeric antigen receptor T cells are T cells that have been genetically engineered to produce an artificial T-cell receptor (a chimeric antigen receptor).
- a chimeric antigen receptor useful in the present invention includes an antigen-recognition domain and a signalling domain, wherein the antigen-recognition domain recognises a P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- a chimeric antigen receptor comprises an extracellular and intracellular domain.
- the extracellular domain comprises a target-specific binding element otherwise referred to as an antigen binding moiety.
- the intracellular domain or otherwise the cytoplasmic domain comprises, a costimulatory signalling region and a zeta chain portion.
- the costimulatory signalling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- Costimulatory molecules are cell surface molecules other than antigens receptors or their ligands that are required for an efficient response of lymphocytes to antigen.
- spacer domain generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the cytoplasmic domain in the polypeptide chain.
- a spacer domain may comprise up to 600 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
- the spacer domain may consist of entire antibody Fc domains and additionally possess appropriate linkers that may separate one or more binding domains.
- the CAR useful in the present invention comprises a target-specific binding element otherwise referred to as an antigen recognition domain or antigen binding moiety that binds to a P2X7 receptor.
- the P2X7 receptor has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- Suitable antigen recognition domains or antigen binding moieties are described herein and include any antigen binding site or antigen binding domain described herein in single or multiple formats separated appropriately for the purpose of conformational optimisation.
- the CAR can be designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR.
- the transmembrane domain that naturally is associated with one of the domains in the CAR is used.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions of particular use in this invention may be derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CDS, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signalling domain of the CAR.
- a glycine-serine doublet provides a particularly suitable linker.
- the transmembrane domain in the CAR of the invention is the CD8 transmembrane domain.
- the transmembrane domain of the CAR of the invention comprises the CD8a hinge domain.
- the cytoplasmic domain or otherwise the intracellular signalling domain of the CAR of the invention is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signalling domain refers to the portion of a protein, which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signalling domain can be employed, in many cases it is not necessary to use the entire chain.
- intracellular signalling domain is thus meant to include any truncated portion of the intracellular signalling domain sufficient to transduce the effector function signal.
- intracellular signalling domains for use in the CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
- TCR T cell receptor
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signalling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signalling sequences) and those that act in an antigen- independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signalling sequences).
- primary cytoplasmic signalling sequences those that initiate antigen-dependent primary activation through the TCR
- secondary cytoplasmic signalling sequences those that act in an antigen- independent manner to provide a secondary or co-stimulatory signal
- Primary cytoplasmic signalling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary cytoplasmic signalling sequences that act in a stimulatory manner may contain signalling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary cytoplasmic signalling sequences examples include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CDS, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that cytoplasmic signalling molecule in the CAR of the invention comprises a cytoplasmic signalling sequence derived from CD3 zeta.
- the cytoplasmic domain of the CAR can be designed to comprise the CD3-zeta signalling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the invention.
- the cytoplasmic domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signalling region.
- the costimulatory signalling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
- Examples of such molecules include CD27, CD28, 4-IBB (CD 137), 0X40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
- LFA-1 lymphocyte function-associated antigen-1
- cytoplasmic signalling sequences within the cytoplasmic signalling portion of the CAR of the invention may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet provides a particularly suitable linker.
- the cytoplasmic domain is designed to comprise the signalling domain of CD3-zeta and the signalling domain of CD28. In another embodiment, the cytoplasmic domain is designed to comprise the signalling domain of CD3-zeta and the signalling domain of 4-IBB. In yet another embodiment, the cytoplasmic domain is designed to comprise the signalling domain of CD3-zeta and the signalling domain of CD28 and 4-1 BB. In one embodiment, the cytoplasmic domain in the CAR of the invention is designed to comprise the signalling domain of 4-1 BB and the signalling domain of CD3-zeta.
- CAR-T cells useful in the present invention includes those described in PCT/AU2016/050851 (or in corresponding US publication 2019-0365805) the entire contents of which are incorporated by reference in their entirety.
- interfering RNA that reduce the level of P2X7 receptor on the surface of a cancer cell.
- the interfering RNA per se does not need to be specific for a P2X7 receptor that has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the interfering RNA may reduce total P2X7 receptor levels in a cell, and be targeted to a cell expressing P2X7 receptor that has an impaired response to ATP such that it is unable to form an apoptotic pore under normal physiological conditions.
- the interfering RNA may be targeted to cancer cells using any method known in the art.
- RNA molecules are described in Gilbert et al. Oncogene. 2019 Jan; 38(2): 194-208, the entire contents of which are incorporated by reference.
- siRNA target sequences include siRNA
- Pre-neoplastic, neoplastic and metastatic diseases are particular examples to which the methods of the invention may be applied.
- Broad examples include breast tumours, colorectal tumours, adenocarcinomas, mesothelioma, bladder tumours, prostate tumours, germ cell tumour, hepatoma/cholongio, carcinoma, neuroendocrine tumours, pituitary neoplasm, small round cell tumour, squamous cell cancer, melanoma, atypical fibroxanthoma, seminomas, nonseminomas, stromal leydig cell tumours, Sertoli cell tumours, skin tumours, kidney tumours, testicular tumours, brain tumours, ovarian tumours, stomach tumours, oral tumours, bladder tumours, bone tumours, cervical tumours, esophageal tumours, laryngeal tumours, liver tumours, lung tumours, vaginal tumours and Wilm's tumour.
- cancers include but are not limited to adenocarcinoma, adenoma, adenofibroma, adenolymphoma, adontoma, AIDS related cancers, acoustic neuroma, acute lymphocytic leukemia, acute myeloid leukemia, adenocystic carcinoma, adrenocortical cancer, agnogenic myeloid metaplasia, alopecia, alveolar soft-part sarcoma, ameloblastoma, angiokeratoma, angiolymphoid hyperplasia with eosinophilia, angioma sclerosing, angiomatosis, apudoma, anal cancer, angiosarcoma, aplastic anaemia, astrocytoma, ataxia-telangiectasia, basal cell carcinoma (skin), bladder cancer, bone cancers, bowel cancer, brain stem glioma, brain and
- b-cell mixed cell, null-cell, t-cell, t-cell chronic, htlv-ii-associated, lymphangiosarcoma, lymphocytic acute, lymphocytic chronic, mast-cell and myeloid), leukosarcoma, leydig cell tumour, liposarcoma, leiomyoma, leiomyosarcoma, lymphangioma, lymphangiocytoma, lymphagioma, lymphagiomyoma, lymphangiosarcoma, male breast cancer, malignant- rhabdoid-tumour-of-kidney, medulloblastoma, melanoma, Merkel cell cancer, mesothelioma, metastatic cancer, mouth cancer, multiple endocrine neoplasia, mycosis fungoides, myelodysplastic syndromes, myeloma, myeloproliferative disorders, malignant carcinoid syndrome carcinoid heart disease,
- ocular cancers oesophageal cancer, oral cavity cancer, oropharynx cancer, osteosarcoma, ostomy ovarian cancer, pancreas cancer, paranasal cancer, parathyroid cancer, parotid gland cancer, penile cancer, peripheral- neuroectodermal-tumours, pituitary cancer, polycythemia vera, prostate cancer, osteoma, osteosarcoma, ovarian carcinoma, papilloma, paraganglioma, paraganglioma nonchromaffin, pinealoma, plasmacytoma, protooncogene, rare-cancers-and-associated- disorders, renal cell carcinoma, retinoblastoma, rhabdomyosarcoma, Rothmund-Thomson syndrome, reticuloendotheliosis, rhabdomyoma, salivary gland cancer, sarcoma, schwannoma
- the cancer may be one selected from the group consisting of brain cancer, oesophageal cancer, mouth cancer, tongue cancer, thyroid cancer, lung cancer, stomach cancer, pancreatic cancer, kidney cancer, colon cancer, rectal cancer, prostate cancer, bladder cancer, cervical cancer, epithelial cell cancers, skin cancer, leukaemia, lymphoma, myeloma, breast cancer, ovarian cancer, endometrial cancer and testicular cancer.
- the cancer may be one selected from the group consisting of; lung cancer, oesophageal cancer, stomach cancer, colon cancer, prostate cancer, bladder cancer, cervical cancer, vaginal cancers, epithelial cell cancers, skin cancer, blood-related cancers, breast cancer, endometrial cancer, uterine cancer, cervix, cancer and testicular cancer.
- the cancer may be metastatic.
- the cancer may be stage III cancer.
- the cancer may be stage IV cancer.
- an antigen binding site in the form of an immunoglobulin variable domain, antibody, dAb, Fab, Fd, Fv, F(ab’)2, scFv or CDR reactive with a P2X7 receptor, preferably a non-functional P2X7 receptor;
- HNYTTRNIL SEQ ID NO: 2
- GHNYTTRNIL SEQ ID NO: 3
- DFPGHNYTTRNIL SEQ ID NO: 4
- GHNYTTRNILPGLNITC SEQ ID NO: 5
- KTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFD SEQ ID NO: 7
- AKYYKENNVEK (SEQ ID NO: 10)
- the experimental data described below has identified that chemotherapy or radiotherapy increases the level of P2X7 receptors that cannot form an apoptotic pore on live cells. Further, the data shows an increased level of P2X7 receptors that cannot form an apoptotic pore on cells that have developed complete or partial resistance to chemotherapy.
- These findings are independent of the type of chemotherapy as chemotherapeutics of distinct structural classes that have distinct mechanisms of action, all result in increased level of P2X7 receptors that cannot form an apoptotic pore. Further, the findings apply to a wide variety of cancers irrespective of tissue origin (e.g. blood borne or solid). Lastly, the experimental data shows that this increased level driven by chemotherapy occurs in both cell lines and primary cells derived from patient samples. The cancer cells pre-treated with chemotherapy, which therefore have an increased level of P2X7 receptors that cannot form an apoptotic pore, are sensitive to various interventions that target the P2X7 receptor.
- Figure 1 A shows that the myeloma cell line, RPMI-8226, is able to open the P2X7 pore in response to 0.5mM BzATP whilst the neuroblastoma cell line Kelly is not.
- RPMI-8226 and Kelly cell lines were selected as representative models of blood born cancer (myeloma) and solid tumour (Neuroblastoma).
- Figure 1 B, C and D shows the effect of increasing dose of chemotherapy (doxorubicin and 5Fu) on RPMI-8226 and Kelly cells as measured using CellTitre-Blue (CTB) assay. These data were used to select the concentration of chemotherapy used in Figure 2.
- chemotherapy doxorubicin and 5Fu
- Doxorubicin also known as Adriamycin belongs to the family of anthracycline. It’s mechanism of action is mediated by the blocking of topo isomerase 2 which results in inhibition of DNA replication, cell proliferation and ultimately cell death as observed in Figure 1 B and C.
- 5Fu also known as Fluorouracil is a chemotherapy which mechanism of action is mainly mediated by the inhibition of thymidylate synthase that in turn blocks synthesis of the pyrimidine thymidine, a nucleoside necessary for DNA replication. This result in the inhibition of cell proliferation and ultimately cell death as observed in Figure 1 D.
- Doxorubicin and 5Fu chemotherapy were selected for their distinct mode of action.
- 500,000 cells were seeded in a 6 well plate and allowed to adhere over-night. Cells were then treated with increasing amount of chemotherapy or vehicle control for 72 hours to induce varying amount of cell killing. The remaining live cells were dissociated in PBS based enzyme-free dissociation buffer, washed and re-suspended in staining buffer (PBS, 2% FCS). Cells were then stained for 1 h with primary antibody raised against non-functional P2X7 (here 2-2-1 hFc), washed 3 times in staining buffer prior to a 1 h incubation with fluorescently coupled secondary antibody and 7AAD. Fluorescence staining on live cells was acquired using a BD Accuri flow cytometer and analysed with FlowJo-flow cytometry analysis software. Median fluorescence intensity of the live cell population was analysed using 7AAD live dead staining.
- Figure 2 A to C shows that increasing amount of chemotherapy (doxorubicin and 5Fu) on RPMI-8226 and Kelly cells leads to increased nfPX7 antibody binding (here 2-2- 1 hFc) in a dose dependent manner.
- chemotherapy doxorubicin and 5Fu
- nfPX7 antibody binding here 2-2- 1 hFc
- cancer cell lines with either functional P2X7 (RPMI-8226) or non-functional P2X7 (Kelly) show increased nfP2X7 antibody binding in response to various chemotherapy treatment (doxorubicin, 5Fu, cisplatin, etc).
- A2780 parental cells, A2780 cells with acquired resistance to doxorubicin and A2780 cells with acquired resistance to cisplatin were cultured were obtained from ECACC repository (References: Proc Amer Assoc Cancer Res 1984;25:336; Semin Oncol 1984; 11 :285; Cancer Res 1987;47:414; Cancer Res 1988;48:5713).
- Figure 3 shows a change in nfP2X7 antibody (here BPM09) binding to live ovarian A2780 parental cells and A2780 cells which have acquired resistance to Doxorubicin and Cisplatin. Data show that ovarian cancer cells that have acquired chemoresistance to doxorubicin and cisplatin have increased nfP2X7 antibody binding compared to parental A2780 cells.
- Dako liquid DAB was used as chromagen (5 minutes) and Haematoxylin (5 seconds) as counterstain. Slides were examined using a 20x objective. Intensity of the membranous staining has been scored by a pathologist. Results
- BPM09 membrane staining was scored after immunohistochemistry in a set of patient derived xenograft (PDX) models which were previously treated or not with chemotherapy and/or radiotherapy.
- the PDX model treated included in the study were colorectal cancer (16 samples), Testicular cancer (2 samples), Sarcoma (4 samples), Melanoma cancer (3 samples), Bladder cancer (1 sample), pancreatic cancer (2 samples), small cell lung cancer (1 sample), non-small cell lung cancer (2 samples), Ovarian cancer (1 sample), Uterine Cervix cancer (2 samples) and Breast cancer (6 samples).
- Various chemotherapy regimen were used including the following chemotherapy as single therapy or in combination: 5FU, Folinic acid, Bleomycin, Etoposide, Cisplatin, Capecitabin, Oxaliplatin, dacarbazine, Cyclophosphamide, Vincristine, Doxorubicin, Irinotecan, Gemcitabine, Mitomycin-C, Gemcitabine, Carboplatin, Paclitaxel, pemetrexed, hydroxyethyl-chloroethyl nitrosourea (FleCNU), Tamoxifen, Methotrexat, Epirubicin, Vindesine, Erlotinib, Bevacizumab, Cetuximab and Radiotherapy.
- 5FU Folinic acid
- Bleomycin Etoposide
- Cisplatin Capecitabin
- Oxaliplatin dacarbazine
- Cyclophosphamide Cyclophosphamide
- Vincristine Doxorubicin
- Irinotecan Gem
- Figure 4 shows that patient derived xenograft previously treated with chemotherapy and/or radiotherapy (multiple chemotherapy regiment and other treatments such as radiotherapy were pooled in this analysis) have increased nfP2X7 antibody binding (here BPM09).
- Cancer cells pre-treated with chemotherapy are sensitive to targeting of nfP2X7 Materials and methods
- Kelly cells untreated or treated for 72 hours with 4uM 5-FU were seeded at 50,000 cells per well in black clear bottom 96 well plate and allowed to attach overnight. Cells were then loaded with 6.6ug/ml Calcein in pre-warmed media for 30 minutes. After loading, cells were washed 3 times with serum free RPMI 1640 and then 5ul mouse serum from mice immunised with PBS or BIL06v was added in 50ul serum free RPMI 1640 per well (sera from 4 PBS immunised mice and 16 mice BIL06v immunised mice in individual wells). Cells were incubated on ice for 30 minutes.
- nfP2X7 antibodies here polyclonal mouse antibody
- Figure 6b describes data showing that P2X7 inhibitor (A 740003 - N-[1 - [[(Cyanoamino)(5-quinolinylamino)methylene]amino]-2,2-dimethylpropyl]-3,4- dimethoxybenzeneacetamide, Cat. No. 3701 , Tocris) does not block the conditioned media induced nfP2X7 induction. This shows that, surprisingly, ATP mediated activation of P2X7 receptor is not mediating the chemotherapy effect.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Developmental Biology & Embryology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Inorganic Chemistry (AREA)
- Endocrinology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/618,849 US20220251187A1 (en) | 2019-07-26 | 2020-07-24 | P2x7 receptor targeted therapy |
| EP20754010.5A EP4003531A1 (en) | 2019-07-26 | 2020-07-24 | P2x7 receptor targeted therapy |
| MX2021015593A MX2021015593A (es) | 2019-07-26 | 2020-07-24 | Métodos de tratamiento. |
| CA3143419A CA3143419A1 (en) | 2019-07-26 | 2020-07-24 | P2x7 receptor targeted therapy |
| AU2020319701A AU2020319701A1 (en) | 2019-07-26 | 2020-07-24 | P2X7 receptor targeted therapy |
| JP2022505386A JP7853205B2 (ja) | 2019-07-26 | 2020-07-24 | P2x7受容体の標的療法 |
| BR112022000142A BR112022000142A2 (pt) | 2019-07-26 | 2020-07-24 | Métodos de tratamento |
| CN202080053631.3A CN114173811A (zh) | 2019-07-26 | 2020-07-24 | P2x7受体靶向治疗 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2019902672A AU2019902672A0 (en) | 2019-07-26 | Methods of treatment | |
| AU2019902672 | 2019-07-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021019222A1 true WO2021019222A1 (en) | 2021-02-04 |
Family
ID=72039614
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2020/051791 Ceased WO2021019222A1 (en) | 2019-07-26 | 2020-07-24 | P2x7 receptor targeted therapy |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20220251187A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4003531A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7853205B2 (cg-RX-API-DMAC7.html) |
| CN (1) | CN114173811A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020319701A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022000142A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3143419A1 (cg-RX-API-DMAC7.html) |
| MX (1) | MX2021015593A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021019222A1 (cg-RX-API-DMAC7.html) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113759131A (zh) * | 2021-09-28 | 2021-12-07 | 嘉兴蔚康科技有限公司 | 一种靶标蛋白组合在检测视网膜黄斑病变中的应用 |
| US12121539B2 (en) | 2015-09-11 | 2024-10-22 | Biosceptre (Aust) Pty Ltd | Chimeric antigen receptors and uses thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN117771376B (zh) * | 2024-02-26 | 2024-05-03 | 四川大学华西第二医院 | 一类化合物在注意缺陷与多动障碍中的应用及产品 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110229411A1 (en) * | 2008-11-27 | 2011-09-22 | Institut Gustave Roussy | Use of p2x7 pathway for assessing the sensitivity of a subject to a cancer treatment |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP4384852B2 (ja) * | 2001-01-17 | 2009-12-16 | イントリート ピーティーワイ リミテッド | 非機能性p2x7レセプター抗体、癌及びその他の容態の診断及び処置 |
| CN100497386C (zh) | 2001-09-03 | 2009-06-10 | 因特里特有限公司 | 非功能性p2x7受体的抗体及其应用 |
| ES2619681T3 (es) * | 2007-09-14 | 2017-06-26 | Biosceptre (Aust) Pty Ltd | Novedosos epítopos P2X7 |
| EP2467404B1 (en) * | 2009-08-20 | 2015-09-30 | Biosceptre International Limited | Anti p2x7 receptor antibodies and fragments thereof |
| WO2011075789A1 (en) * | 2009-12-24 | 2011-06-30 | Biosceptre International Limited | Antibodies to non-functional oligomeric p2x7 receptors |
| MX349321B (es) * | 2011-07-01 | 2017-07-21 | Biosceptre (Aust) Pty Ltd | Terapia combinada. |
| US12121539B2 (en) | 2015-09-11 | 2024-10-22 | Biosceptre (Aust) Pty Ltd | Chimeric antigen receptors and uses thereof |
| MX2019004410A (es) * | 2016-10-21 | 2019-09-26 | Biosceptre Uk Ltd | Particulas citotoxicas. |
-
2020
- 2020-07-24 CN CN202080053631.3A patent/CN114173811A/zh active Pending
- 2020-07-24 WO PCT/GB2020/051791 patent/WO2021019222A1/en not_active Ceased
- 2020-07-24 CA CA3143419A patent/CA3143419A1/en active Pending
- 2020-07-24 JP JP2022505386A patent/JP7853205B2/ja active Active
- 2020-07-24 EP EP20754010.5A patent/EP4003531A1/en active Pending
- 2020-07-24 MX MX2021015593A patent/MX2021015593A/es unknown
- 2020-07-24 BR BR112022000142A patent/BR112022000142A2/pt unknown
- 2020-07-24 US US17/618,849 patent/US20220251187A1/en active Pending
- 2020-07-24 AU AU2020319701A patent/AU2020319701A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110229411A1 (en) * | 2008-11-27 | 2011-09-22 | Institut Gustave Roussy | Use of p2x7 pathway for assessing the sensitivity of a subject to a cancer treatment |
Non-Patent Citations (9)
| Title |
|---|
| ARNAUD-SAMPAIO VANESSA FERNANDES ET AL: "The P2X7 Receptor in the Maintenance of Cancer Stem Cells, Chemoresistance and Metastasis", STEM CELL REVIEWS AND REPORTS, SPRINGER US, NEW YORK, vol. 16, no. 2, 7 December 2019 (2019-12-07), pages 288 - 300, XP037090834, ISSN: 2629-3269, [retrieved on 20191207], DOI: 10.1007/S12015-019-09936-W * |
| DI VIRGILIO FRANCESCO ET AL: "Extracellular ATP and P2 purinergic signalling in the tumour microenvironment", NATURE REVIEWS CANCER, NATURE PUB. GROUP, LONDON, vol. 18, no. 10, 13 July 2018 (2018-07-13), pages 601 - 618, XP036599912, ISSN: 1474-175X, [retrieved on 20180713], DOI: 10.1038/S41568-018-0037-0 * |
| GILBERT SM ET AL: "ATP in the tumour microenvironment drives expression of nfP2X7, a key mediator of cancer cell survival", ONCOGENE, NATURE PUBLISHING GROUP UK, LONDON, vol. 38, no. 2, 7 August 2018 (2018-08-07), pages 194 - 208, XP036668960, ISSN: 0950-9232, [retrieved on 20180807], DOI: 10.1038/S41388-018-0426-6 * |
| NESSELHUT ET AL: "NfP2X7, a novel target for immune therapeutic approaches in cancer treatment.", JOURNAL OF CLINICAL ONCOLOGY, vol. 31, no. 15, 1 May 2013 (2013-05-01), pages 1 - 2, XP055367725 * |
| OHSHIMA Y ET AL: "gamma-Irradiation induces P2X7 receptor-dependent ATP release from B16 melanoma cells", BIOCHIMICA ET BIOPHYSICA ACTA (BBA) - GENERAL SUBJECTS, ELSEVIER, AMSTERDAM, NL, vol. 1800, no. 1, 1 January 2010 (2010-01-01), pages 40 - 46, XP026783678, ISSN: 0304-4165, [retrieved on 20091023], DOI: 10.1016/J.BBAGEN.2009.10.008 * |
| ORIOLI ET AL: "3. P2X7 receptor splice variants A and B as oncogenes and predictors of response to chemotherapy: evidence from patients and murine experimental models- Purines 2018 Basic and Translational Science on Purinergic Signaling and its Components for a Healthy and Better World", PURINERGIC SIGNALLING, 5 January 2019 (2019-01-05), pages S21 - S22, XP055740151, Retrieved from the Internet <URL:https://link.springer.com/article/10.1007/s11302-018-9637-0> [retrieved on 20201014] * |
| S.M. GILBERT ET AL: "A phase I clinical trial demonstrates that nfP2X 7 -targeted antibodies provide a novel, safe and tolerable topical therapy for basal cell carcinoma", BRITISH JOURNAL OF DERMATOLOGY, vol. 177, no. 1, 1 July 2017 (2017-07-01), UK, pages 117 - 124, XP055740141, ISSN: 0007-0963, DOI: 10.1111/bjd.15364 * |
| See also references of EP4003531A1 * |
| VANESSA FERNANDES ET AL: "5. P2X7B isoform role in chemoresistance and epithelial-to-mesenchymal transition of human neuroblastoma cells -Purines 2018 Basic and Translational Science on Purinergic Signaling and its Components for a Healthy and Better World", PURINERGIC SIGNALLING:, 5 January 2019 (2019-01-05), XP055740148, Retrieved from the Internet <URL:https://link.springer.com/article/10.1007/s11302-018-9637-0> [retrieved on 20201014] * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12121539B2 (en) | 2015-09-11 | 2024-10-22 | Biosceptre (Aust) Pty Ltd | Chimeric antigen receptors and uses thereof |
| CN113759131A (zh) * | 2021-09-28 | 2021-12-07 | 嘉兴蔚康科技有限公司 | 一种靶标蛋白组合在检测视网膜黄斑病变中的应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3143419A1 (en) | 2021-02-04 |
| JP2022541344A (ja) | 2022-09-22 |
| EP4003531A1 (en) | 2022-06-01 |
| MX2021015593A (es) | 2022-04-11 |
| AU2020319701A1 (en) | 2022-01-20 |
| CN114173811A (zh) | 2022-03-11 |
| US20220251187A1 (en) | 2022-08-11 |
| JP7853205B2 (ja) | 2026-04-28 |
| BR112022000142A2 (pt) | 2022-04-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10543262B2 (en) | Combination therapy utilizing P2X7 peptides | |
| US20250186346A1 (en) | Polymersomes comprising a soluble encapsulated antigen as well as methods of making and uses thereof | |
| EP3307322A1 (en) | Humanized anti-cd40 antibodies and uses thereof | |
| KR20220127940A (ko) | 항-pd-1 항체 및 또 다른 항암제의 조합물을 이용한 신장암의 치료 | |
| US20220251187A1 (en) | P2x7 receptor targeted therapy | |
| CN107249632A (zh) | 用于治疗癌症(骨髓瘤)的抗cs1与抗pd‑1抗体的组合 | |
| CN114450028A (zh) | Lag-3拮抗剂治疗的定量空间剖析 | |
| US20250281405A1 (en) | Polymersomes comprising a soluble encapsulated polynucleotide and an ionizable lipid as well as methods of making and uses thereof | |
| AU2022358772A1 (en) | Method of treating diseases with anti-pd-l1/il-10 fusion proteins | |
| HK40098919A (zh) | 用pd-1轴结合拮抗剂和rna疫苗诱导新表位特异性t细胞的方法 | |
| HK1195258A (en) | Combination therapy | |
| HK1195258B (en) | Combination therapy | |
| HK40060278B (zh) | Cd137激动剂抗体及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20754010 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3143419 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022000142 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2020319701 Country of ref document: AU Date of ref document: 20200724 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022505386 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020754010 Country of ref document: EP Effective date: 20220228 |
|
| ENP | Entry into the national phase |
Ref document number: 112022000142 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220104 |