WO2020182860A1 - Norovirus-like particles with improved stability - Google Patents
Norovirus-like particles with improved stability Download PDFInfo
- Publication number
- WO2020182860A1 WO2020182860A1 PCT/EP2020/056461 EP2020056461W WO2020182860A1 WO 2020182860 A1 WO2020182860 A1 WO 2020182860A1 EP 2020056461 W EP2020056461 W EP 2020056461W WO 2020182860 A1 WO2020182860 A1 WO 2020182860A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- protein
- acid sequence
- capsid protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention provides a Norovirus (NoV) genogroup I VP1 capsid protein that is capable of forming a VLP (virus-like particle).
- the invention further provides a VLP containing said capsid protein, and an immunogenic composition and a vaccine containing said capsid protein or said VLP.
- the invention further provides an immunogenic
- composition and a vaccine containing said capsid protein or said VLP and a genogroup II or genogroup IV capsid protein or VLP.
- the invention further provides the use of the composition and vaccine for the prevention or treatment of Norovirus infection in a subject, preferably a human.
- a method of preventing or treating Norovirus infection in a subject comprising administering said composition or vaccine to a subject.
- a method of increasing the stability of Norovirus genogroup I VLPs are also provided.
- Noroviruses are the leading cause of gastroenteritis outbreaks worldwide. They are responsible for 685 million cases annually including 200 million cases among children 5 years old or younger (www.cdc.gov/norovirus/worldwide.html). Up to date, there is no norovirus vaccine on the market. Also, there are no established protocols for norovirus cultivation, which significantly slows down progress with norovirus vaccine development. In addition, the rapid rate of the genetic changes of circulating noroviruses leads to new norovirus strains emerging every 2-4 years, causing epidemic outbreaks and complicating the development of vaccines and therapies that are required to counter these challenges (de Graaf, M, van Beek, J, & Koopmans, PG, 2016, Nature Rev Microbiol, 14: 421-433).
- VLPs virus-like particles
- alum-containing vaccines are generally well-tolerated, alum has long-lasting biopersistence in the body, ability to migrate in lymphoid organs and accumulate in brain, which raises concerns especially for pediatric applications (Petrovsky, N. & Aguilar, JC., 2004, Immunol. &Cell Biol., 82:488-496;
- Norovirus VLPs notably VLPs of genogroup I
- VLPs of genogroup I of improved stability and capsid proteins for such VLPs.
- bivalent or multivalent immunogenic compositions and vaccines that address the issue of compatibility and stability of Norovirus VLPs to allow formulation of vaccine compositions without the need of stabilizers like alum. Therefore, it is also an object to provide compositions comprising NoV VLPs of different genogroups having comparable or similar stability.
- protocols for purification, preparation and formulation of VLPs notably of VLPs of different genogroups such as genogroups I and II.
- a norovirus genogroup I VP1 capsid protein wherein the amino acid sequence of said protein has at the position corresponding to Arg472 in SEQ ID NO:3 an Arg or Lys residue.
- a norovirus genogroup I VP1 capsid protein having an amino acid sequence wherein the amino acid sequence stretch Ala-Ala-Leu-Leu/Val-His-Tyr (SEQ ID NO: 57) is modified to Ala-Ala-Leu-Leu/Val-Arg/Lys-Tyr (SEQ ID NO: 58), wherein Leu/Val means either Leu or Val, and Arg/Lys means either Arg or Lys.
- capsid protein according to any one of items 1 to 3, wherein said capsid protein belongs to any of the following genotypes of genogroup I: GI.1 , GI.2, GI.3, GI.4,
- capsid protein according to any one of items 1 to 4, wherein said capsid protein is capable of assembling to form norovirus-like particles (norovirus virus like particles).
- capsid protein according to any one of items 1 to 5, wherein said capsid protein has an amino acid sequence as defined in any one of SEQ ID NOs: 6 to 21 , except that the amino acid residue at the position corresponding to Arg472 in SEQ ID NO:3 is Arg or Lys; or said protein has an amino acid sequence as defined in any one of SEQ ID NOs: 3 to 5.
- the amino acid sequence of said protein consists of or comprises at least 480, preferably at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 , except that the amino acid residue at the position corresponding to Arg472 in SEQ ID NO:3 is Arg or Lys; or
- the amino acid sequence of said protein consists of or comprises at least 480, preferably at least 500 amino acid residues and has at least 80%, preferably at least 85%, more preferably at least 90% sequence identity over this length to a sequence segment of at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 ; or (iii) the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30 deletions, substitutions, additions or insertions compared to a sequence segment of at least 480, preferably at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 ;
- amino acid residue at the position corresponding to Arg472 in SEQ ID NO:3 is Arg or Lys.
- amino acid sequence of said protein comprises at least 510, preferably at least 520, more preferably at least 530, and most preferably at least 540 amino acid residues.
- the amino acid sequence of said protein consists of or comprises the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4, or 5; or
- the amino acid sequence of said protein has at least 80 %, preferably at least 85%, more preferably at least 90% sequence identity to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO: 3, 4, or 5; or
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30 deletions, substitutions, additions or insertions compared to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO: 3, 4, or 5;
- amino acid at the position corresponding to Arg472 in SEQ ID NO:3, or at the position corresponding to His472 in SEQ ID NO:2, is Arg or Lys.
- amino acid sequence of said protein consists of or comprises the amino acid sequence of SEQ ID NO: 3, 4, or 5; or
- the amino acid sequence of said protein has at least 80 %, preferably at least 85%, more preferably at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 3, 4, or 5; or
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30 deletions, substitutions, additions or insertions compared to the amino acid sequence of SEQ ID NO: 3, 4, or 5;
- amino acid at the position corresponding to Arg472 in SEQ ID NO:3, or at the position corresponding to His472 in SEQ ID NO:2, is Arg or Lys.
- said protein (i’) comprising a polypeptide of an amino acid sequence comprising the amino acid sequence from residue 43 to residue 540 of SEQ ID NO: 3, 4, or 5; or
- (ii’”) comprising a polypeptide of an amino acid sequence that has at least 80 %, preferably at least 85%, more preferably at least 90% sequence identity to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO: 3, 4, or 5; or
- (iii’”) comprising a polypeptide of an amino acid sequence that has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30 deletions, substitutions, additions or insertions compared to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO: 3, 4, or 5;
- amino acid at the position corresponding to Arg472 in SEQ ID NO:3, or at the position corresponding to His472 in SEQ ID NO:2, is Arg or Lys.
- VLP Virus-like particle
- VLP of item 14 where said VLP comprises at least 60, preferably at least 90, more preferably about 180 molecules of said protein.
- An immunogenic composition comprising the capsid protein as defined in any one of items 1 to 12 or the VLP of item 14 or 15 and optionally a pharmaceutically acceptable carrier.
- the immunogenic composition according to item 16 further comprising a Norovirus genogroup II VP1 capsid protein, or a VLP consisting of or comprising a genogroup II VP1 capsid protein.
- a vaccine against norovirus infection comprising the immunogenic composition of item 16 or 17.
- a vaccine against norovirus infection comprising the capsid protein as defined in any one of items 1 to 12 or the VLP of items 14 or 15. 20.
- the vaccine according to item 20 comprising genogroup I VP1 capsid protein and said genogroup II VP1 capsid protein in a mass ratio of from 5:1 to 1 :5, preferably from 3:1 to 1 :3, more preferably from 2:1 to 1 :2.
- a method of preventing or treating Norovirus infection in a subject comprising administering to said subject the capsid protein as defined in any one of items 1 to 12, or the VLP of item 14 or 15, or the vaccine according to any one of items 18 to 22 one or more times.
- a method of increasing the stability of Norovirus genogroup I VLPs comprising replacing the His residue in the sequence stretch Ala-Ala-Leu-Leu/Val-His-Tyr (SEQ ID NO: 57) in the P domain of a genogroup I VP1 capsid protein to Arg or Lys.
- a method of producing Norovirus genogroup I VLPs comprising expressing the capsid protein defined in any one of items 1 to 12 from a nucleic acid molecule encoding the capsid protein, and allowing the expressed capsid protein to assemble to form VLPs.
- NoV norovirus
- NoV norovirus
- the inventors have found a way to increase the stability of NoV genogroup I VLPs by modifying the amino acid sequence of genogroup I VP1 capsid protein.
- the modified VP1 capsid protein is the capsid protein or antigen of the invention.
- VLPs formed from the VP1 protein of the invention have improved stability.
- the improved stability is demonstrated in Example 3 and by the results reported in Figs. 9 and 10.
- Fig. 9 shows improved homogeneity and purity of the VLP of the invention by size-exclusion chromatography.
- Fig. 10 shows an improved stability trend and purity of the capsid protein of the invention (B) compared to the original capsid protein (A).
- compositions or vaccines are prepared that contain both genogroup I and genogroup II or IV VLPs
- the stability of the genogroup I VLPs and the genogroup II or IV VLPs can be made more similar, whereby the compositions containing both types of VLPs are also more stable, which increases storage time and allows use of less harsh storage conditions (e.g. fridge temperature instead of freezing temperature) during storage and delivery of the vaccine of the invention.
- Figure 1 Alignment of Norovirus capsid protein VP1 from different strains of genogroup I Noroviruses.
- the (S/A/T/V)TA(V/A/T/L)ATA motif and the conserved histidine residue of genogroup I sequences are indicated by a box.
- Fig. 1 A shows a Norovirus Gl alignment of the N-terminal part of VP1 proteins.
- Fig. 1 B shows the Norovirus Gl alignment of the C-terminal part of VP1 proteins.
- the sequences shown are partial sequences of complete VP1 amino acid sequences given in section“Amino Acid Sequences” below and in the electronic sequence listing.
- Figure 2 Alignment of the N-terminal part of the Norovirus capsid protein VP1 from different strains of genogroup I, II and IV. Sequences of the different genogroups are separated by a horizontal line. The (S/A/T/V)TA(V/A/T/L)ATA motif of genogroup I and the corresponding region in the genogroup II and IV sequences is indicated by a box. The sequences shown are partial sequences of complete VP1 amino acid sequences given in section“Amino Acid Sequences” below and in the electronic sequence listing.
- FIG. 3 Panel A shows a slab through the structure of a Gl Norovirus-like particle (PDB:1 IHM; white: protruding domain; grey: shell domain; black: inner surface).
- Panel B shows only the inner surface of the VLP (PDB: 1 IHM amino acid residues 29-45).
- Panel C depicts a section of Panel B illustrating the configuration of the two conserved threonine residues of the genogroup I (S/A/T/V)TA(V/A T/L)ATA motif at the inner surface of the VLP. Substitution of the two threonine residues with lysine and aspartic acid residues at the inner surface of the VLP can lead to formation of stabilizing ionic interactions or salt bridges.
- Figure 4 Alignment of the C-terminal part of the Norovirus capsid protein VP1 from different strains of genogroup I, II and IV. Sequences of the different genogroups are separated by a horizontal line. The conserved histidine residue of genogroup I and the conserved arginine residue in genogroups II and IV sequences are indicated by a box. The sequences shown are partial sequences of complete VP1 amino acid sequences given in section“Amino Acid Sequences” below and in the electronic sequence listing.
- Figure 5 Structure of a section of the protruding (upper part) and shell domain (lower part) of a genogroup I VP1 (PDB: 11HM) and theoretical structure of the same region of a genogroup II VP1.
- the conserved histidine residue in genogroup I and the conserved arginine residue in genogroup II are indicated by an arrow.
- the arginine residue in genogroup II VP1 can participate in ionic interaction or formation of salt bridges between the protruding and shell domain and, thereby, be responsible for the better assembly and stability of genogroup II VP1 -based virus-like particles.
- Figure 6 Cloning schemes for Norovirus GI.4 Chiba VP1 wild-type, NC and NCHR (Fig. 6A) and NCHRKD and NCHRDK (Fig. 6B). Sequence modules for Norovirus GI.4 Chiba VP1 are cloned in a TMV-based viral binary expression vector using the Type IIS enzyme Bsal. Amino acid sequence ranges encoded by the modules are indicated.
- Figure 7 Expression of wild-type and mutant versions of GI.4 Chiba 407 VP1 in Nicotiana benthamiana using magnICON®. Laemmli total protein extracts were separated on a 12% polyacrylamide gel and Coomassie stained afterwards (M: size marker; 0:
- Figure 8 Transmission electron micrograph of two independent VLP batches each prepared using GI.4 Chiba 407 VP1 wild-type, NC or NCHR version. Transmission electron microscopy of UranyLess stained VLP samples prepared from GI.4 Chiba 407 VP1 A) wild- type, B) NC and C) NCHR version. The bar in the lower right of the images represents 500 nm.
- Figure 9 SE-HPLC of VLP derived from GI.4 Chiba 407 VP1 NC and NCHR version. Size-Exclusion-High-Performance Liquid Chromatography to analyze formation of VLP in samples prepared from GI.4 Chiba 407 VP1 A) NC and B) NCHR version. The black arrow indicates the second, smaller VLP species in the GI.4 Chiba 407 VP1 NC sample.
- Figure 10 Stability of GI.4 Chiba 407 NC and NCHR version. Stability trend of GI.4 Chiba 407 A) NC and B) NCHR version as indicated by VLP content in % (measured using SE-HPLC) and VP1 purity in % (measured using capillary gel electrophoresis).
- Figure 11 Comparison of immunogenicity of GI.4 Chiba 407 NC and NCHR version.
- Noroviruses are non-enveloped single-stranded positive-sense RNA viruses. They belong to the family Calciviridae.
- the norovirus genome consists of three open reading frames (ORFs).
- ORF1 encodes the nonstructural proteins that are essential for virus replication
- ORF2 and ORF3 encode a major capsid protein VP1 and a minor structural protein VP2, respectively.
- VP1 self-assembles into virus-like particles (VLPs) that are morphologically and antigenically similar to native virions. Because NoVs are non- cultivatable in cell culture, much of the understanding of the biology of human NoVs has come from studies using VLPs.
- Genotypes are classified and referred to by Arabic numbers, frequently following the indication of the genogroup in Roman numbers.
- noroviruses are Norwalk virus (GenBank: AF093797.1 ), GI.1 strain Aichi/ 24-89/JP (GenBank: BAA834130), GI.2 strain Funabashi258/96/JP (GenBank: BAC05516), Maryland virus (MV, AY032605), GI.3 strain Shimizu/KK2866/JP (GenBank: AII73765), GI.4 strain Chiba407/87/JP (GenBank: BAA82106), GI.7 strain TCH-060/USA/2003 (GenBank: AEQ77282), GII.3 strain Kashiwa336/00/JP (GenBank: AAZ66774), GII.4 strain NL/2014/GII.4/Groningen01 (GeneBank: CRL46961 ), GII.4 strain Sydney/NSW0514/2012 /AU (GenBank: AFV08795), GII.4 strain Aomori2/
- VP1 capsid protein A key structural component of norovirus particles is the VP1 capsid protein.
- Another capsid protein is VP2 that is, however, not required for assembly of viral particles or VLPs.
- the size of the NoV particle varies between 23 and 40 nm in diameter. Depending on the size, the number of VP1 molecules per viral particle is generally either 60 or 180 molecules (http://viralzone.expasy.org/194).
- VLPs virus-like particles
- VP1 alone in the absence of VP2
- VLPs comprise VP1 protein molecules and may further comprise VP2 protein molecules.
- the VLPs of the invention comprise VP1 capsid protein molecules but no VP2 protein molecules.
- the NoV capsid protein VP1 has two domains, the shell (S) domain formed by, in the case of the Norwalk virus capsid protein (SEQ ID NO: 10), amino acid residues 1-225 and the protruding (P) domain formed of residues 225-530 (Choi et a!., PNAS 105 (2008) 9175-9180), see also Fig. 3.
- S domain is involved in the formation of the icosahedral shell of the NoV capsid
- the P domain is involved in dimeric contacts of the VP1 protein.
- the dimers of the P domain project out from the icosahedral shell.
- the P domain is further subdivided into the P1 and P2 sub-domains.
- Amino acid residues 225-278 and 406-519 of the Norwalk virus VP1 capsid protein form the P1 sub-domain, and residues 279-405 form the distal P2 sub-domain (Choi et al., ibid.).
- residues 1 -224 constitute the S domain
- residues 224-540 constitute the P domain
- residues 224-277 and 414-531 constitute the P1 domain
- residues 278-413 constitute P2 domain.
- the S, P, P1 and P2 domains of other genogroup I VP1 proteins such as those of SEQ ID NOs: 6 to 21 can be determined by sequence alignment to find the corresponding primary sequence segments that form the domains mentioned.
- the inventors have found variants of NoV genogroup I VP1 proteins that can assemble to VLPs of improved stability.
- the invention thus provides NoV genogroup I VP1 proteins. These VP1 proteins can assemble to, or can be assembled to, more stable VLPs.
- the genogroup I VP1 protein of the invention has an Arg or Lys residue, preferably an Arg residue, at the position of a histidine residue that is highly conserved among genogroup I VP1 proteins. This position is position 474 in SEQ ID NO:1 or position 472 in SEQ ID NO:2 or 3. The corresponding position can be identified in other genogroup I VP1 proteins by alignment of an amino acid sequence of at least 500 amino acids to SEQ ID NO:3.
- the invention provides a NoV genogroup I VP1 capsid protein, wherein the amino acid sequence of said protein has at the position corresponding to His472 of SEQ ID NO:2, or at the position corresponding to Arg472 in SEQ ID NO: 3, 4 or 5, an Arg or Lys residue, preferably an Arg residue.
- the amino acid sequence shown in SEQ ID NO: 3 is the preferred reference sequence to identify the position in the VP1 sequence at which the capsid protein of the invention has an Arg or Lys residue.
- the His amino acid corresponding to position 474 in SEQ ID NO:1 or position 472 in SEQ ID NO:2 is, in NoV genogroup I VP1 proteins, part of the sequence stretch Ala-Ala-Leu- Leu/Val-His- (SEQ ID NO: 61 ), preferably Ala-Ala-Leu-LeuA/al-His-Tyr (SEQ ID NO: 57).
- This sequence stretch is present in the P domain of the VP1 protein, preferably the P1 sub-domain of the VP1 protein.
- the NoV genogroup I VP1 capsid protein of the invention may be defined as follows.
- It has an amino acid sequence wherein the amino acid sequence stretch in the P domain, preferably the P1 domain, Ala-Ala-Leu-Leu/Val-His-Tyr (SEQ ID NO: 57) is modified to Ala-Ala-Leu-Leu/Val-Arg/Lys-Tyr (SEQ ID NO: 58), wherein Leu/Val means either Leu or Val, and Arg-/Lys means Arg or Lys.
- the amino acid sequence stretch in the P domain Ala-Ala-Leu-Leu/Val-His-Tyr-Val/Leu/lle-Asp (SEQ ID NO: 59) is modified to Ala-Ala-Leu-Leu/Val-Arg/Lys-Tyr-Val/Leu/lle-Asp (SEQ ID NO: 60), wherein Val/Leu/lle means either Val or Leu or lie.
- the amino acid sequence of said protein preferably comprises at least 510, preferably at least 520, more preferably at least 530 amino acid residues.
- the VP1 capsid protein of the invention is a NoV genogroup I protein.
- the classification of norovirus is based on the VP1 protein (Hansman et al., Journal of General Virology (2006), 87, 909-919).
- the established classification of NoV can be used for determining whether a given NoV VP1 capsid protein is a genogroup I capsid protein.
- Embodiments of the VP1 capsid protein of the invention are as follows:
- the amino acid sequence of said protein consists of or comprises at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 , except that the amino acid residue at the position corresponding to Arg472 in SEQ ID NO:3 is Arg or Lys; or
- the amino acid sequence of said protein consists of or comprises at least 500 amino acid residues and has at least 80 %, preferably at least 85%, more preferably at least 90% and even more preferably at least 95% sequence identity over this length to a sequence segment of at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 ; or (iii) the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30, and even more preferably from 1 to 20 deletions, substitutions, additions or insertions compared to a sequence segment of at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 6 to 21 ;
- the amino acid residue at the position corresponding to Arg472 in SEQ ID NO:3 is Arg or Lys, preferably Arg.
- the minimum number of contiguous amino acid residues is preferably 510, more preferably 520, even more preferably 530, and most preferably 540 amino acid residues.
- VP1 capsid protein of the invention is as follows:
- the amino acid sequence of said protein consists of or comprises the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4 or 5; or
- the amino acid sequence of said protein has at least 80 %, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% sequence identity to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4 or 5; or
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30, and even more preferably from 1 to 20 deletions, substitutions, additions or insertions compared to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4 or 5;
- amino acid at the position corresponding to Arg472 in SEQ ID NO:3, 4 or 5, respectively is Arg or Lys, preferably Arg.
- amino acid sequence of the VP1 capsid protein are as follows:
- amino acid sequence of said protein consists of or comprises the amino acid sequence of SEQ ID NO:3, 4 or 5;
- the amino acid sequence of said protein has at least 80 %, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% sequence identity to the amino acid sequence of SEQ ID NO:3, 4 or 5;
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30, and even more preferably from 1 to 20 deletions, substitutions, additions or insertions compared to the amino acid sequence of SEQ ID NO:3, 4 or 5; whereby in items (ii”) or (iii”) the amino acid at the position corresponding to Arg472 in SEQ ID NO:3, 4 or 5, respectively, is Arg or Lys, preferably Arg.
- the capsid protein is defined by
- (ii’”) comprising a polypeptide molecule of an amino acid sequence that has at least 80 %, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% sequence identity to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4 or 5; or
- (iii”') comprising a polypeptide molecule of an amino acid sequence that has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30, and even more preferably from 1 to 20 deletions, substitutions, additions or insertions compared to the amino acid sequence from residue 43 to residue 540 of SEQ ID NO:3, 4 or 5;
- amino acid at the position corresponding to Arg472 in SEQ ID NO:3, 4 or 5, respectively is Arg or Lys, preferably Arg.
- a VP1 protein of genogroup I according to the invention may be of any one or more of the following genotypes: 1.1 , 1.2, 1.3, 1.4, 1.5, 1.6, 1.7,
- genotypes 1.1 and 1.4 are preferred.
- SEQ ID NOs: 1 to 21 are also referred to herein as“reference sequences”.
- a “segment” or“portion” of an amino acid sequence is a partial sequence (or fragment) of contiguous amino acid residues of any given number of amino acid residues of the amino acid sequence which is referred to. The length of an amino acid sequence is measured by the number of amino acid residues it consists of including terminal residues.
- the NoV VP1 protein of the invention may be a VP1 protein of any NoV genogroup I genotpye, a fragment of such protein, a derivative of the protein or the fragment, or a protein comprising an amino acid sequence of a genogroup I NoV VP1 protein or derivative, as defined above.
- the VP1 protein may have amino acid deletions, substitutions, additions or insertions compared to the reference sequences as indicated above. Among these, deletions, substitutions, and additions are preferred. The numbers of such alterations indicated above refer to the sum of all deletions, substitutions, additions and insertions.
- the term“insertion” relates to insertions within the amino acid sequence of a reference sequence, i.e. excluding additions at the C- or N-terminal end.
- additionals means additions at the C- and/or N-terminal end of the amino acid sequence of a reference sequence.
- a deletion may be a deletion of a terminal or an internal amino acid residue of a reference sequence.
- the VP1 protein of the invention may have the length of natural genogroup I VP1 proteins or may be a fragment thereof or derivative thereof. However, the VP1 protein of the invention should be capable of assembling to form VLPs.
- a VP1 protein of the invention has, as indicated above, preferably a minimum length of 500 amino acid residues and minimum identity or similarity to natural genogroup I VP1 proteins, as also indicated above. Whether VLPs are formed can be determined by established methods such as by electron microscopy (Laue M & Bannert N.
- the invention also provides a nucleic acid molecule encoding the capsid protein of the invention.
- the nucleic acid molecule may be a vector used for expressing the protein of the invention in host cells or a host organism.
- the nucleic acid molecule may contain a nucleic acid construct that contains a nucleotide sequence encoding the protein of the invention; the nucleic acid molecule may further contain genetic elements for expressing the nucleotide sequence. Further information on the nucleic acid molecule and the construct is given below in the section on the production of the protein of the invention.
- VLPs Virus-like particles
- the invention also provides a VLP consisting of or comprising a VP1 capsid protein of the invention.
- a VLP is a particle consisting of virus structural protein(s), but does not contain viral nucleic acid.
- a VLP is a particle consisting of virus structural protein(s), but does not contain noroviral nucleic acid encoding the VP1 or the VP1 and VP2 of said VLP.
- a VLP consists of structural protein(s) VP1 or of VP1 and VP2 proteins (or any fragments or derivatives as described herein).
- the VLP of the invention comprises or consists of the VP1 capsid protein of the invention, such as those defined in any one of items (i) to (iii), items (i’) to (iii’), items (i”) to (iii”), or of items (i’”) to (iii’”) above.
- These proteins are preferably capable of forming VLPs.
- the VLP of the invention preferably comprises at least 60, preferably at least 90, more preferably about 180 VP1 protein molecules. It is not necessary that all VP1 protein molecules of the VLP of the invention are genogroup I VP1 capsid protein molecules according to the invention. It is possible that the VLP also contains other VP1 protein molecules, preferably of genogroup I.
- At least 50 %, preferably at least 70%, more preferably at least 90% of the number of VP1 protein molecules of a VLP should be VP1 capsid protein molecules according to the invention.
- all VP1 protein molecules of a VLP are VP1 capsid protein molecules according to the invention.
- the VLP of the invention comprises at least 60, preferably at least 90, more preferably about 180 VP1 capsid protein molecules according to the invention.
- the VLP may further comprise one or more VP2 protein molecules, preferably genogroup I VP2 protein molecules.
- the VP1 capsid protein of the invention can assemble spontaneously into the VLP of the invention. Expression and production of the VP1 protein of the invention and production of the VLP is further explained below.
- the invention also provides a method of increasing the stability of NoV genogroup I VLPs, comprising replacing the His residue in the sequence stretch Ala-Ala-Leu-Leu/Val-His- Tyr (SEQ ID NO: 57) in the P domain of a genogroup I VP1 capsid protein to Arg or Lys.
- the replacement is generally done by appropriate changes in a nucleic acid encoding a genogroup I VP1 protein, and expressing the modified VP1 encoding nucleic acid in a suitable expression host (further described below).
- the expressed VP1 protein is preferably assembled, in the presence or absence of further genogroup I VP1 protein of the same or a different genogroup I genotype, to the VLP of the invention.
- the invention further provides an immunogenic composition comprising one or more NoV antigens, wherein at least one NoV antigen is the genogroup I VP1 capsid protein of the invention.
- the VP1 capsid protein of the invention is also referred to herein as the “antigen of the invention”.
- the immunogenic composition is capable of generating an immune response in a mammal against the one or more NoV antigens in the composition.
- the immunogenic composition comprises as a NoV antigen, the VP1 capsid protein of the invention or, preferably, the VLP of the invention.
- the immunogenic composition may further comprise a pharmaceutically acceptable carrier and/or a vaccine adjuvant.
- the immunogenic composition may comprise two or more different NoV antigens, such as two or more VP1 proteins, in order to generate an immune response in a subject against multiple NoV antigens at the same time, such as two, three or four different NoV antigens.
- the NoV antigen(s) used in the immunogenic composition of the invention depend on the NoV or NoVs against which immunization in a subject should be achieved using the vaccine of the invention.
- noroviruses (NoVs) that cause infections in mammals evolve, the antigen(s) used in the immunogenic composition may be changed or adapted so as to cause immune response in a mammal against the NoVs considered a health risk at a given time or in a given season.
- the immunogenic composition of the invention contains at least the VP1 capsid or the VLP of the invention. Thus, it contains at least a NoV genogroup I antigen.
- the immunogenic composition may contain a second or further NoV genogroup antigen that may or may not be a genogroup I VP1 antigen of the invention; preferably a further NoV genogroup I antigen is also a genogroup I VP1 antigen of the invention.
- the immunogenic composition comprises two or more genogroup I VP1 antigens, preferably of different genotypes, wherein the two or more genogroup I VP1 antigens are genogroup I VP1 antigens of the invention.
- the immunogenic composition may further contain a NoV antigen from NoV genogroup Gil and/or GIV.
- the immunogenic composition contains additionally a NoV antigen from NoV genogroup II (Gil).
- the NoV antigens of genogroup Gil and/or GIV are preferably VP1 capsid proteins.
- the genogroup Gil and/or GIV VP1 capsid protein that may be contained in the immunogenic composition may be as follows:
- the amino acid sequence of said protein consists of or comprises at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 22 to 53; or
- the amino acid sequence of said protein consists of or comprises at least 500 amino acid residues and has at least 80%, preferably at least 85%, more preferably at least 90% sequence identity over this length to a sequence segment of at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 22 to 53; or
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30 deletions, substitutions, additions or insertions compared to a sequence segment of at least 500 contiguous amino acid residues of the amino acid sequence of any one of SEQ ID NOs: 22 to 53.
- VP1 capsid protein of the genogroup II or IV antigen are as follows: (a’) the amino acid sequence of said protein consists of or comprises the amino acid sequence of any one of SEQ ID NO: 22 to 53; or
- the amino acid sequence of said protein has at least 80 %, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% sequence identity to the amino acid sequence of any one of SEQ ID NO; 22 to 53; or
- the amino acid sequence of said protein has from 1 to 50, preferably from 1 to 40, more preferably from 1 to 30, and even more preferably from 1 to 20 deletions, substitutions, additions or insertions compared to the amino acid sequence of any one of SEQ ID NO: 22 to 53.
- genotypes of the NoV antigens to be used in the immunogenic composition of the invention there are no particular limitations.
- Preferred genotypes of genogroup I are any of the genogroup I genotypes given above, preferably genotypes 1.1 and
- An antigen of genogroup II may be an antigen of any one or more of the following genotypes: 11.1 , II.2, II.3, II.4, II.5, II.6, II.7, II.8, 11.12, 11.13, 11.14,
- An antigen of genogroup IV may be an antigen of any one or more of the following genotypes: IV.1 or IV.3.
- the antigens of other genogroups are preferably VP1 proteins.
- compositions may be mentioned:
- the composition contains at least the VP1 capsid protein of the invention as a genogroup I antigen, preferably the genogroup I antigens are the VP1 capsid proteins of the invention.
- the antigens of genogroups I and II may be those defined above with reference to SEQ ID NOs. Preferred is an embodiment, wherein the immunogenic composition contains an antigen of genotype
- the immunogenic composition contains an antigen of genotype 1.1 or 1.4 and an antigen of genotype II.4.
- the immunogenic compositions may further contain a pharmaceutically acceptable carrier or a vaccine adjuvant as further explained below.
- the immunogenic composition may, in a further embodiment, comprises two or more antigens from one NoV genogroup, preferably of genogroup II.
- the immunogenic composition may comprise, in addition to a genotype I VP1 capsid protein of the invention, two different antigens of genogroup II noroviruses, such as an antigen of a first genotype of a genogroup II norovirus and an antigen of a second genotype of a genogroup II norovirus.
- the composition may comprise an antigen (e.g. VP1 protein) of a genotype
- the composition may comprise an antigen (e.g. VP1 protein) of a genotype 11.1 NoV and an antigen (e.g. VP1 protein) of a genotype 11.17 NoV.
- the composition may comprise an antigen (e.g. VP1 protein) of a genotype II.4 NoV and an antigen (e.g. VP1 protein) of a genotype 11.17 NoV.
- genogroup II antigens may be those defined above with reference to SEQ ID NOs.
- Derivatives of an antigen as defined above are considered antigens of the genogroup and/or genotype to which the native antigen belongs. If an antigen such as a VP1 protein may, using this rule, belong to two different genogroups or genotypes, the antigen or derivative belongs to the genogroup or genotype to which the antigen or derivative is most similar in terms of amino acid sequence identity over the entire length of an amino acid sequence of a native VP1 protein such as of any one of SEQ ID NOs 1 to 56.
- the immunogenic composition of the invention preferably contains the antigens in the form of NoV VLPs.
- the immunogenic composition of this embodiment may contain the VLP of the invention defined above.
- the immunogenic composition preferably contains the VLP of the invention and a NoV VLP of genogroup II and/or of genogroup IV antigens, preferably NoV VLP of genogroup II antigens.
- the VLP of genogroup II and/or of genogroup IV antigen are preferably VP1 proteins as mentioned above and of the genotypes mentioned above.
- the immunogenic composition of the invention may contain a VLP comprising or consisting of a NoV antigen of genogroup I (that contains the VP1 capsid protein of the invention) and a VLP comprising or consisting of a NoV antigen of a second genogroup (e.g. genogroup II).
- a VLP comprising or consisting of a NoV antigen of genogroup I (that contains the VP1 capsid protein of the invention) and a VLP comprising or consisting of a NoV antigen of a second genogroup (e.g. genogroup II).
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype 11.1 ;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.4;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.6;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.2;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype 11.17;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype 11.1 ;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.4;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.6.
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype II.2;
- composition comprising a VLP consisting of or comprising an antigen of genotype
- VLP consisting of or comprising an antigen of genotype 11.17;
- the VLP consisting of or comprising an antigen of genotype I is the VLP of the invention, wherein 100% of the VP1 protein molecules of said VLP may the VP1 capsid protein of the invention.
- the immunogenic composition of the invention may comprise the genogroup I noroviral antigen (preferably VP1 protein) and the genogroup II noroviral antigen (also preferably VP1 protein) in a mass ratio range of from 1 :1 to 1 :6, preferably of from 1 :1.5 to 1 :5, more preferably of from 1 :2 to 1 :4.
- the immunogenic composition of the invention comprises the genogroup I noroviral antigen and the genogroup II noroviral antigen in a mass ratio range of from 5:1 to 1 :5, preferably of from 3:1 to 1 :3, and more preferably of from 2:1 to 1 :2, and even more preferably from 1.5:1 to 1 :1.5.
- the immunogenic composition of the invention comprises the genogroup I VP1 capsid protein of the invention and a genogroup II noroviral antigen (preferably VP1 protein) in a mass ratio range of from 5:1 to 1 :5, preferably of from 3:1 to 1 :3, and more preferably of from 2:1 to 1 :2, and even more preferably from 1.5:1 to 1 :1.5.
- the immunogenic composition of the invention comprises the VLP of the invention and a NoV genogroup II VLP in a mass ratio range of from 5:1 to 1:5, preferably of from 3:1 to 1 :3, and more preferably of from 2:1 to 1 :2, and even more preferably from 1.5:1 to 1 :1.5.
- the VLP of the invention is as defined above.
- the mass ratio may be measured e.g. by subjecting the VLPs to SDS-PAGE, staining and reading the stained intensities by a commercial reader. The measurement may be made before mixing the VLPs and subsequently mixing the desired VLPs in the desired ratio.
- VLP may be quantitated using mass spectroscopy such as MALDI-TOF.
- the immunogenic composition may further contain a suitable carrier, in desired amounts and mixing ratios.
- a suitable carrier may be water or an aqueous solution that should be at an appropriate pH such as from 6 to 8, preferably from 6.7 to 7.5.
- the aqueous solution may contain, apart from water, a buffer, a tonicity agent and/or a preservative as required.
- a liquid carrier for solid compositions, a liquid
- composition may be dried or lyophilized.
- buffers are phosphate buffer, Tris buffer, acetate buffer, and citrate buffer.
- examples of possible tonicity agents are sodium chloride, sucrose, glycerol, and trehalose.
- An example of a possible preservative is thimerosal.
- the immunogenic composition may be provided sterHe without addition of a preservative.
- the composition may be liquid or solid. If it is liquid, it may be a solution in water or an aqueous buffer. If it is solid, it may be a mixture containing the NoV genogroup I capsid protein, preferably containing the NoV VLPs of the invention.
- a preferred solid form is a lyophilized form.
- the immunogenic composition is immunogenic in that it generates an immune response against the antigen(s) contained therein if the composition is administered to a subject, such as a human.
- the composition may contain a vaccine adjuvant.
- adjuvants is aluminum hydroxide (alum) that is a generally know adjuvant for vaccines or other aluminum salts.
- alum aluminum hydroxide
- the immunogenic composition (and the vaccine) does not contain an adjuvant.
- the composition (and the vaccine) does not contain alum or another aluminum salt as adjuvant.
- the one or more antigens may be mixed preferably in or with a suitable carrier or medium.
- the carrier or medium may be water or an aqueous medium such as a solution.
- the aqueous medium may contain a buffer to control the pH and may contain physiologic saline and/or other additives. Possible additives can be, but are not limited to, sucrose, glycerol, trehalose.
- the NoV antigens may be stored in an aqueous medium until the immunogenic composition or the vaccine of the invention are produced. For longer storage times, it may be frozen or lyophilized. After production of the immunogenic composition, it may be sterilized, e.g. by sterile filtration and stored. Storage may be in liquid form or frozen. It may also be stored after lyophilization as a dry powder.
- the lyophilization of immunogenic composition and vaccines is well known in the art.
- the composition is freeze dried in the presence of agents to protect the antigen and/or adjuvant of the invention during the lyophilization process and to yield powders with desirable characteristics.
- Sugars such as sucrose, mannitol, trehalose, or lactose (present at an initial concentration of 10-200 mg/ml_) are commonly used for cryoprotection and lyoprotection of protein antigens and to yield lyophilized cake or powders with desirable characteristics. Lyophilized compositions may be more stable.
- the vaccine of the invention comprises the immunogenic composition of the invention in a form suitable for administration to a subject or in a form that can, prior to administration, be easily brought in a form suitable for administration to a subject.
- the vaccine contains the immunogenic composition in a suitable dosage form, preferably as a single or unit dose dosage form containing the amount of antigen to be administered to a subject at a single administration.
- the vaccine may be a solid formulation that can be reconstituted prior to administration by addition of a predetermined amount of water or aqueous solution, suspension or emulsion. In this way, solutions for administration e.g. by injection can be made shortly before administration.
- the vaccine may be a solid formulation for intranasal administration to a subject.
- the vaccine may be a liquid preparation, preferably an aqueous liquid formulation, for administration by injection. In the latter case, the vaccine may be an aqueous solution as a unit dosage form.
- the vaccine may comprise, apart from the immunogenic composition, one or more pharmaceutical excipients or carriers.
- Excipients may be liquid or solid. Liquid excipients include, without limitation, water, alcohol, saline, and buffered solutions. Other possible excipients include, without limitation, preservatives and other additives such as antimicrobials, anti-oxidants, chelating agents, buffer substances.
- the immunogenic composition of the invention may itself be a vaccine in the sense of the invention.
- the vaccine is an anti-NoV vaccine. It is at the same time a pharmaceutical composition.
- the vaccine is generally used for preventing or treating NoV infection in a subject, or for suppressing the severity of a NoV infection.
- the invention also provides a method of preventing or treating norovirus infection, or for suppressing the severity of a NoV infection, generally comprising administering to a subject the immunogenic composition or vaccine of the invention.
- Subjects in which NoV may be prevented or treated or in which the severity of a NoV infection may be suppressed are mammals, preferably humans. Among humans, both children and adults may be subjects for preventing or treating NoV infection. Among humans, children are preferred for achieving immunization early in life. Human subjects are considered children up to the age of 16.
- the NoV vaccine is used in children of age between 1 and 16, preferably 2 to 14, and more preferably from 3 to 12 years of age.
- the invention is not limited.
- the vaccine of the invention is preferably administered to a subject parenterally, e.g. by injection.
- the vaccine may be formulated as a liquid or as a solid for reconstitution to form a liquid.
- the parenteral administration by injection may be intravenous, intradermal, intramuscular or subcutaneous administration. Preferred are intradermal, intramuscular or subcutaneous administration, more preferably intradermal and intramuscular administration.
- the vaccine is administered intradermally.
- the vaccine is administered intramuscularly.
- the vaccine may also be administered intranasally.
- the composition or vaccine may a liquid, preferably an aqueous solution.
- the composition or vaccine for intranasal administration may in solid form, such as in a lyophilized form.
- the NoV antigen(s) is (are) administered in an amount of from 10 to 1000 pg, preferably from 30 to 300 pg, more preferably from 55 to 150 pg of NoV antigen. If the vaccine contains more than one NoV antigen, these amounts relate to the sum of the amounts of the individual NoV antigens. If the vaccine contains antigens of genogroup I and antigens of genogroup II, the amount of the genogroup II antigen(s) may be the same or higher than the genogroup I antigen(s).
- the amount of the genogroup II antigen(s) may be from 1.5 to 6 times, preferably from 2.0 to 5 times, more preferably from 2.5 to 4.5 times, and even more preferably from 3.0 to 4.0 times the amount of the genogroup I antigen(s) in terms of mass.
- the vaccine may be packaged in a single-dose or multiple dose form in a container that contains the desired amount of the vaccine suitable for administration.
- the single-dose form may comprise from 10 to 1000 pg, preferably from 30 to 300 pg, more preferably from 55 to 150 pg of NoV antigen(s). If the vaccine contains antigens of genogroup I and antigens of genogroup II, the ratios of these antigens may be as defined in the previous paragraph.
- the vaccine may be administered once or twice to a subject for improving the immunity against NoV infection. If the vaccine is be administered twice, the second administration may be made within 2 to 8 weeks, preferably within 3 to 5 weeks after the first administration of the vaccine.
- the vaccine of the invention may also contain antigens against other infectious diseases for generating immune protection not only against NoV, but also against other viruses.
- the vaccine may, for example, comprise rotavirus antigens to generate protection against NoV and rotavirus.
- the invention also provides a method of producing an immunogenic composition or vaccine against NoV infection, comprising expressing the VP1 capsid protein of the invention in an expression host, assembling the expressed VP1 capsid protein to form VLPs, and formulating the VLPs for administration to a subject.
- NoV antigens as described above can be expressed in and purified from different production hosts including mammalian cells, insect cells and plants or plant cells (for review: Herbst-Kralovetz, M., Mason, H. S. & Chen, Q. 2010, Exp. Rev. Vaccines, 9:299- 307).
- Reliable NoV antigen and NoV VLP purification protocols and modifications thereof have been described for insect cells using baculoviral expression system (Jiang, X. et al., 1992, J. Virol., 66:6527-6532; Prasad BW, Hardy D, Estes M. 2000, J. Infect. Dis.,
- EP2601970 may also be considered regarding the production of NoV VLPs.
- VLPs isolated from insect and plant cells Although there is no difference observed in the structure and immunogenic properties of VLPs isolated from insect and plant cells, a preferred system for VLP production is plant-based, as this allows avoiding baculoviral impurities in the antigen or VLPs isolated from plant tissues.
- plant-based transient expression systems unlike the baculoviral one, are easily scalable. NoV antigen genes can be successfully expressed in plants using plant virus-based expression system called magnICON® (Gleba et al., 2005, Vaccine, 23:17-18; Marillonnet et al., 2005, Nat. Biotechnol., 23:718-723;
- the capsid protein of the invention and other antigens to be included in the immunogenic composition or vaccine may be produced by known methods of protein expression in a standard expression system.
- a nucleotide sequence encoding it may be expressed in a suitable host organism. Methods usable for producing and purifying a protein of interest have been described in the prior art and any such methods may be used. If a eukaryotic expression system is used, one or more introns may be inserted in the coding sequence of the antigen.
- Particularly efficient expression methods are plant expression systems that are also known in the prior art.
- a possible way of achieving expression of a nucleotide sequence of interest encoding an antigen according to the invention in plants is the use of self- replicating (viral) replicons containing the nucleotide sequence encoding the antigen.
- Plant viral expression systems have been described in many publications, such as in
- WO2012019660, W02008028661 , W02006003018, W02005071090, W02005049839, W02006012906, W002101006, W02007137788 or WO02068664 and many more publications are cited in these documents.
- Various methods for introducing a nucleic acid molecule, such as a DNA molecule, into a plant or plant part for transient expression are known.
- Agrobacteria may be used for transfecting plants with the nucleic acid molecule (vector) or nucleic acid construct e.g. by agroinfiltration or spraying with agrobacterial suspensions.
- WO 2012019660, WO 2014187571 , or WO 2013149726 see WO 2012019660, WO 2014187571 , or WO 2013149726.
- a nucleic acid construct containing a nucleotide sequence encoding the capsid protein may encode a viral vector that can replicate in plant cells to form replicons of the viral vector.
- the viral vector and the replicons may contain an origin of replication that can be recognized by a nucleic acid polymerase present in plant cells, such as by the viral polymerase expressed from the replicon.
- RNA viral vectors referred to as“RNA replicons”
- the replicons may be formed by transcription under the control of a promoter active in plant cells, from the DNA construct after the latter has been introduced into plant cell nuclei.
- the replicons may be formed by recombination between two recombination sites flanking the sequence encoding the viral replicon in the DNA construct, e.g. as described in WOOO/17365 and WO 99/22003. If the replicon is encoded by the DNA construct, RNA replicons are preferred.
- Use of DNA and RNA viral vectors has been extensively described in the literature over the years. Some examples are the following patent publications: W02008028661 ,
- DNA viral vectors are those based on geminiviruses.
- viral vectors or replicons based on plant RNA viruses notably those based on plus-sense single-stranded RNA viruses may be preferably used.
- the viral replicon may be a plus-sense single-stranded RNA replicon.
- examples of such viral vectors are those based on tobacco mosaic virus (TMV) and potexvirus X (PVX).“Based on” means that the viral vector uses the replication system such as the replicase and/or other proteins involved in replication of these viruses.
- the capsid protein may be expressed in a multi-cellular plant or a part thereof, notably a higher plant or parts thereof. Both monocot and dicot (crop) plants can be used. Common plants usable for expressing proteins include Nicotiana tabacum and Nicotiana benthamiana. However, many others can be employed as well.
- the capsid protein may be expressed in the cytosol of cells of the plants or plant parts. In this case, no signal peptide directing the protein of interest into a particular compartment is added to the enzyme.
- the capsid protein or antigen can be expressed in or targeted into chloroplasts of the plants or be secreted into the extracellular space; in these cases, an N-terminal pre-sequence, such as a plastid transit peptide or a signal sequence for targeting to the extracellular space, is added to the N-terminal or C- terminal end, preferably the C-terminal end, of the capsid protein as the protein of interest.
- plant material containing expressed capsid protein from a plant having expressed the antigen is harvested.
- Plant material may e.g. be leaves, roots, tubers, or seeds, or a crushed, milled or comminuted product of leaves, roots, tubers, or seeds.
- the capsid protein may then be extracted from the plant material using an aqueous buffer. This may include that the plant material is homogenized and insoluble material may be removed by centrifugation or filtration. Soluble components including the capsid protein will be extracted into the aqueous buffer to produce an capsid protein solution in the aqueous buffer.
- the aqueous buffer may contain an inorganic or organic acid or salts thereof and may have a pH as defined below for the aqueous solution as a composition of the invention. Further, the aqueous buffer may contain salt and/or a sulfhydryl compound.
- the capsid protein in the obtained antigen preparation may then be further purified using standard methods of protein purification, such as chromatographic methods.
- the capsid protein being a NoV VP1 protein or derivative, can form VLPs. These VLPs generally form spontaneously in the aqueous buffer used in extraction and
- VLPs Formation of VLPs can be verified e.g. using electron microscopy.
- the two or more antigens may be expressed and purified separately and then mixed in desired ratios when preparing the composition or vaccine. It is also possible to coexpress two or more capsid protein or antigens in the same plant cells or plants and purifying the together as a mixture.
- FIG. 6 shows generation of expression vector containing GI.4 antigen coding sequence. Similar approach using type IIS restriction enzymes can be used for cloning any sequence of interest into the expression vector.
- Figures 7 shows wild type and mutant GI.4 VP1 protein expression on .
- Norovirus GI.4 Chiba 407 The sequence corresponding to the VP1 capsid protein of Norovirus GI.4 Chiba 407 (Japan, 1987) (GenBank accession no.: BAB18267, 544 amino acid residues, SEQ ID No: 1 , Fig. 1 ) was generated using gene synthesis and flanking Type IIS restriction enzyme Ssal sites were added for cloning.
- the Norovirus GI.4 Chiba 407 modules were cloned in TMV- based viral expression vectors (magnICON® system, see below) using the Type IIS restriction enzyme Bsa ⁇ which generates different, customized overhangs for each module and thereby allowing assembly of the final construct by removing these restriction sites (Engler, C., Kandzia, R. & Marillonnet, S. 2008, PLoS One, 3:e3647).
- the respective Norovirus GI.4 Chiba 407 VP1 modules were generated via PCR with flanking Type IIS restriction enzyme Bsal sites and cloned in TMV-based magnICON® viral expression vectors using these Bsal sites.
- the NC version of SEQ ID No: 2 (compared to wild-type sequence: N-terminally DMM, C-terminally ARR) was used as basis for the introduction of further mutations.
- GI.4 VLPs in comparison with GII.4 VLPs, showed lower homogeneity and also lower stability. Furthermore, for GI.4 Chiba 407 wild-type and NC version VP1 , an antigen-related high molecular weight product was co-purified and co-formulated with the VLPs in a reproducible manner. Since this behavior was not observed for GII.4 strains, a comparative sequence and structure analysis was conducted.
- the respective Norovirus GI.4 Chiba 407 VP1 NC version modules were generated via PCR with flanking Type IIS restriction enzyme Bsal sites and cloned in TMV-based magnICON® viral expression vectors using these Bsal sites resulting in the NCHR version (SEQ ID No: 3) of GI.4 Chiba 407 VP1 (compared to wild-type sequence: N-terminally DMM, H474R, C- terminally ARR).
- the inner shell domain was modified by substitution of residues to allow additional formation of shell-stabilizing salt bridges at the inner surface of the VLPs, i.e., the N-terminal STALATA motif was modified to SKALADA or SDALAKA.
- the respective Norovirus GI.4 Chiba 407 VP1 NCHR version modules were generated via PCR with flanking Type IIS restriction enzyme Bsal sites and cloned in TMV-based magnICON® viral expression vectors using these Bsal sites resulting in the NCHRKD (SEQ ID No: 4) and NCHRDK (SEQ ID No: 5) version of GI.4 Chiba 407 VP1 (compared to wild-type sequence: N-terminally DMM, T41 K/D, T45D/K, H474R, C-terminally ARR).
- Viral binary expression vectors were developed based on the magnICON® technology (Gleba, Y., Klimyuk, V. & Marillonnet, S., 2005, Vaccine, 2005, 23:2042-2048; Gleba, Y., Klimyuk, V. & Marillonnet, S. 2007, Curr. Opin. Biotechnol., 18:134-141 ) using elements from Tobamo viruses (Tobacco Mosaic Virus, TMV), i.e. from the cDNAs of two closely related plant viruses, TVCV (turnip vein clearing virus; Lartey, R.T., Lane, L.C. & Melcher, U. 1994, Arch.
- TMV Tobamo viruses
- TVCV turnip vein clearing virus
- the resulting vectors are called 'TMV- based', since both parental viruses are tobamoviruses and related to the well-known tobacco mosaic virus (TMV). All three viruses (TVCV, crTMV and TMV) are positive-strand RNA viruses and have the same overall structure and mode of replication.
- the viruses encode an RNA-dependent RNA polymerase (RdRP), the Movement Protein (MP) and the Coat Protein (CP).
- RdRP replicates the full viral RNA transcript (genomic RNA) as well as the two subgenomic RNAs (sgRNAs) that are required for expression of the two other viral proteins, MP and CP.
- the MP is required for short distance cell-to-cell movement of the viral genomic RNA within the infiltrated leaf.
- the CP is required for formation of viral particles and long distance systemic movement from leaf to leaf via the vascular system. Formation of viral particles is not required for cell-to-cell movement. Therefore, the CP was eliminated from the viral vectors and replaced with the gene of interest.
- the viral vector is unable to produce viral particles and the gene of interest is expressed at higher levels.
- the viral vector also contains the 5' and 3' non- translated (5' ntr and 3' ntr) viral sequences which are essential for replication (Marillonnet, S., Giritch, A., Gils, M. et al., 2004, Proc. Natl. Acad. Sci. U S A., 101 :6852-7).
- the cDNA of the viral vector was cloned between a plant promoter and a plant terminator (Act2 and nos) (Marillonnet, S., Giritch, A., Gils, M. et al., 2004, Proc. Natl. Acad. Sci. U S A., 101 :6852- 6857) and plant introns were added within the RdRP and MP sequences (Marillonnet, S., Thoeringer, C., Kandzia, R. et al., 2005, Nat. Biotechnol., 23:718-723).
- Agrobacterium tumefaciens for efficient delivery of TMV-based viral vectors to plant cells.
- the complete viral vector (plant promoter, TMV-based viral vector sequences with gene of interest, plant terminator) was cloned between the T-DNA left and right borders of a binary vector.
- the elements of the binary vector are a pVS1 origin (Hajdukiewicz, P., Svab, Z. & Maliga, P., 1994, Plant Mol Biol., 25:989-994) for plasmid replication in Agrobacterium, a co/E1 origin for plasmid replication in E. coli, a nptlll kanamycin antibiotic resistance gene (Frisch, D.A., Harris-Haller, L.W., Yokubaitis, N.T. et al., 1995, Plant Mol.
- the selected Agrobacterium strain harboring the TMV-based expression vector was grown in liquid LBS medium with soya peptone (Duchefa Biochemie, Haarlem, The Netherlands) replacing tryptone, and supplemented with 50 mg/mL rifampicin and 50 mg/mL kanamycin.
- Agrobacterial cultures were grown at 28°C until OD600 reaches 2 to 4.
- Infiltration solution is prepared by diluting the agrobacterial culture in infiltration buffer (10 mM MES, pH 5.5, 10 mM MgS04) to a defined cell concentration (equivalent to a 1000-fold dilution of a culture with OD6OO of 2.0).
- Leaves of Nicotiana benthamiana plants grown under controlled and standardized conditions for 6-8 weeks were infiltrated with the agrobacterial infiltration solution using a needle-less syringe and then kept in the greenhouse for approximately 7 days for expression and accumulation of the recombinant protein. Plant leaf material was then harvested, ground in liquid nitrogen to a fine powder and proteins extracted using Laemmli buffer. The protein extracts were analyzed by SDS-polyacrylamid-gel electrophoresis and proteins visualized by Coomassie staining.
- Norovirus VP1 VLPs were purified as described below.
- the five weeks old Nicotiana benthamiana plants were vacuum-infiltrated (80-100 mbar for 3-4 minutes) with diluted Agrobacterium tumefaciens cultures carrying TMV-based assembled magnICON® vectors (Gleba et al., 2005, Vaccine, 23:17-18; Marillonnet et al., 2005, Nat. Biotechnol., 23:718-723; Gleba et al., Curr. Opin. Biotechnol., 2007, 18:134-141 ; Klimyuk, V., et al., 2014, Curr. Top. Microbiol.
- the green biomass was homogenized in the presence of two volumes neutral buffer (i.e. 15 g biomass and 30 mL 100 mM Tris, 5 mM Na 2 S 2 0s pH 7.5).
- neutral buffer i.e. 15 g biomass and 30 mL 100 mM Tris, 5 mM Na 2 S 2 0s pH 7.5.
- the plant homogenate was centrifuged 20 min. at 15.000 x g.
- the resulting extract was further clarified by filtration using a Millipore® glass fiber filter (AP25). High molecular weight components were sedimented by ultracentrifugation (150.000xg for 90 min.).
- the pellet was suspended in 1 mL of 20 mM histidine, 137 mM NaCI pH 6.0 and clarified by 15.000 x g centrifugation for 20 minutes.
- the VLP containing supernatant was placed on the top of a 30% sucrose cushion (in 20 mM histidine, 137 mM NaCI pH 6.5). Ultracentrifugation was performed for 90 min. at 150.000 x g. The resulting pellet was resuspended in 20 mM histidine, 137 mM NaCI pH 6.5.
- VLPs The presence of assembled VLPs was monitored by transmission electron microscopy. TEM micrographs were taken to visualize the size, dispersity, and icosahedral morphology of purified VLPs.
- SE-HPLC Size-exclusion high performance liquid chromatography
- VLPs formation, relative content and size (molar mass and radius) of VLPs was confirmed by size-exclusion high performance liquid chromatography (SE-HPLC) with ultraviolet (UV), light scattering (LS) and refractive index (Rl) detection.
- SE-HPLC size-exclusion high performance liquid chromatography
- UV ultraviolet
- LS light scattering
- Rl refractive index
- SE-HPLC analysis was performed on an Agilent 1200 series HPLC system (Agilent Technologies GmbH, Waldbronn, Germany).
- the HPLC consisted of a G1312A binary pump, G1379B micro vacuum degasser, G1329A automatic liquid sampler, G1330B automatic liquid sampler thermostat, G13 6A thermostated column compartment and a G1314C variable wavelength detector.
- the Wyatt Technology Europe GmbH instruments miniDAWN TREOS laser photometer with a quasi-elastic light scattering dynamic light scattering module (QELS-DLS detector) and Optilab rEX refractometer were coupled in-line with the SE-HPLC system.
- QELS-DLS detector quasi-elastic light scattering dynamic light scattering module
- Optilab rEX refractometer were coupled in-line with the SE-HPLC system.
- VLPs were separated by using a TSKgel PWxl guard column (40 x 6 mm, 12 pm particle size, mixed pore size, Tosoh) together with a TSKGel G6000 PWxl analytical column (300 x 7.8 m , 13 pm particle size, >1000 A pore diameter, Tosoh Bioscience, Stuttgart, Germany) as stationary phase and 25 mM di-Sodium hydrogen phosphate/125 mM Sodium chloride/1 mM Sodium chloride (pH 7.4) as SE-HPLC eluent (mobile phase) at a flow rate of 0.8 ml/min.
- CGE Capillary gel electrophoresis
- Sample buffer for reducing conditions contained lithium dodecylsulfate, two internal standards and 3.5 % (v/v) of 1 M DTT as a reducing agent.
- 6 pi of each sample were loaded onto a chip together with and a protein ladder.
- the chip run results were displayed as a gel-like image, electropherograms and in tabular form. Peak baseline adjusting and peak integration of electropherograms were done automatically and, if necessary, manual adjusting of peak baselines was done on a case-by-case basis.
- Protein peaks for the desired product (fully VP1 coat protein) and for a product-related substance (/V-terminally truncated VP1 ) could be identified and were clearly distinguishable form product- or process-related impurities by comparing migration time in seconds or protein size in kDa, respectively.
- the H472R amino acid substitution significantly alters the VLP assembly of and improves VLP homogeneity.
- a single, highly homogenic VLP product was detected in a test batch produced in pilot scale.
- Recombinant norovirus VLPs were administered two times to BALB/c mice at weeks 0 and 3 in PBS (pH 7.3) IM. Groups were immunized with 10 pg VLP dose of GI.4 Chiba VLPs, either GI.4 Chiba NC (Group I) or GI.4 Chiba NCHR (Group II). All mice were terminated at study week 5. Humoral (antibody) immune responses were analyzed by ELISA- based assays.
- mice Female mice (Envigo, Netherlands) were shipped at ambient temperature to animal facility. Animals were acclimatized one week prior to immunizations and immunized at 7 weeks of age. Health monitoring data summary form was provided with the shipment of the mice. Animal health (clinical signs of illness) and welfare were monitored daily by the staff of the animal facility. All procedures were authorized and performed according to the guidelines of the Finnish National Animal Experiment Board. Immunization procedures
- mice were anesthetized with inhalation of isoflurane for the time of immunization and related procedures. Animals were weighted at the beginning of the study and marked with a group tattoo and individually by ear piercing. Test article was administered IM in the caudal tight muscle (50 pi volume) with 0.5 ml insulin syringe (29G*1/2"- 0.33> ⁇ 12 mm).
- mice Animal weights were recorded at the time of termination. The mice were terminated by anesthetizing mice with 1 mg/kg medetomidine (Dorbene® 1 mg/ml, Laboratorios Syva) and 75 mg/kg ketamine (Ketalar® 50 mg/ml, Pfizer) and collecting the terminal whole blood from axillary (armpit) area. Serum was separated from individually collected whole blood samples and stored at -20°C until used.
- medetomidine Dorbene® 1 mg/ml, Laboratorios Syva
- ketamine Ketalar® 50 mg/ml, Pfizer
- SEQ ID No: 1 Norovirus GI.4 Chiba 407 (Japan, 1987) capsid protein VPl wild-type sequence (GenBank acc . : BAB18267)
- SEQ ID No: 2 Norovirus GI .4 Chiba 407 (Japan, 1987) capsid protein VPl sequence with a single initiator codon and deletion of the two C-terminal arginine residues
- SEQ ID No : 3 Norovirus GI .4 Chiba 407 (Japan, 1987) capsid protein VPl sequence with a single initiator codon, deletion of the two C- terminal arginine residues and H472R mutation
- SEQ ID No: 4 Norovirus GI .4 Chiba 407 (Japan, 1987) capsid protein
- SEQ ID No: 5 Norovirus GI .4 Chiba 407 (Japan, 1987) capsid protein VPl sequence with a single initiator codon, deletion of the two C- ter inal arginine residues, and T39D, T43K, H472R mutations
- SEQ ID No: 10 gb:NP_056821GI .1 GI /Human/United States/Norwalk/1968 MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDPVAGSSTAVATAGQVNPIDPWIINNF VQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVGNMRVRIMLAGNAFTA GKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTM RLVCMLYTPLRTGGGTGDSFWAGRVMTCPSPDFNFLFLVPPTVEQKTRPFTLPNLPLSS LSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVIN LTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQ ANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNY
- SEQ ID NO: 14 gb: AEY77031
- SEQ ID NO: 15 gb: BAA82106
- SEQ ID No: 16 gb: AOO95019
- SEQ ID NO: 36 gb : AHH44895
- SEQ ID No: 40 gb: ABD77588
- SEQ ID No: 42 gb: AII73753
- NGEFTVSPRNSPG EVLLNLELGPELNPYLAHLSRMYNGYAGGVEVQVLLAGNAFTAGKLV
- SEQ ID NO: 57 Ala-Ala-Leu-Leu/Val-His-Tyr
- SEQ ID NO: 58 Ala-Ala-Leu-Leu/Val-Arg/Lys-Tyr
- SEQ ID NO: 59 Ala-Ala-Leu-Leu/Val-His-Tyr-Val/Leu/lle-Asp
- SEQ ID NO: 60 Ala-Ala-Leu-Leu/Val-Arg/Lys-Tyr-Val/Leu/lle-Asp
- SEQ ID NO: 61 Ala-Ala-Leu-Leu/Val-His
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Manufacturing Of Micro-Capsules (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3133030A CA3133030C (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
| AU2020235344A AU2020235344B2 (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
| JP2021552611A JP7536031B2 (ja) | 2019-03-12 | 2020-03-11 | 安定性が改善されたノロウイルス様粒子 |
| MX2021011059A MX2021011059A (es) | 2019-03-12 | 2020-03-11 | Particulas tipo norovirus con estabilidad mejorada. |
| IL285914A IL285914B2 (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
| CN202080020212.XA CN113557240B (zh) | 2019-03-12 | 2020-03-11 | 具有提高的稳定性的诺如病毒样颗粒 |
| EP20708137.3A EP3938378B1 (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
| ES20708137T ES2953232T3 (es) | 2019-03-12 | 2020-03-11 | Partículas similares a norovirus con estabilidad mejorada |
| KR1020217032648A KR20220021451A (ko) | 2019-03-12 | 2020-03-11 | 안정성이 향상된 노로바이러스 유사 입자 |
| US17/438,047 US20220152186A1 (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
| JP2023148763A JP7672460B2 (ja) | 2019-03-12 | 2023-09-13 | 安定性が改善されたノロウイルス様粒子 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19162266 | 2019-03-12 | ||
| EP19162266.1 | 2019-03-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020182860A1 true WO2020182860A1 (en) | 2020-09-17 |
Family
ID=65818179
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2020/056461 Ceased WO2020182860A1 (en) | 2019-03-12 | 2020-03-11 | Norovirus-like particles with improved stability |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20220152186A1 (https=) |
| EP (1) | EP3938378B1 (https=) |
| JP (2) | JP7536031B2 (https=) |
| KR (1) | KR20220021451A (https=) |
| CN (1) | CN113557240B (https=) |
| AU (1) | AU2020235344B2 (https=) |
| ES (1) | ES2953232T3 (https=) |
| IL (1) | IL285914B2 (https=) |
| MX (1) | MX2021011059A (https=) |
| WO (1) | WO2020182860A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023009977A1 (en) * | 2021-07-26 | 2023-02-02 | The University Of North Carolina At Chapel Hill | Methods and compositions for norovirus chimeric therapeutics |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2020235344B2 (en) * | 2019-03-12 | 2024-10-24 | Icon Genetics Gmbh | Norovirus-like particles with improved stability |
| CN118252924A (zh) * | 2022-12-27 | 2024-06-28 | 远大赛威信生命科学(南京)有限公司 | 用于诱发哺乳动物针对诺如病毒的免疫反应的药物组合物及其制备方法和用途 |
Citations (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999022003A1 (en) | 1997-10-24 | 1999-05-06 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2000017365A2 (en) | 1998-09-23 | 2000-03-30 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2002068664A1 (en) | 2001-02-27 | 2002-09-06 | Icon Genetics Ag | Recombinant viral switches for the control of gene expression in plants |
| WO2002088369A1 (en) | 2001-04-30 | 2002-11-07 | Icon Genetics Ag | Processes and vectors for amplification or expression of nucleic acid sequences of interest in plants |
| WO2002097080A2 (en) | 2002-04-30 | 2002-12-05 | Icon Genetics Ag | Amplification vectors based on trans-splicing |
| WO2002101006A2 (en) | 2001-06-08 | 2002-12-19 | Icon Genetics, Inc. | Production of proteins in plants |
| WO2005049839A2 (en) | 2003-11-10 | 2005-06-02 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2005071090A1 (en) | 2004-01-23 | 2005-08-04 | Icon Genetics Ag | Two-component rna virus-derived plant expression system |
| WO2006003018A2 (en) | 2004-07-07 | 2006-01-12 | Icon Genetics Ag | Biologically safe transient protein expression in plants |
| WO2006012906A1 (en) | 2003-11-10 | 2006-02-09 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2007137788A1 (en) | 2006-05-29 | 2007-12-06 | Icon Genetics Gmbh | Plant virus-based inducible expression system |
| WO2008028661A2 (en) | 2006-09-06 | 2008-03-13 | Icon Genetics Gmbh | Potexvirus- derived replicon |
| WO2012019660A1 (en) | 2010-08-07 | 2012-02-16 | Nomad Bioscience Gmbh | Process of transfecting plants |
| EP2601970A1 (en) | 2006-09-29 | 2013-06-12 | Ligocyte Pharmaceuticals, Inc. | Norovirus vaccine formulations |
| WO2013149726A1 (en) | 2012-04-03 | 2013-10-10 | Nomad Bioscience Gmbh | Agrobacterium for transient transfection of whole plants |
| WO2013192604A1 (en) | 2012-06-22 | 2013-12-27 | Takeda Vaccines (Montana), Inc. | Purification of virus like particles |
| WO2014187571A1 (en) | 2013-05-23 | 2014-11-27 | Nomad Bioscience Gmbh | Process of providing plants with abiotic stress resistance |
| EP3153578A1 (en) * | 2010-07-06 | 2017-04-12 | Novartis Ag | Norovirus derived immunogenic compositions and methods |
| WO2018170603A1 (en) * | 2017-03-23 | 2018-09-27 | Medicago Inc. | Norovirus fusion proteins and vlps comprising norovirus fusion proteins |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP5846908B2 (ja) * | 2009-05-28 | 2016-01-20 | 東洋紡株式会社 | 特性の改変されたグルコースデヒドロゲナーゼ |
| US11208441B2 (en) * | 2015-10-22 | 2021-12-28 | Protenova Co., Ltd. | Immunoglobulin-binding polypeptide |
| AU2020235344B2 (en) * | 2019-03-12 | 2024-10-24 | Icon Genetics Gmbh | Norovirus-like particles with improved stability |
-
2020
- 2020-03-11 AU AU2020235344A patent/AU2020235344B2/en active Active
- 2020-03-11 KR KR1020217032648A patent/KR20220021451A/ko not_active Ceased
- 2020-03-11 ES ES20708137T patent/ES2953232T3/es active Active
- 2020-03-11 US US17/438,047 patent/US20220152186A1/en active Pending
- 2020-03-11 CN CN202080020212.XA patent/CN113557240B/zh active Active
- 2020-03-11 MX MX2021011059A patent/MX2021011059A/es unknown
- 2020-03-11 IL IL285914A patent/IL285914B2/en unknown
- 2020-03-11 JP JP2021552611A patent/JP7536031B2/ja active Active
- 2020-03-11 WO PCT/EP2020/056461 patent/WO2020182860A1/en not_active Ceased
- 2020-03-11 EP EP20708137.3A patent/EP3938378B1/en active Active
-
2023
- 2023-09-13 JP JP2023148763A patent/JP7672460B2/ja active Active
Patent Citations (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999022003A1 (en) | 1997-10-24 | 1999-05-06 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2000017365A2 (en) | 1998-09-23 | 2000-03-30 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2002068664A1 (en) | 2001-02-27 | 2002-09-06 | Icon Genetics Ag | Recombinant viral switches for the control of gene expression in plants |
| WO2002088369A1 (en) | 2001-04-30 | 2002-11-07 | Icon Genetics Ag | Processes and vectors for amplification or expression of nucleic acid sequences of interest in plants |
| WO2002101006A2 (en) | 2001-06-08 | 2002-12-19 | Icon Genetics, Inc. | Production of proteins in plants |
| WO2002097080A2 (en) | 2002-04-30 | 2002-12-05 | Icon Genetics Ag | Amplification vectors based on trans-splicing |
| WO2005049839A2 (en) | 2003-11-10 | 2005-06-02 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2006012906A1 (en) | 2003-11-10 | 2006-02-09 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2005071090A1 (en) | 2004-01-23 | 2005-08-04 | Icon Genetics Ag | Two-component rna virus-derived plant expression system |
| WO2006003018A2 (en) | 2004-07-07 | 2006-01-12 | Icon Genetics Ag | Biologically safe transient protein expression in plants |
| WO2007137788A1 (en) | 2006-05-29 | 2007-12-06 | Icon Genetics Gmbh | Plant virus-based inducible expression system |
| WO2008028661A2 (en) | 2006-09-06 | 2008-03-13 | Icon Genetics Gmbh | Potexvirus- derived replicon |
| EP2061890A2 (en) | 2006-09-06 | 2009-05-27 | Icon Genetics GmbH | Potexvirus- derived replicon |
| EP2601970A1 (en) | 2006-09-29 | 2013-06-12 | Ligocyte Pharmaceuticals, Inc. | Norovirus vaccine formulations |
| EP3153578A1 (en) * | 2010-07-06 | 2017-04-12 | Novartis Ag | Norovirus derived immunogenic compositions and methods |
| WO2012019660A1 (en) | 2010-08-07 | 2012-02-16 | Nomad Bioscience Gmbh | Process of transfecting plants |
| WO2013149726A1 (en) | 2012-04-03 | 2013-10-10 | Nomad Bioscience Gmbh | Agrobacterium for transient transfection of whole plants |
| WO2013192604A1 (en) | 2012-06-22 | 2013-12-27 | Takeda Vaccines (Montana), Inc. | Purification of virus like particles |
| WO2014187571A1 (en) | 2013-05-23 | 2014-11-27 | Nomad Bioscience Gmbh | Process of providing plants with abiotic stress resistance |
| WO2018170603A1 (en) * | 2017-03-23 | 2018-09-27 | Medicago Inc. | Norovirus fusion proteins and vlps comprising norovirus fusion proteins |
Non-Patent Citations (51)
| Title |
|---|
| "GenBank", Database accession no. AF093797.1 |
| "GeneBank", Database accession no. CRL46961 |
| BLAZEVIC ET AL., VACCINE, vol. 29, 2011, pages 81268133 |
| CHAN ET AL., NAT COMMUN, 2015 |
| CHOI ET AL., FOOD ENVIRON VIROL, 2017 |
| CHOI ET AL., PNAS, vol. 105, 2008, pages 9175 - 9180 |
| DE GRAAF, MVAN BEEK, JKOOPMANS, PG, NATURE REV MICROBIOL, vol. 14, 2016, pages 421 - 433 |
| DEBBINK, K.LINDESMITH, L.BARIC, R.S., CLIN INFECT DIS, vol. 58, 2014, pages 1746 - 1752 |
| DOROKHOV, Y.L.IVANOV, P.A.NOVIKOV, V.K. ET AL., FEBS LETT., vol. 350, 1994, pages 5 - 8 |
| EFFIO CL ET AL., VACCINE, vol. 34, 2016, pages 1259 - 1267 |
| ENGLER, C.KANDZIA, R.MARILLONNET, S., PLOS ONE, vol. 3, 2008, pages e3647 |
| FRISCH, D.A.HARRIS-HALLER, L.W.YOKUBAITIS, N.T. ET AL., PLANT MOL. BIOL., vol. 27, 1995, pages 405 - 409 |
| GHERARDI R.K. ET AL., FRONT. NEUROL, vol. 6, 2014, pages 4 |
| GHERARDI R.K. ET AL., MORPHOLOGIE, vol. 100, 2016, pages 85 - 94 |
| GLEBA, Y.KLIMYUK, V.MARILLONNET, S., CURR. OPIN. BIOTECHNOL., vol. 18, 2007, pages 134 - 141 |
| GLEBA, Y.KLIMYUK, V.MARILLONNET, S., VACCINE, vol. 23, 2005, pages 2042 - 2048 |
| HAJDUKIEWICZ, P.SVAB, Z.MALIGA, P., PLANT MOL BIOL., vol. 25, 1994, pages 989 - 994 |
| HANSMAN ET AL., JOURNAL OF GENERAL VIROLOGY, vol. 87, 2006, pages 909 - 919 |
| HARRIS JR, METHODS MOL BIOL., vol. 117, 1999, pages 13 - 30 |
| HERBST-KRALOVETZ, M.MASON, H. S.CHEN, Q., EXP. REV. VACCINES, vol. 9, 2010, pages 299 - 307 |
| HUHTI, L. ET AL., ARCH. VIROL., vol. 155, 2010, pages 1855 - 1858 |
| HUHTI, L. ET AL., ARCH. VIROL., vol. 158, 2013, pages 933 - 942 |
| J. ROBBIN HARRIS: "Methods in Molecular Biology", vol. 117, article "Electron Microscopy Methods and Protocols", pages: 13 - 30 |
| JIANG, X. ET AL., J.VIROL., vol. 66, 1992, pages 6527 - 6532 |
| K. DEBBINK ET AL: "The State of Norovirus Vaccines", CLINICAL INFECTIOUS DISEASES, vol. 58, no. 12, 27 February 2014 (2014-02-27), US, pages 1746 - 1752, XP055306273, ISSN: 1058-4838, DOI: 10.1093/cid/ciu120 * |
| KLIMYUK, V. ET AL., CURR. TOP. MICROBIOL IMMUNOL., vol. 375, 2014, pages 127 - 154 |
| KLIMYUK, V. ET AL., CURR. TOP. MICROBIOL. IMMUNOL., vol. 375, 2014, pages 127 - 154 |
| KOHO, T. ET AL., J. VIROL. METHODS, vol. 181, 2012, pages 6 - 11 |
| KUSCHEL, M.T. NEUMANN ET AL.: "Use of lab-on-a-chip technology for protein sizing and quantitation", J BIOMOL TECH, vol. 13, no. 3, 2002, pages 172 - 178 |
| LAI, H.CHEN, Q., PLANT CELL REP., vol. 31, 2012, pages 573 - 584 |
| LARTEY, R.T.LANE, L.C.MELCHER, U., ARCH. VIROL., vol. 138, 1994, pages 287 - 298 |
| LARTEY, R.T.VOSS, T.C.MELCHER, U., GENE, vol. 166, 1995, pages 331 - 332 |
| LAUE MBANNERT N., J APPLIED MICROBIOL., vol. 109, 2010, pages 1159 - 1168 |
| LEROUX-ROELS, G. ET AL., THE J. INFECT. DISEASES, vol. 217, 2018, pages 597 - 607 |
| LINDESMITH ET AL., J. VIROL., vol. 86, 2012, pages 873 - 883 |
| MARILLONNET, S.GIRITCH, A.GILS, M. ET AL., PROC. NATL. ACAD. SCI. U S A., vol. 101, 2004, pages 6852 - 6857 |
| MARILLONNET, S.THOERINGER, C.KANDZIA, R. ET AL., NAT. BIOTECHNOL., vol. 23, 2005, pages 718 - 723 |
| MATTHEWS ET AL., EPIDEMIOL. INFECT, vol. 140, 2012, pages 1161 - 1172 |
| PETROVSKY, N.AGUILAR, JC., IMMUNOL. &CELL BIOL., vol. 82, 2004, pages 488 - 496 |
| POGAN R ET AL., J PHYS.: CONDENS. MATTER, vol. 30, 2018, pages 064006 |
| POGAN, R ET AL., CURR OPIN VIROL, 2018 |
| POGAN, R. ET AL., J. PHYS.: CONDENS. MATTER, vol. 30, 2018, pages 064006 |
| PRASAD BWHARDY DESTES M, J. INFECT. DIS., vol. 181, 2000, pages S317 - S321 |
| RAMANI, S.ESTES, M.K.ATMAR, R.L., PLOS PATHOG, vol. 12, 2016, pages e1005334 |
| SANTI L. ET AL., VACCINE, vol. 26, 2008, pages 1846 - 1854 |
| SOMEYA, Y. ET AL., JOURNAL OF GENERAL VIROLOGY, vol. 92, 2011, pages 2320 - 2323 |
| TAMMINEN ET AL., IMMUNOLOGY, vol. 135, 2012, pages 89 - 99 |
| TAN, M.JIANG, X., HUM. VACCIN IMMUNOTHER, vol. 10, 2014, pages 1449 - 1456 |
| UUSI-KERTTULA ET AL., MICROBES INFECT., vol. 16, 2014, pages 472 - 480 |
| Y. SOMEYA ET AL: "Assembly of homogeneous norovirus-like particles accomplished by amino acid substitution", JOURNAL OF GENERAL VIROLOGY., vol. 92, no. 10, 29 June 2011 (2011-06-29), GB, pages 2320 - 2323, XP055599285, ISSN: 0022-1317, DOI: 10.1099/vir.0.033985-0 * |
| ZAHIN, M. ET AL., PLOS ONE, vol. 11, no. 8, 2016, pages e0160995 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023009977A1 (en) * | 2021-07-26 | 2023-02-02 | The University Of North Carolina At Chapel Hill | Methods and compositions for norovirus chimeric therapeutics |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3938378A1 (en) | 2022-01-19 |
| EP3938378C0 (en) | 2023-08-02 |
| IL285914A (en) | 2021-10-31 |
| JP2022522891A (ja) | 2022-04-20 |
| CN113557240B (zh) | 2025-02-25 |
| MX2021011059A (es) | 2021-10-13 |
| CA3133030A1 (en) | 2020-09-17 |
| AU2020235344A1 (en) | 2021-09-23 |
| JP7672460B2 (ja) | 2025-05-07 |
| EP3938378B1 (en) | 2023-08-02 |
| JP7536031B2 (ja) | 2024-08-19 |
| IL285914B1 (en) | 2024-07-01 |
| JP2024009801A (ja) | 2024-01-23 |
| US20220152186A1 (en) | 2022-05-19 |
| CN113557240A (zh) | 2021-10-26 |
| KR20220021451A (ko) | 2022-02-22 |
| IL285914B2 (en) | 2024-11-01 |
| AU2020235344B2 (en) | 2024-10-24 |
| ES2953232T3 (es) | 2023-11-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7672460B2 (ja) | 安定性が改善されたノロウイルス様粒子 | |
| US20230256078A1 (en) | Immunogenic composition and vaccine for generating an immune response to norovirus | |
| US12076388B2 (en) | Modified norovirus VP1 proteins and VLPS comprising modified norovirus VP1 proteins | |
| US12156907B2 (en) | Recombinant vector for expressing virus-like particles in plant and method for preparation of vaccine composition containing circovirus-like particles by using same | |
| US7413889B2 (en) | Production of a parvovirus vaccine in plants as viral coat protein fusions | |
| MX2014013671A (es) | Producción de partículas similares a rotavirus en plantas. | |
| Gil et al. | Successful oral prime‐immunization with VP60 from rabbit haemorrhagic disease virus produced in transgenic plants using different fusion strategies | |
| CN112135630A (zh) | 猪瘟疫苗组合物及其制备方法 | |
| Park et al. | Porcine circovirus 2 capsid protein produced in N. benthamiana forms virus-like particles that elicit production of virus-neutralizing antibodies in guinea pigs | |
| US20190345454A1 (en) | Rotavirus-like particle production in plants | |
| CA3133030C (en) | Norovirus-like particles with improved stability | |
| Tyulkina et al. | New viral vector for superproduction of epitopes of vaccine proteins in plants | |
| Li et al. | Morphology and stability changes of recombinant TMV particles caused by a cysteine residue in the foreign peptide fused to the coat protein | |
| JP7429684B6 (ja) | 改変ノロウイルスvp1タンパク質および改変ノロウイルスvp1タンパク質を含むvlp | |
| US12467058B2 (en) | Influenza virus-like particle production in plants | |
| TW201713680A (zh) | 嵌合型竹嵌紋病毒蛋白質與粒子、使用嵌合型竹嵌紋病毒載體而從衍生自基因轉殖植物的懸浮細胞中生產它們的方法,以及它們的應用 | |
| BR102018011834A2 (pt) | polipeptídeo flaviviral com finalidade vacinal e diagnostica produzido em planta |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20708137 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 285914 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2021552611 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3133030 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020235344 Country of ref document: AU Date of ref document: 20200311 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20217032648 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020708137 Country of ref document: EP Effective date: 20211012 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 202080020212.X Country of ref document: CN |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020217032648 Country of ref document: KR |
|
| WWC | Wipo information: continuation of processing after refusal or withdrawal |
Ref document number: 1020217032648 Country of ref document: KR |