WO2020106916A1 - Recombinant viral vectors and nucleic acids for producing the same - Google Patents

Recombinant viral vectors and nucleic acids for producing the same

Info

Publication number
WO2020106916A1
WO2020106916A1 PCT/US2019/062531 US2019062531W WO2020106916A1 WO 2020106916 A1 WO2020106916 A1 WO 2020106916A1 US 2019062531 W US2019062531 W US 2019062531W WO 2020106916 A1 WO2020106916 A1 WO 2020106916A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
sequence
promoter
aav
itr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/062531
Other languages
English (en)
French (fr)
Inventor
Darby Thomas
David DISMUKE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Stridebio Inc
Original Assignee
Stridebio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EA202191418A priority Critical patent/EA202191418A1/ru
Priority to KR1020217017068A priority patent/KR20210103469A/ko
Priority to AU2019385506A priority patent/AU2019385506A1/en
Priority to CN201980088932.7A priority patent/CN113302201A/zh
Priority to CA3120289A priority patent/CA3120289A1/en
Priority to MX2021005997A priority patent/MX2021005997A/es
Priority to SG11202105326WA priority patent/SG11202105326WA/en
Priority to PE2021000747A priority patent/PE20211419A1/es
Priority to EP19887003.2A priority patent/EP3883954A4/en
Priority to JP2021529002A priority patent/JP7704998B2/ja
Application filed by Stridebio Inc filed Critical Stridebio Inc
Priority to BR112021009733A priority patent/BR112021009733A2/pt
Publication of WO2020106916A1 publication Critical patent/WO2020106916A1/en
Priority to PH12021551155A priority patent/PH12021551155A1/en
Priority to IL283344A priority patent/IL283344A/en
Priority to US17/326,884 priority patent/US20210324418A1/en
Anticipated expiration legal-status Critical
Priority to CONC2021/0008120A priority patent/CO2021008120A2/es
Priority to JP2025034621A priority patent/JP2025102783A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0085Brain, e.g. brain implants; Spinal cord
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the instant disclosure relates to the fields of molecular biology and gene therapy. More specifically, disclosure relates to compositions and methods for producing recombinant viral vectors.
  • Recombinant viral vectors including adeno-associated virus vectors (AAVs), are useful as gene delivery agents, and are powerful tools for human gene therapy.
  • AAVs adeno-associated virus vectors
  • high-frequency stable DNA integration and expression may be achieved in a variety of cells, in vivo and in vitro.
  • AAV does not require active cell division for stable integration in target cells.
  • Recombinant AAV vectors can be produced in culture using viral production cell lines. Production of recombinant AAVs typically requires the presence of three elements in the cells: 1 ) a nucleic acid comprising a transgene flanked by AAV inverted terminal repeat (ITR) sequences, 2) AAV rep and cap genes, and 3) helper virus protein sequences. These three elements may be provided on one or more plasmids, and transfected or transduced into the cells. [0006] The production and use of recombinant AAV vectors has been limited by the inability to efficiently package transgene DNA into viral capsids and to effectively express the transgene in target cells. Accordingly, there exists a need in the art for improved compositions and methods for producing recombinant AAV vectors.
  • ITR inverted terminal repeat
  • nucleic acids comprising AAV transfer cassettes.
  • the disclosed nucleic acids can be used in the production of recombinant adeno-associated viral (AAV) vectors.
  • AAV adeno-associated viral
  • the disclosed nucleic acids and transfer cassettes comprise the sequences of one or more transgenes having therapeutic efficacy in the amelioration, treatment and/or prevention of one or more diseases or disorders.
  • the disclosure provides a nucleic acid comprising, from 5’ to 3’, a 5’ inverted terminal repeat (ITR), a promoter, a transgene sequence, a polyadenylation signal, and a 3’ ITR.
  • the transgene sequence encodes the frataxin (FXN) protein.
  • the FXN protein may be, for example, the human FXN protein.
  • the FXN protein has the sequence of SEQ ID NO: 65, or a sequence that is at least 95% identical thereto.
  • the nucleic acid comprises the sequence of any one of SEQ ID NO: 28-64, or a sequence at least 95% identical thereto.
  • the 5’ ITR is the same length as the 3’ ITR. In some embodiments, the 5’ ITR and the 3’ ITR have different lengths. In some embodiments, at least one of the 5’ ITR and the 3’ ITR is about 1 10 to about 160 nucleotides in length. At least one of the 5’ ITR and the 3’ ITR may be isolated or derived from, for example, the genome of AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV or Bovine AAV.
  • the 5’ ITR comprises the sequence of SEQ ID NO: 1 , or a sequence at least 95% identical thereto.
  • the 3’ ITR comprises the sequence of SEQ ID NO: 2, or a sequence at least 95% identical thereto.
  • the 3’ ITR comprises the sequence of SEQ ID NO: 3, or a sequence at least 95% identical thereto.
  • the promoter may drive expression of the transgene.
  • the promoter is a constitutive promoter.
  • the promoter is an inducible promoter.
  • the promoter is a tissue-specific promoter.
  • the promoter is a modified form of a wildtype promoter. For example, because of the packaging restrictions for an AAV, the length of a promoter may be reduced.
  • the promoter is a truncated form of a wildtype promoter.
  • the promoter may, for example, the CMV promoter, the SV40 early promoter, the SV40 late promoter, the metallothionein promoter, the murine mammary tumor virus (MMTV) promoter, the Rous sarcoma virus (RSV) promoter, the polyhedrin promoter, the chicken b-actin (CBA) promoter, the EF-1 alpha promoter, the EF-1 alpha short promoter, the EF-1 alpha core promoter, the dihydrofolate reductase (DHFR) promoter, the GUSB240 promoter, the GUSB379 promoter, or the phosphoglycerol kinase (PGK) promoter.
  • the promoter comprises a sequence selected from any one of SEQ ID NO: 6-12, or a sequence at least 95% identical thereto.
  • the transgene sequence is CpG optimized. In some embodiments, the transgene sequence comprises SEQ ID NO: 19 or 20, or a sequence that is at least 95% identical thereto.
  • the nucleic acid comprises a Kozak sequence immediately 5’ to the transgene sequence.
  • the Kozak sequence may comprise, for example, the sequence of SEQ ID NO: 17 or 18, or a sequence at least 95% identical thereto.
  • the polyadenylation signal is selected from the polyadenylation signal of simian virus 40 (SV40), human a-globin, rabbit a-globin, human b-globin, rabbit b-globin, human collagen, polyoma virus, human growth hormone (hGH) and bovine growth hormone (bGH).
  • the polyadenylation signal comprises the sequence of any one of SEQ ID NO: 21 -24, or a sequence at least 95% identical thereto.
  • the nucleic acid further comprises an enhancer.
  • the enhancer may be, for example, a CMV enhancer.
  • the enhancer comprises the sequence of SEQ ID NO: 4 or 5, or a sequence at least 95% identical thereto.
  • the nucleic acid further comprises an intronic sequence.
  • the intronic sequence may be, for example, a chimeric sequence or a hybrid sequence.
  • the intronic sequence comprises a sequence isolated or derived from one or more of the following genes: b-globin, chicken beta-actin, minute virus of mice, and human IgG.
  • the intronic sequence comprises the sequence of any one of SEQ ID NO: 13-16, or a sequence at least 95% identical thereto.
  • the nucleic acid further comprises at least one stuffer sequence (e.g., 1 , 2, 3, 4, or 5 stuffer sequences).
  • the at least one stuffer sequence comprises the sequence of any one of SEQ ID NO: 25-27, or a sequence at least 95% identical thereto.
  • a vector e.g., an AAV vector or plasmid
  • a nucleic acid of the disclosure comprising a nucleic acid of the disclosure.
  • a method of producing a recombinant AAV vector comprising contacting an AAV producer cell with a nucleic acid or plasmid/bacmid of the disclosure.
  • a recombinant AAV vector produced by this method may comprise a capsid protein from AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV and Bovine AAV.
  • the AAV vector may comprise a capsid protein with one or more substitutions or mutations compared to a wildtype AAV capsid protein.
  • the recombinant AAV vector is single stranded (ssAAV).
  • the recombinant AAV vector is self-complementary (scAAV).
  • compositions comprising a nucleic acid, a plasmid, a bacmid, a cell, or a recombinant AAV vector of the disclosure.
  • a method for treating a subject in need thereof comprising administering to the subject a therapeutically effective amount of a nucleic acid, a plasmid, a cell, or a recombinant AAV vector of the disclosure.
  • the subject is a human subject.
  • the subject has Friedreich’s Ataxia (FRDA).
  • FIG. 1 shows AAV production yield (vector genomes) using a triple plasmid transfection method.
  • AAV vectors were quantified using a droplet digital PCR (ddPCR ® ) assay.
  • FIG. 2 shows percent survival of FXN-deficient (FXN flox/flox MCKCre + ) mice treated with an AAV vector packaging a human FXN transgene at a dose of 5x10 13 vg/kg (Group 2) compared to saline-injected mice (Group 1 ).
  • FIG. 3A shows the number of copies of human FXN vector DNA per microgram of host DNA in heart tissue.
  • FIG. 3C shows FXN protein levels.
  • FIG. 4 shows expression of human FXN (ng/mg) in cultured Lec2 cells transduced with various doses of AAV9-FXN. Human FXN levels were measured using a standard ELISA.
  • FIG. 5 shows a schematic of an exemplary scheme for producing AAV using an AAV transfer cassette of the disclosure.
  • An AAV transfer cassette comprising a 5’ITR, a promoter, a transgene, and a 3’ITR is packaged into a plasmid using standard cloning techniques.
  • a second plasmid comprising AAV rep and cap sequences, and third plasmid comprising Adenovirus helper genes is prepared.
  • the three plasmids are transfected into an AAV producer cell line (e.g., HEK293). The cells then produce AAVs, which can be purified and frozen for later use.
  • AAV producer cell line e.g., HEK293
  • FRDA Friedreich’s Ataxia
  • FXN frataxin
  • Symptoms vary among subjects, but may include (i) loss of coordination (ataxia) in the arms and legs, (ii) fatigue/energy deprivation and muscle loss, (iii) vision impairment, hearing loss, and slurred speech, (iv) aggressive scoliosis (curvature of the spine), (v) diabetes mellitus (typically insulin-dependent), and (vi) serious heart conditions (e.g., hypertrophic cardiomyopathy and arrhythmias).
  • the mental capabilities of individuals with FRDA remain intact. There are currently no treatments for FRDA; subjects are monitored for symptom management. Accordingly, there is a need in the art for compositions and methods to treat and/or prevent FRDA.
  • nucleic acids comprising AAV transfer cassettes for producing AAV vectors.
  • the AAV vectors can be used for gene therapy applications, for example to deliver a therapeutic transgene to a cell or to a subject in need thereof.
  • the AAV transfer cassettes and vectors of the instant disclosure may be used to treat or prevent various genetic diseases and disorders, such as FRDA.
  • the term“about” as used herein when referring to a measurable value such as an amount or the length of a polynucleotide or polypeptide sequence, dose, time, temperature, and the like, is meant to encompass variations of ⁇ 20%, ⁇ 10%, ⁇ 5%, ⁇ 1 %, ⁇ 0.5%, or even ⁇ 0.1 % of the specified amount.
  • a “nucleic acid” or“polynucleotide” is a sequence of nucleotide bases, for example RNA, DNA or DNA-RNA hybrid sequences (including both naturally occurring and non-naturally occurring nucleotides).
  • the nucleic acids of the disclosure are either single or double stranded DNA sequences.
  • a nucleic acid may be 1 -1 ,000, 1 ,000-10,000, 10,000-100,000, 100,000-1 million or greater than 1 million nucleotides in length.
  • a nucleic acid will generally contain phosphodiester bonds, although in some cases nucleic acid analogs are included that may have alternate backbones, comprising, for example, phosphoramide, phosphorothioate, phosphorodithioate, O-methylphophoroamidite, or P-ethoxy linkages, or peptide nucleic acid backbones and linkages. Other analog nucleic acids include those with positive backbones, non-ionic backbones, and non-ribose backbones. Nucleic acids containing one or more carbocyclic sugars are also included within the definition of nucleic acids. These modifications of the ribose-phosphate backbone may facilitate the addition of labels, or increase the stability and half-life of such molecules in physiological environments. Nucleic acids of the disclosure may be linear, or may be circular (e.g., a plasmid).
  • protein refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, but no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • virus vector refers to a virus particle that functions as a nucleic acid delivery vehicle, and which comprises the vector genome packaged within a virion.
  • virus vectors of the disclosure include adenovirus vectors, adeno-associated virus vectors (AAVs), lentivirus vectors, and retrovirus vectors.
  • Adeno-associated virus or AAV belongs to the Dependovirus genus of the Parvoviridae family.
  • the 4.7 kb wildtype AAV genome encodes two major open reading frames.
  • the rep gene expresses viral replication proteins and the cap gene expresses viral capsid proteins.
  • At the ends of the AAV genome are inverted terminal repeats (ITRs) that form a T-shaped hairpin structure.
  • ITRs inverted terminal repeats
  • the replicative AAV life cycle requires helper function from, for example, adenovirus or herpes virus.
  • Recombinant AAV vectors can be generated by replacing the wildtype AAV open reading frames with a transgene expression cassette.
  • an AAV may be AAV type 1 , AAV type 2, AAV type 3 (including types 3A and 3B), AAV type 4, AAV type 5, AAV type 6, AAV type 7, AAV type 8, AAV type 9, AAV type 10, AAV type 1 1 , AAV type 12, AAV type 13, AAV type rh32.33, AAV type rh8, AAV type rh10, AAV type rh74, AAV type hu.68, avian AAV, bovine AAV, canine AAV, equine AAV, ovine AAV, snake AAV, bearded dragon AAV, AAV2i8, AAV2g9, AAV-LK03, AAV7m8, AAV Anc80, AAV PHP.B, and any other AAV now known or later discovered.
  • scAAV single-stranded AAV genomes.
  • scAAV single-stranded AAV genomes.
  • a dual-vector strategy may be used to overcome the small packaging capacity of AAV. For example, cis-activation, trans-splicing, overlapping, and hybrid systems may be used.
  • AAV transfer cassette refers to a nucleic acid comprising a transgene flanked by a first and a second ITR sequence. An AAV transfer cassette is packaged into an AAV vector during AAV vector production.
  • viral production cell refers to cells used to produce viral vectors.
  • HEK293 and 239T cells are common viral production cell lines.
  • HEK293 refers to a cell line originally derived from human embryonic kidney cells grown in tissue culture. The HEK293 cell line grows readily in culture, and is commonly used for viral production. As used herein,“HEK293” may also refer to one or more variant HEK293 cell lines, i.e. , cell lines derived from the original HEK293 cell line that additionally comprise one or more genetic alterations. Many variant HEK293 lines have been developed and optimized for one or more particular applications. For example, the 293T cell line contains the SV40 large T-antigen that allows for episomal replication of transfected plasmids containing the SV40 origin of replication, leading to increased expression of desired gene products.
  • Sf9 refers to an insect cell line that is a clonal isolate derived from the parental Spodoptera frugiperda cell line IPLB-Sf-21 -AE. Sf9 cells can be grown in the absence of serum and can be cultured attached or in suspension.
  • A“transfection reagent” means a composition that enhances the transfer of nucleic acid into cells.
  • Some transfection reagents commonly used in the art include one or more lipids that bind to nucleic acids and to the cell surface (e.g., LipofectamineTM).
  • ITR sequences are the minimum sequences required for AAV proviral integration and for packaging of AAV DNA into virions. ITRs are involved in a variety of activities in the AAV life cycle. For example, the ITR sequences play roles in excision from the plasmid after transfection, replication of the vector genome and integration and rescue from a host cell genome.
  • the nucleic acids of the disclosure may comprise a 5’ ITR and/or a 3’ ITR.
  • the ITR sequences may be about 1 10 to about 160 nucleotides in length, for example 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, 134, 135, 136, 137, 138, 139, 140, 141 , 142, 143, 144, 145, 146, 147, 148, 149, 150, 151 , 152, 153, 154, 155, 156, 157, 158, 159 or 160 nucleotides.
  • the 5’ ITR is the same length as the 3’ ITR. In some embodiments, the 5’ ITR and the 3’ ITR have different lengths. In some embodiments, the 5’ ITR is longer than the 3’ ITR, and in other embodiments, the 3’ ITR is longer than the 5’ ITR.
  • the ITRs may be isolated or derived from the genome of any AAV, for example the AAVs listed in Table 1.
  • at least one of the 5’ ITR and the 3’ ITR is isolated or derived from the genome of AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV or Bovine AAV.
  • at least one of the 5’ ITR and the 3’ITR may be a wildtype or mutated ITR isolated derived from a member of another parvovirus species besides AAV.
  • an ITR may be a wildtype or mutant ITR isolated or derived from bocavirus or parvovirus B19.
  • the ITR comprises a modification to promote production of a self-complementary AAV (scAAV).
  • the modification to promote production of a scAAV is deletion of the terminal resolution sequence (TRS) from the ITR.
  • the 5’ ITR is a wildtype ITR
  • the 3’ ITR is a mutated ITR lacking the terminal resolution sequence.
  • the 3’ ITR is a wildtype ITR
  • the 5’ ITR is a mutated ITR lacking the terminal resolution sequence.
  • the terminal resolution sequence is absent from both the 5’ ITR and the 3’ITR.
  • the modification to promote production of a scAAV is replacement of an ITR with a different hairpin-forming sequence, such as a shRNA- forming sequence.
  • the 5’ ITR or the 3’ ITR may comprise the sequence of SEQ ID NO: 1 , or a sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the 5’ ITR or the 3’ ITR may comprise the sequence of SEQ ID NO: 2, or a sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the 5’ ITR or the 3’ ITR may comprise the sequence of SEQ ID NO: 3, or a sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the 5’ ITR comprises the sequence of SEQ ID NO: 1
  • the 3’ ITR comprises the sequence of SEQ ID NO: 2.
  • the 5’ ITR comprises the sequence of SEQ ID NO: 1
  • the 3’ ITR comprises the sequence of SEQ ID NO: 3.
  • the nucleic acid may comprise one or more“surrogate” ITRs, i.e. , non-ITR sequences that serve the same function as ITRs. See, e.g., Xie, J. et al. , Mol. Then, 25(6): 1363-1374 (2017).
  • an ITR is replaced by a surrogate ITR.
  • the surrogate ITR comprises a hairpin-forming sequence.
  • the surrogate ITR is a short hairpin (sh)RNA-forming sequence. Promoters, Enhancers, Repressors and Other Regulatory Sequences
  • Gene expression may be controlled by nucleotide sequences such as promoters, enhancers, and/or repressors operably linked with the gene.
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
  • the nucleic acids or AAV transfer cassettes described herein comprise a promoter.
  • They promoter may be, for example, a constitutive promoter or an inducible promoter.
  • the promoter is a tissue-specific promoter.
  • promoter refers to one or more nucleic acid control sequences that direct transcription of an operably linked nucleic acid. Promoters may include nucleic acid sequences near the start site of transcription, such as a TATA element. Promoters may also include cis-acting polynucleotide sequences that can be bound by transcription factors.
  • a "constitutive" promoter is a promoter that is active under most environmental and developmental conditions.
  • An “inducible” promoter is a promoter that is active under environmental or developmental regulation.
  • Exemplary promoters that may be used in the nucleic acids and cassettes described herein include a CMV promoter, a SV40 promoter (e.g., a SV40 early or late promoter), a metallothionein promoter, a murine mammary tumor virus (MMTV) promoter, a Rous sarcoma virus (RSV) promoter, a polyhedrin promoter, a chicken b-actin (CBA) promoter, an EF-1 alpha promoter, a dihydrofolate reductase (DHFR) promoter, a GUSB240 promoter (e.g., a human GUSB240 (hGUSB240) promoter), GUSB379 promoter (e.g., a human GUSB379 (hGUSB379) promoter), and a phosphoglycerol kinase (PGK) promoter (e.g., a human PGK (hPGK) promoter).
  • the EF-1 alpha is selected from an EF-1 alpha wildtype promoter, an EF-1 alpha short promoter, and an EF-1 alpha core promoter.
  • the promoter is selected from the group consisting of a chicken b-actin (CBA) promoter, an EF-1 alpha short promoter, an EF-1 alpha wildtype promoter, an EF-1 alpha core promoter, a hPGK promoter, a hGUSB240 promoter, and a hGUSB379 promoter.
  • the promoter comprises a sequence of any one of SEQ ID NO: 6-12, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • tissue-specific promoters and enhancers that may be used in the nucleic acids and cassettes described herein includes: HMG-COA reductase promoter; sterol regulatory element 1 (SRE-1 ); phosphoenol pyruvate carboxy kinase (PEPCK) promoter; human C-reactive protein (CRP) promoter; human glucokinase promoter; cholesterol 7-alpha hydroylase (CYP-7) promoter; beta- galactosidase alpha-2,6 sialyltransferase promoter; insulin-like growth factor binding protein (IGFBP-1 ) promoter; aldolase B promoter; human transferrin promoter; collagen type I promoter; prostatic acid phosphatase (PAP) promoter; prostatic secretory protein of 94 (PSP 94) promoter; prostate specific antigen complex promoter; human glandular kallikrein gene promoter (hgt-1 ); the my
  • Gene expression may also be controlled by one or more distal "enhancer” or “repressor” elements, which can be located as much as several thousand base pairs from the start site of transcription. Enhancer or repressor elements regulate transcription in an analogous manner to cis-acting elements near the start site of transcription, with the exception that enhancer elements can act from a distance from the start site of transcription.
  • the nucleic acids or AAV transfer cassettes described herein comprise an enhancer.
  • the enhancer may be operably linked to a promoter.
  • the enhancer may be, for example, a CMV enhancer.
  • the enhancer comprises the sequence of SEQ ID NO: 4 or 5, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • nucleic acids and AAV transfer cassettes described herein may comprise a transgene sequence for expression in a target cell.
  • the transgene may be any heterologous nucleic acid sequence(s) of interest.
  • Nucleic acids of interest may encode polypeptides, including therapeutic (e.g., for medical or veterinary uses) or immunogenic (e.g., for vaccines) polypeptides or RNAs.
  • the transgene is a cDNA sequence.
  • the transgene encodes a therapeutic polypeptide.
  • Therapeutic polypeptides include, but are not limited to, cystic fibrosis transmembrane regulator protein (CFTR), dystrophin (including mini- and micro-dystrophins, see, e.g., Vincent et al, (1993) Nature Genetics 5: 130; U.S. Patent Publication No. 2003/017131 ; International publication WO/2008/088895, Wang et al., Proc. Natl. Acad. Sci. USA 97: 1 3714-13719 (2000); and Gregorevic et al., Mol. Ther.
  • CTR cystic fibrosis transmembrane regulator protein
  • dystrophin including mini- and micro-dystrophins, see, e.g., Vincent et al, (1993) Nature Genetics 5: 130; U.S. Patent Publication No. 2003/017131 ; International publication WO/2008/088895, Wang et al.,
  • myostatin propeptide myostatin propeptide, follistatin, activin type 1 1 soluble receptor, IGF-1 , anti-inflammatory polypeptides such as the Ikappa B dominant mutant, sarcospan, utrophin (Tinsley et al, (1996) Nature 384:349), mini-utrophin, clotting factors (e.g., Factor VIII, Factor IX, Factor X, etc.), erythropoietin, angiostatin, endostatin, catalase, tyrosine hydroxylase, superoxide dismutase, leptin, the LDL receptor, lipoprotein lipase, ornithine transcarbamylase, b-globin, a-globin, spectrin, alpha-1 -antitrypsin, adenosine deaminase, hypoxanthine guanine phosphoribosyl transferase, b-glucocer
  • angiogenesis inhibitors such as Vasohibins and other VEGF inhibitors (e.g., Vasohibin 2 [see, WO JP2006/073052]).
  • Other illustrative therapeutic polypeptides include suicide gene products (e.g., thymidine kinase, cytosine deaminase, diphtheria toxin, and tumor necrosis factor), proteins that enhance or inhibit transcription of host factors (e.g., nuclease-dead Cas9 linked to a transcription enhancer or inhibitor element, zinc-finger proteins linked to a transcription enhancer or inhibitor element, transcription activator-like (TAL) effectors linked to a transcription enhancer or inhibitor element), proteins conferring resistance to a drug used in cancer therapy, tumor suppressor gene products (e.g., p53, Rb, Wt-1 ), TRAIL, frataxin (FXN), FAS-ligand, and any other polypeptide that has a therapeutic effect in a
  • a transgene may also be a monoclonal antibody or antibody fragment, for example, an antibody or antibody fragment directed against myostatin (see, e.g., Fang et al. , Nature Biotechnology 23:584-590 (2005)).
  • Therapeutic polypeptides also include those encoding reporter polypeptides (e.g., an enzyme). Reporter polypeptides are known in the art and include, but are not limited to, Green Fluorescent Protein, b-galactosidase, alkaline phosphatase, luciferase, and chloramphenicol acetyltransferase gene.
  • the transgene encodes a secreted polypeptide (e.g., a polypeptide that is a secreted polypeptide in its native state or that has been engineered to be secreted, for example, by operable association with a secretory signal sequence as is known in the art).
  • a secreted polypeptide e.g., a polypeptide that is a secreted polypeptide in its native state or that has been engineered to be secreted, for example, by operable association with a secretory signal sequence as is known in the art.
  • the transgene may encode an antisense nucleic acid, a ribozyme (e.g., as described in U.S. Patent No. 5,877,022), RNAs that effect spliceosome-mediated/ram-splicing (see, Puttaraju et al, (1999) Nature Biotech. 17:246; U.S. Patent No. 6,013,487; U.S. Patent No.
  • a ribozyme e.g., as described in U.S. Patent No. 5,877,022
  • RNAs that effect spliceosome-mediated/ram-splicing see, Puttaraju et al, (1999) Nature Biotech. 17:246; U.S. Patent No. 6,013,487; U.S. Patent No.
  • RNAi interfering RNAs
  • siRNA siRNA
  • shRNA shRNA
  • miRNA miRNA that mediate gene silencing
  • other non-translated RNAs such as“guide” RNAs, and the like.
  • RNAi against a multiple drug resistance (MDR) gene product e.g., to treat and/or prevent tumors and/or for administration to the heart to prevent damage by chemotherapy
  • MDR multiple drug resistance
  • myostatin e.g., for Duchenne muscular dystrophy
  • VEGF e.g., to treat and/or prevent tumors
  • RNAi against phospholamban e.g., to treat cardiovascular disease, see, e.g., Andino et al., J. Gene Med. 10: 132-142 (2008) and Li et al., Acta Pharmacol Sin.
  • phospholamban inhibitory or dominant-negative molecules such as phospholamban S 16E (e.g., to treat cardiovascular disease, see, e.g., Hoshijima et al. Nat. Med. 8:864-871 (2002)), RNAi to adenosine kinase (e.g., for epilepsy), and RNAi directed against pathogenic organisms and viruses (e.g., hepatitis B and/or C virus, human immunodeficiency virus, CMV, herpes simplex virus, human papilloma virus, etc.)
  • pathogenic organisms and viruses e.g., hepatitis B and/or C virus, human immunodeficiency virus, CMV, herpes simplex virus, human papilloma virus, etc.
  • the transgene sequence may direct alternative splicing.
  • an antisense sequence (or other inhibitory sequence) complementary to the 5' and/or 3' splice site of dystrophin exon 51 can be delivered in conjunction with a U1 or U7 small nuclear (sn) RNA promoter to induce skipping of this exon.
  • a DNA sequence comprising a U1 or U7 snRNA promoter located 5' to the antisense/inhibitory sequence(s) can be packaged in a cassette and delivered in an AAV vector of the disclosure.
  • the transgene may direct gene editing.
  • the transgene may encode a gene-editing molecule such as a guide RNA or a nuclease.
  • the transgene may encode a zinc-finger nuclease, a homing endonuclease, a TALEN (transcription activator-like effector nuclease), a NgAgo (agronaute endonuclease), a SGN (structure-guided endonuclease), or a RGN (RNA- guided nuclease) such as a Cas9 nuclease or a Cpf1 nuclease.
  • a gene-editing molecule such as a guide RNA or a nuclease.
  • the transgene may encode a zinc-finger nuclease, a homing endonuclease, a TALEN (transcription activator-like effector nuclease), a NgA
  • the transgene may share homology with and recombine with a locus on a host chromosome. This approach can be utilized, for example, to correct a genetic defect in the host cell.
  • the transgene may be an immunogenic polypeptide, e.g., for vaccination.
  • the transgene may encode any immunogen of interest known in the art including, but not limited to, immunogens from human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), influenza virus, HIV or SIV gag proteins, tumor antigens, cancer antigens, bacterial antigens, viral antigens, and the like.
  • HIV human immunodeficiency virus
  • SIV simian immunodeficiency virus
  • influenza virus HIV or SIV gag proteins
  • tumor antigens cancer antigens
  • bacterial antigens bacterial antigens
  • viral antigens and the like.
  • the virus vectors according to the present disclosure provide a means for delivering transgenes into a broad range of cells, including dividing and non-dividing cells.
  • the virus vectors can be employed to deliver a transgene to a cell in vitro, e.g., to produce a polypeptide in vitro or for ex vivo gene therapy.
  • the virus vectors are additionally useful in a method of delivering a transgene to a subject in need thereof e.g., to express an immunogenic or therapeutic polypeptide or a functional RNA.
  • the polypeptide or functional RNA can be produced in vivo in the subject.
  • the subject can be in need of the polypeptide because the subject has a deficiency of the polypeptide.
  • the method can be practiced because the production of the polypeptide or functional RNA in the subject may impart some beneficial effect.
  • the virus vectors can also be used to produce a polypeptide of interest or functional RNA in cultured cells or in a subject (e.g., using the subject as a bioreactor to produce the polypeptide or to observe the effects of the functional RNA on the subject, for example, in connection with screening methods).
  • the nucleic acids and virus vectors of the present disclosure can be employed to deliver a transgene encoding a polypeptide or functional RNA to treat and/or prevent any disease state for which it is beneficial to deliver a therapeutic polypeptide or functional RNA.
  • disease states include, but are not limited to: cystic fibrosis (cystic fibrosis transmembrane regulator protein) and other diseases of the lung, hemophilia A (Factor VIII), hemophilia B (Factor IX), thalassemia (b-globin), anemia (erythropoietin) and other blood disorders.
  • Alzheimer's disease GDF; neprilysin
  • multiple sclerosis b-interferon
  • Parkinson's disease glial-cell line derived neurotrophic factor [GDNF]
  • Huntington's disease RNAi to remove repeats
  • amyotrophic lateral sclerosis epilepsy (galanin, neurotrophic factors), and other neurological disorders, cancer (endostatin, angiostatin, TRAIL, FAS-ligand, cytokines including interferons; RNAi including RNAi against VEGF or the multiple drug resistance gene product, mir-26a [e.g., for hepatocellular carcinoma]), diabetes mellitus (insulin), muscular dystrophies including Duchenne (dystrophin, mini-dystrophin, insulin-like growth factor I, a sarcoglycan [e.g., a, b, y], RNAi against myostatic myostatin propeptide, follistatin, activin type II soluble receptor,
  • the disclosure can further be used following organ transplantation to increase the success of the transplant and/or to reduce the negative side effects of organ transplantation or adjunct therapies (e.g., by administering immunosuppressant agents or inhibitory nucleic acids to block cytokine production).
  • organ transplantation or adjunct therapies e.g., by administering immunosuppressant agents or inhibitory nucleic acids to block cytokine production.
  • bone morphogenic proteins including BNP 2, 7, etc., RANKL and/or VEGF
  • the virus vectors of the present disclosure can be employed to deliver a transgene encoding a polypeptide or functional RNA to treat and/or prevent a liver disease or disorder.
  • the liver disease or disorder may be, for example, primary biliary cirrhosis, nonalcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), autoimmune hepatitis, hepatitis B, hepatitis C, alcoholic liver disease, fibrosis, jaundice, primary sclerosing cholangitis (PSC), Budd-Chiari syndrome, hemochromatosis, Wilson’s disease, alcoholic fibrosis, non-alcoholic fibrosis, liver steatosis, Gilbert’s syndrome, biliary atresia, alpha-1 -antitrypsin deficiency, alagille syndrome, progressive familial intrahepatic cholestasis, Hemophilia B, Hereditary An
  • the virus vectors of the present disclosure can be employed to deliver a transgene used to produce induced pluripotent stem cells (iPS).
  • a virus vector of the disclosure can be used to deliver stem cell associated nucleic acid(s) into a non-pluripotent cell, such as adult fibroblasts, skin cells, liver cells, renal cells, adipose cells, cardiac cells, neural cells, epithelial cells, endothelial cells, and the like.
  • Transgenes encoding factors associated with stem cells are known in the art.
  • Nonlimiting examples of such factors associated with stem cells and pluripotency include Oct-3/4, the SOX family (e.g., SOX 1 , SOX2, SOX3 and/or SOX 15), the Klf family (e.g., Klfl, KHZ Klf4 and/or Klf5), the Myc family (e.g., C-myc, L-myc and/or N-myc), NANOG and/or LIN28.
  • the SOX family e.g., SOX 1 , SOX2, SOX3 and/or SOX 15
  • the Klf family e.g., Klfl, KHZ Klf4 and/or Klf5
  • the Myc family e.g., C-myc, L-myc and/or N-myc
  • NANOG e.g., NANOG and/or LIN28.
  • the virus vectors of the present disclosure can be employed to deliver a transgene to treat and/or prevent a metabolic disorder such as diabetes (e.g., insulin), hemophilia (e.g., Factor IX or Factor VIII), a lysosomal storage disorder such as a mucopolysaccharidosis disorder (e.g., Sly syndrome [b-glucuronidase], Hurler Syndrome [alpha-L-iduronidase], Scheie Syndrome [alpha-L-iduronidase], Hurler-Scheie Syndrome [alpha-L-iduronidase], Hunter's Syndrome [iduronate sulfatase], Sanfilippo Syndrome A [heparan sulfamidase], B [N-acetylglucosaminidase], C [acetyl-CoA:alpha-glucosaminide acetyltransferase], D [N-acetylglucosamine 6-sulfatase], Morquio
  • the transgene is useful for treating Friedreich’s ataxia.
  • the transgene encodes the frataxin (FXN) protein.
  • the frataxin protein may be, for example, the human frataxin protein.
  • An exemplary human frataxin protein sequence is provided below (SEQ ID NO: 65): MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQ
  • the frataxin protein has a sequence that is at least 90% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical to the sequence of the human frataxin protein. In some embodiments, the frataxin protein has a sequence that is at least 90% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical to the sequence of SEQ ID NO: 65. In some embodiments, the human frataxin protein is an isoform, variant (e.g. an alternative splice variant) or mutant form of frataxin. In some embodiments, the mutant frataxin has one or more of the substitutions shown in Table 3.
  • the transgene comprises a frataxin cDNA that is codon optimized relative to a wildtype sequence.
  • the cDNA may be modified to remove cryptic splice acceptor/donor sites, reduce the usage of rare codons, remove ribosomal entry sites, etc.
  • the transgene comprises a frataxin cDNA that is CpG optimized.
  • the cDNA may be modified to reduce the number of CpG dinucleotides.
  • the transgene comprises a frataxin cDNA comprising the sequence of SEQ ID NO: 19, or a sequence at least 90% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical thereto.
  • the transgene comprises a frataxin cDNA comprising the sequence of SEQ ID NO: 20, or a sequence at least 90% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical thereto.
  • Polyadenylation signals are nucleotide sequences found in nearly all mammalian genes and control the addition of a string of approximately 200 adenosine residues (the poly(A) tail) to the 3' end of the gene transcript.
  • the poly(A) tail contributes to mRNA stability, and mRNAs lacking the poly(A) tail are rapidly degraded. There is also evidence that the presence of the poly(A) tail positively contributes to the translatability of mRNA by affecting the initiation of translation.
  • the nucleic acids and AAV transfer cassettes of the disclosure comprise one or more polyadenylation signals.
  • the nucleic acids and AAV transfer cassettes comprise two, three, four, or more polyadenylation signals.
  • the polyadenylation signal may be the polyadenylation signal of simian virus 40 (SV40), a-globin (e.g., human a-globin, mouse a-globin, or rabbit a- globin), b-globin (e.g., human b-globin, mouse b-globin, or rabbit b-globin), human collagen, polyoma virus, human growth hormone (hGH) or bovine growth hormone (bGH), or a variant thereof.
  • SV40 polyadenylation signal of simian virus 40
  • a-globin e.g., human a-globin, mouse a-globin, or rabbit a- globin
  • b-globin e.g., human b-globin,
  • the polyadenylation signal is the bovine growth hormone (bGH) polyadenylation signal, for example a bGH polyadenylation signal having a sequence of SEQ ID NO: 21.
  • the polyadenylation signal is the human growth hormone (hGH) polyadenylation signal, for example a hGH polyadenylation signal having a sequence of SEQ ID NO: 22.
  • the polyadenylation signal is the human beta globin polyadenylation signal, for example a human beta globin polyadenylation signal having a sequence of SEQ ID NO: 23.
  • the polyadenylation signal is the rabbit beta globin polyadenylation signal, for example a rabbit beta globin polyadenylation signal having a sequence of SEQ ID NO: 24.
  • the polyadenylation signal comprises the sequence of any one of SEQ ID NO: 21 -24, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the polyadenylation signal may be present in the nucleic acid or cassette in reverse orientation.
  • the polyadenylation signal may act as a safety factor.
  • the reverse orientation polyadenylation signal may prevent significant transcription from the promoter in the reverse direction.
  • a nucleic acid or AAV transfer cassette comprises two polyadenylation signals, such as the polyadenylation signals of SEQ ID NOs: 21 and 22.
  • the nucleic acid or AAV transfer cassette comprises two polyadenylation signals, one of the signals may be present in the reverse orientation.
  • AAV vectors typically accept inserts of DNA having a defined size range which is generally about 4 kb to about 5.2 kb, or slightly more. Thus, for shorter sequences, it may be necessary to include additional nucleic acid in the insert fragment in order to achieve the required length which is acceptable for the AAV vector.
  • the stuffer sequence may be isolated or derived from a non-coding region (e.g., an intronic region) of a known gene or nucleic acid sequence.
  • the stuffer sequence may be for example, a sequence between 1 -10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-75, 75-100, 100-150, 150-200, 200- 250, 250-300, 300-400, 400-500, 500-750, 750-1 ,000, 1 ,000-1 ,500, 1 ,500-2,000, 2,000- 2,500, 2,500- 3,000, 3,000-3,500, 3,500-4,000, 4,000-4,500, 4,500-5,000, 5,500-6,000, 6,000-7,000, 7,000- 8,000, or 8,000-9,000 nucleotides in length.
  • the stuffer sequence can be located in the nucleic acid or cassette at any desired position such that it does not prevent a function or activity.
  • the nucleic acids or AAV transfer cassettes of the disclosure comprise a suffer sequence.
  • the suffer sequence comprises an intronic sequence, or a sequence derived therefrom.
  • the stuffer sequence is a chimeric sequence.
  • the stutter sequence is isolated or derived from a gene such as alphal -antitrypsin or albumin.
  • the suffer sequence is selected from the sequence of any one of SEQ ID NO: 25-27, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the nucleic acids and/or transfer cassettes of the disclosure may comprise an intronic sequence.
  • the inclusion of an intronic sequence in the may recruit factors to a transcribed mRNA that are important for efficient nuclear export and translation.
  • inclusion of an intronic sequence may enhance expression compared with expression in the absence of the intronic sequence.
  • the intronic sequence is a hybrid or chimeric sequence.
  • the intronic sequence is isolated or derived from an intronic sequence of one or more of b-globin, chicken beta-actin, minute virus of mice (MVM), factor IX, SV40, and/or human IgG (heavy or light chain).
  • the intronic sequence comprises the sequence of any one of SEQ ID NO: 13-16, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • a Kozak sequence is a short sequence centered around the translational initiation site of eukaryotic mRNAs that allows for efficient initiation of translation of the mRNA.
  • the ribosomal translation machinery recognizes the AUG initiation codon in the context of the Kozak sequence.
  • the AAV transfer cassettes of the disclosure may comprise a Kozak sequence.
  • the Kozak sequence may enhance translation efficiency and overall expression of the transgene.
  • the Kozak sequence may be positioned immediately 5’ to the transgene sequence, or overlap with the transgene sequence.
  • a Kozak sequence in a nucleic acid or AAV transfer cassette of the disclosure may be a consensus sequence, or a modified version thereof.
  • the Kozak sequence may comprise the sequence of any one of SEQ ID NO: 17-18 or 66-70, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • a nucleic acid or an adeno-associated virus (AAV) transfer cassette comprises one or more of an enhancer, a promoter, an intronic sequence, a Kozak sequence, a transgene sequence, a polyadenylation signal, and/or a suffer sequence.
  • a nucleic acid or an adeno-associated virus (AAV) transfer cassette comprises any combination of an enhancer, a promoter, an intronic sequence, a Kozak sequence, a transgene sequence, a polyadenylation signal, and/or a suffer sequence.
  • a nucleic acid or an adeno-associated virus (AAV) transfer cassette comprises, from 5’ to 3’, a 5’ inverted terminal repeat (ITR), a promoter, a transgene sequence, a polyadenylation signal, and a 3’ ITR.
  • ITR inverted terminal repeat
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, an enhancer, a promoter, a transgene sequence, a polyadenylation signal, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, an enhancer, a promoter, an intronic sequence, a transgene sequence, a polyadenylation signal, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, a promoter, an intronic sequence, a transgene sequence, a polyadenylation signal, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, a polyA signal (reverse orientation), a promoter, an intronic sequence, a transgene sequence, a polyadenylation signal, a stuffer sequence, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, a stuffer sequence, a polyadenylation signal (reverse orientation), a promoter, an intronic sequence, a transgene sequence, a polyadenylation signal, a stutter sequence, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, a stutter sequence, a polyadenylation signal (reverse orientation), a promoter, a transgene sequence, a polyadenylation signal, a stutter sequence, and a 3’ ITR.
  • a nucleic acid or an AAV transfer cassette comprises, from 5’ to 3’, a 5’ ITR, a promoter, an intronic sequence, a transgene sequence, a polyadenylation signal, a suffer sequence, and a 3’ ITR.
  • the nucleic acid or AAV transfer cassette may further comprise a Kozak sequence.
  • the Kozak sequence may be located immediately 5’ to the transgene sequence.
  • the Kozak sequence may have the sequence of any one of SEQ ID NO: 17-18.
  • the nucleic acid or AAV transfer cassette comprises, from 5’ to 3’, the elements shown in Table 4, or any subset thereof.
  • a different exemplary nucleic acid or AAV transfer cassette is shown in each row in the table.
  • An“x” indicates that the indicated element is included in the nucleic acid or AAV transfer cassette.
  • Table 4 Exemplary nucleic acids or AAV transfer cassettes (5’ to 3’)
  • the transgene sequence may encode the frataxin (FXN) protein.
  • the transgene sequence may have the sequence of, for example, SEQ ID NO: 19 or SEQ ID NO: 20.
  • the transgene may encode a FXN protein having a sequence of SEQ ID NO: 65.
  • the 5’ ITR may have the sequence of SEQ ID NO: 1
  • the 3’ ITR may have the sequence of SEQ ID NO: 2 or 3.
  • the enhancer may have the sequence of any one of SEQ ID NO: 4-5.
  • the promoter may have the sequence of any one of SEQ ID NO: 6-12.
  • the intronic sequence may have the sequence of any one of SEQ ID NO: 13-16.
  • the polyadenylation signal may comprise the sequence of any one of SEQ ID NO: 21 -24.
  • the stuffer sequence may comprise the sequence of any one of SEQ ID NO: 25-27.
  • the nucleic acid or AAV transfer cassette comprises, from 5’ to 3’, the elements and sequences shown in Table 5, or any subset thereof.
  • a different exemplary nucleic acid or AAV transfer cassette is shown in each row of the table. The numbers provided in the table correspond to SEQ ID NOs.
  • Table 5 Exemplary nucleic acids or AAV transfer cassettes (5’ to 3’)
  • the nucleic acid or AAV transfer cassette comprises the sequence of any one of SEQ ID NO: 28-64, or a sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical thereto.
  • the nucleic acids and AAV transfer cassettes described herein may be incorporated into a vector (e.g., a plasmid or a bacmid) using standard molecular biology techniques.
  • the vector e.g., plasmid or bacmid
  • the vector may further comprise one or more genetic elements used during production of AAV, including, for example, AAV rep and cap genes, and helper virus protein sequences.
  • the nucleic acids and AAV transfer cassettes, and vectors comprising the nucleic acids and AAV transfer cassettes described herein, may be used to produce recombinant AAV vectors.
  • the AAV vectors may comprise a single stranded genome or a double stranded genome (i.e. , a scAAV).
  • High titer AAV preparations can be produced using techniques known in the art, such as standard triple transfection or baculoviral production methods.
  • methods for production of AAV vectors include 4 components: plasmids acting in trans and the transgene acting in cis. These components include: 1 ) a plasmid containing the AAV Rep and Cap genes for capsid formation and replication, 2) a plasmid containing adenovirus helper genes, 3) a cassette containing the transgene enclosed by two inverted terminal repeats (ITR), and 4) a viral packaging cell line. Since AAV is highly infectious and naturally present in a large percentage of the human population, cell cultures and all materials may be thoroughly tested for transient wild type AAV infection before use.
  • a method for producing a recombinant AAV vector comprises contacting an AAV producer cell (e.g., an HEK293 cell) with a nucleic acid, AAV transfer cassette or vector (e.g., plasmid) of the disclosure.
  • the method further comprises contacting the AAV producer cell with one or more additional vectors (e.g., plasmids) encoding, for example, AAV rep and cap genes, and helper virus protein sequences.
  • the method further comprises maintaining the AAV producer cell under conditions such that AAV is produced.
  • a method for producing a recombinant AAV vector comprises contacting an AAV producer cell (e.g., an insect cell such as a Sf9 cell) with at least one insect cell-compatible vector comprising a nucleic acid or AAV transfer cassette of the disclosure.
  • An“insect cell-compatible vector” is any compound or formulation, biological or chemical, which formulation facilitates transformation or transfection of an insect cell with a nucleic acid.
  • the insect cell-compatible vector is a baculoviral vector.
  • the method further comprises maintaining the insect cell under conditions such that AAV is produced.
  • an AAV producer cell is transfected (e.g., using a transfection reagent) with three plasmids: (1 ) a first plasmid comprising a nucleic acid or AAV transfer cassette of the disclosure, (2) a second plasmid comprising AAV rep and cap gene sequences, and (3) a third plasmid comprising helper virus protein sequences. See, e.g., FIG. 5.
  • the AAV producer cell may be any of the cells listed in Table 2.
  • the AAV producer cell may subsequently be maintained under conditions such that AAV is produced.
  • the AAV may then be purified using standard techniques, such as cesium chloride (CsCI) gradient centrifugation or column chromatography techniques.
  • CsCI cesium chloride
  • the recombinant AAV vectors produced may comprise a capsid of any serotype, for example AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV and Bovine AAV.
  • the recombinant AAV vectors produced may comprise a capsid protein with one or more amino acid modifications (e.g., substitutions and/or deletions) compared to the native AAV capsid.
  • the recombinant AAV vectors may comprise modified AAV capsids derived from AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV and Bovine AAV.
  • the AAV vector produced is an AAV9.
  • the AAV vector produced is an AAV1.
  • the AAV vector produced is an AAV4.
  • the recombinant AAV vectors may be used to transduce target cells with the transgene sequence, for example by contacting the recombinant AAV vector with a target cell.
  • compositions comprising a nucleic acid, AAV transfer cassette, plasmid, cell, or recombinant AAV vector of the disclosure.
  • the compositions are liquid compositions. In some embodiments, the compositions are solid compositions.
  • compositions comprising a nucleic acid, AAV transfer cassette, a plasmid, a cell, or a recombinant AAV vector of the disclosure.
  • Pharmaceutical compositions according to the present disclosure, and for use in accordance with the present disclosure may comprise, in addition to a nucleic acid, AAV transfer cassette, plasmid, cell, or recombinant AAV vector, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials (e.g., diluents, adjuvants, fillers, preservatives, anti-oxidants, lubricants, solubilizers, surfactants (e.g., wetting agents), masking agents, coloring agents, flavoring agents, and sweetening agents).
  • a pharmaceutically acceptable excipient e.g., diluents, adjuvants, fillers, preservatives, anti-oxidants, lubricants, solubilizers, surfactants (e.g., wetting agents), mask
  • Such materials should preferably be non-toxic.
  • Suitable carriers, diluents, excipients, etc. can be found in standard pharmaceutical texts. See, for example, Handbook of Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash), 2001 (Synapse Information Resources, Inc., Endicott, New York, USA), Remington's Pharmaceutical Sciences. 20th edition, pub. Lippincott, Williams & Wilkins, 2000; and Handbook of Pharmaceutical Excipients, 2nd edition, 1994.
  • the precise nature of the carrier or other material will depend on the route of administration, which may be oral, or by injection, e.g. cutaneous, subcutaneous, or intravenous.
  • compositions for oral administration may be in tablet, capsule, powder or liquid form.
  • a tablet may comprise a solid carrier or an adjuvant.
  • Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
  • a capsule may comprise a solid carrier such a gelatin.
  • the pharmaceutical composition may be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • Suitable solutions may comprise, for example, isotonic vehicles such as Sodium Chloride, Ringer's solution, and/or Lactated Ringer's solution. Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
  • the AAV vectors of the disclosure may be used to treat or prevent a disease, disorder, or other condition a subject in need thereof.
  • the subject may be a mammal or an avian.
  • the mammal is a cat, dog, mouse, rat, horse, cow, pig, guinea pig, or non-human primate.
  • the subject is a human.
  • the human may be a pediatric subject, an adult subject, or a geriatric subject.
  • the AAV vectors of the disclosure, or compositions comprising the same may be contacted with a cell in vivo or ex vivo.
  • the cell may then be maintained under conditions sufficient for expression of the transgene in the cell.
  • the AAV vectors of the disclosure, or compositions comprising the same, may be administered to a subject in need thereof. Administration can be by any means known in the art.
  • the virus vector and/or composition is delivered in a therapeutically effective dose in a pharmaceutically acceptable carrier.
  • a therapeutically effective dose of the virus vector and/or composition is delivered.
  • Dosages of the virus vector and/or composition to be administered to a subject depend upon the mode of administration, the disease or condition to be treated and/or prevented, the individual subject's condition, the particular virus vector or composition, the nucleic acid to be delivered, and the like, and can be determined in a routine manner.
  • Exemplary doses for achieving therapeutic effects are titers of at least about 10 5 , at least about 10 6 , at least about 10 7 , at least about 10 s , at least about 10 9 , at least about 10 10 , at least about 10 11 , at least about 10 12 , at least about 10 13 , at least about 10 14 , at least about 10 15 transducing units, optionally about 10 8 to about 10 13 transducing units.
  • more than one administration may be employed to achieve the desired level of gene expression over a period of various intervals, e.g., daily, weekly, monthly, yearly, etc.
  • Exemplary modes of administration include oral, rectal, transmucosal, intranasal, inhalation (e.g., via an aerosol), buccal (e.g., sublingual), vaginal, intrathecal, intraocular, transdermal, in utero (or in ovo), parenteral (e.g., intravenous, subcutaneous, intradermal, intramuscular (including administration to skeletal, diaphragm and/or cardiac muscle), intradermal, intrapleural, intracerebral, and intraarticular), topical (e.g., to both skin and mucosal surfaces, including airway surfaces, and transdermal administration), intralymphatic, and the like, as well as direct tissue or organ injection (e.g., to liver, skeletal muscle, cardiac muscle, diaphragm muscle or brain).
  • buccal e.g., sublingual
  • vaginal intrathecal
  • intraocular transdermal
  • in utero or in ovo
  • parenteral e.
  • Administration can also be to a tumor (e.g., in or near a tumor or a lymph node).
  • a tumor e.g., in or near a tumor or a lymph node.
  • the most suitable route in any given case will depend on the nature and severity of the condition being treated and/or prevented and on the nature of the particular vector that is being used.
  • an AAV vector or composition comprising the vector may be administered by direct injection into cardiac or central nervous system (CNS) tissue.
  • the AAV vector or composition comprising the vector may be delivered intracranially including intrathecal, intraneural, intra-cerebral, or intra-ventricular administration.
  • the AAV vector or composition comprising the vector may be delivered to the heart by direct administration into the myocardium by epicardiac injection followed by minithoractomy, by intracoronary injection, or by endomyocardic injection.
  • Delivery to a target tissue can also be achieved by delivering a depot comprising the virus vector and/or capsid.
  • a depot comprising the virus vector and/or capsid is implanted into skeletal, cardiac and/or diaphragm muscle tissue or the tissue can be contacted with a film or other matrix comprising the virus vector and/or capsid.
  • implantable matrices or substrates are described in U.S. Patent No. 7,201 ,898.
  • a method for treating a subject in need thereof comprises administering to the subject a therapeutically effective amount of a nucleic acid, an AAV transfer cassette, a plasmid, a cell, or a recombinant AAV of the disclosure.
  • the subject is a human subject. In some embodiments, the subject suffers from Friedreich’s Ataxia.
  • the administering may result in expression of a therapeutically effective amount of FXN protein in a CNS tissue (e.g., a neuronal tissue) or a cardiac tissue of the subject.
  • the administering may result in alleviation of one or more symptoms of Friedrich’s Ataxia.
  • the administering may (1 ) improve coordination (ataxia) in the arms and legs of the subject, (2) increase energy levels and/or decrease fatigue and muscle loss in the subject, (3) improve vision, hearing loss, or speech in the subject, (3) decrease scoliosis or the rate of progression thereof, (4) improve the symptoms of diabetes such as insulin sensitivity, or (5) ameliorate heart conditions such as hypertrophic cardiomyopathy or arrhythmia.
  • the improvement in the subject due to treatment may be an improvement as compared to the subject pre treatment, or as compared to typical subjects with Friedrich’s ataxia.
  • the administering may result in an extension of the lifespan of the subject.
  • the administering may extend the lifespan of the subject by about 1 year, about 2 years, about 3 years, about 4 years, about 5 years, about 5-10 years, or greater than 10 years compared to a typical subject that has Friedrich’s ataxia.
  • Example 1 Preparation of a recombinant AAV vector in mammalian cells
  • the first plasmid comprises a transfer cassette comprising a cDNA encoding human frataxin (SEQ ID NO: 19 or 20) flanked by two ITRs (SEQ ID NO: 1 , SEQ ID NO: 2 or 3), and has the sequence of any one of SEQ ID NO: 28-64.
  • the second plasmid comprises sequences encoding the Rep and Cap genes.
  • the third plasmid comprises various“helper” sequences required for AAV production (E4, E2a, and VA).
  • the three plasmids are transfected into viral production cells (e.g., HEK293) using an appropriate transfection reagent (e.g., LipofectamineTM). After incubation at 37°C for a predetermined period of time, AAV particles are collected from the media or the cells are lysed to release the AAV particles. The AAV particles are then purified, titered, and may be stored at -80°C for later use.
  • an appropriate transfection reagent e.g., LipofectamineTM
  • Example 2 Preparation of a recombinant AAV vector in insect cells
  • a first recombinant baculoviral vector comprises a transfer cassette sequence comprising a cDNA encoding human frataxin (SEQ ID NO: 19 or 20) flanked by two ITRs (SEQ ID NO: 1 , SEQ ID NO: 2 or 3), wherein the transfer cassette has the sequence of any one of SEQ ID NO: 28-64.
  • Insect cells e.g., Sf9 are co-infected in suspension culture with the first recombinant baculoviral vector and a least one additional recombinant baculoviral vector comprising sequences encoding the AAV Rep and Cap proteins. After incubation at 28°C for a predetermined period of time, AAV particles are collected from the media or the cells are lysed to release the AAV particles. The AAV particles are then purified, titered, and may be stored at -80°C for later use.
  • Example 3 Recombinant AAV packaging FXN transgene transduces heart cells in vivo and extends lifespan of FXN deficient mice
  • FXN plasmid A composition comprising the FXN plasmid, a second plasmid comprising sequences encoding AAV Rep and Cap (AAV9) genes, and a third plasmid comprising sequences encoding AAV helper sequences was prepared and used to transfect HEK293 cells using a standard “triple transfection” protocol.
  • the HEK293 cells were maintained under standard culture conditions (37°C, 5% CO2) to allow for production of recombinant, self complementary AAV9 vectors.
  • AAV9 vector yield was quantified using ddPCR ® .
  • the yield of AAV9 packaging the FXN transgene (AAV9-FXN) in each run was between 10 13 and 10 14 vector genomes.
  • FIG. 4 shows expression of human FXN (ng/mg) in cultured Lec2 cells transduced with various doses of AAV9-FXN. Higher expression of hFXN was observed at higher doses of vector were used.
  • AAV9-FXN The recombinant AAV9-FXN was also used to infect mice lacking FXN in cardiac and skeletal muscle ( FXN flox/flox MCKCre + ). Mice were treated with either saline or AAV9- FXN (5x10 13 vg/kg) at 3 weeks of age, and survival was monitored. As shown in FIG. 2, treatment with AAV9-FXN significantly increased lifespan. The median survival of the saline-injected mice was 64 days, whereas the median survival of AAV9-FXN injected mice was 138.5 days.
  • FXN deficient mice were treated with either saline, or a low or high dose of AAV9-FXN (1x10 13 or 5x10 13 vg/kg, respectively) at 3 weeks of age. Mice were sacrificed 3 weeks post-treatment, and heart tissue was analyzed. As shown in FIG 3A, human FXN (hFXN) DNA was detectable in heart tissue from AAV9-FXN treated mice. The hFXN DNA was transcribed to RNA (FIG. 3B) and translated into protein (FIG. 3C). The higher dose of AAV9-FXN led to higher levels of FXN DNA, RNA, and protein in the heart samples.
  • AAV9-FXN human FXN
  • an AAV transfer cassette of the disclosure comprising the FXN transgene can be used to produce recombinant AAV vectors, and can be used to transduce the cells of a subject in vivo.
  • a nucleic acid comprising, from 5’ to 3’: a 5’ inverted terminal repeat (ITR); a promoter; a transgene sequence; a polyadenylation signal; and a 3’ ITR; wherein the transgene sequence encodes the frataxin (FXN) protein.
  • ITR inverted terminal repeat
  • FXN frataxin
  • nucleic acid of embodiment 1 wherein at least one of the 5’ ITR and the 3’ ITR is about 1 10 to about 160 nucleotides in length.
  • nucleic acid of embodiment 1 wherein the 5’ ITR comprises the sequence of SEQ ID NO: 1 , or a sequence at least 95% identical thereto.
  • nucleic acid of any one of embodiments 1-6, wherein the 3’ ITR comprises the sequence of SEQ ID NO: 2, or a sequence at least 95% identical thereto.
  • nucleic acid of any one of embodiments 1-7, wherein the 3’ ITR comprises the sequence of SEQ ID NO: 3, or a sequence at least 95% identical thereto.
  • the nucleic acid of any one of embodiments 1 -1 1 wherein the promoter is a tissue-specific promoter.
  • the promoter is selected from the group consisting of the CMV promoter, the SV40 early promoter, the SV40 late promoter, the metallothionein promoter, the murine mammary tumor virus (MMTV) promoter, the Rous sarcoma virus (RSV) promoter, the polyhedrin promoter, the chicken b-actin (CBA) promoter, the EF-1 alpha promoter, the EF-1 alpha short promoter, the EF-1 alpha core promoter, the dihydrofolate reductase (DHFR) promoter, the GUSB240 promoter, the GUSB379 promoter, and the phosphoglycerol kinase (PGK) promoter.
  • nucleic acid of embodiment 24, wherein the Kozak sequence comprises the sequence of SEQ ID NO: 17 or 18, or a sequence at least 95% identical thereto.
  • nucleic acid of any one of embodiments 1 -25, wherein the polyadenylation signal is selected from the polyadenylation signal of simian virus 40 (SV40), human a-globin, rabbit a-globin, human b-globin, rabbit b-globin, human collagen, polyoma virus, human growth hormone (hGH) and bovine growth hormone (bGH).
  • SV40 polyadenylation signal of simian virus 40
  • human a-globin rabbit a-globin
  • human b-globin rabbit b-globin
  • human collagen polyoma virus
  • hGH human growth hormone
  • bGH bovine growth hormone
  • nucleic acid of embodiment 26, wherein the polyadenylation signal is the bovine growth hormone polyadenylation signal.
  • nucleic acid of embodiment 26, wherein the polyadenylation signal is the human growth hormone polyadenylation signal.
  • nucleic acid of embodiment 26, wherein the polyadenylation signal is the human b-globin polyadenylation signal.
  • nucleic acid of embodiment 26, wherein the polyadenylation signal is the rabbit b-globin polyadenylation signal.
  • nucleic acid of any one of embodiments 1 -25, wherein the polyadenylation signal comprises the sequence of any one of SEQ ID NO: 21 -24, or a sequence at least 95% identical thereto.
  • nucleic acid of any one of embodiments 1 -31 wherein the nucleic acid further comprises an enhancer.
  • nucleic acid of embodiment 32, wherein the enhancer comprises the sequence of SEQ ID NO: 4 or 5, or a sequence at least 95% identical thereto.
  • intronic sequence comprises sequences isolated or derived from intronic sequences of one or more of b- globin, chicken beta-actin, minute virus of mice, and human IgG.
  • nucleic acid of embodiment 35, wherein the intronic sequence comprises the sequence of any one of SEQ ID NO: 13-16, or a sequence at least 95% identical thereto.
  • nucleic acid of embodiment 40, wherein the nucleic acid comprises two stuffer sequences.
  • nucleic acid of embodiment 1 wherein the nucleic acid comprises the sequence of any one of SEQ ID NO: 28-64, or a sequence at least 95% identical thereto.
  • a plasmid comprising the nucleic acid of any one of embodiments 1 -43.
  • a cell comprising the nucleic acid of any one of embodiments 1 -43 or the plasmid of embodiment 44.
  • a method of producing a recombinant AAV vector comprising contacting an AAV producer cell with the nucleic acid of any one of embodiments 1 -43 or the plasmid of embodiment 44.
  • AAV vector of any one of embodiments 47-49, wherein the AAV vector comprises a capsid protein of AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1 , AAV12, AAVrh8, AAVrhI O, AAVrh32.33, AAVrh74, Avian AAV or Bovine AAV.
  • AAV vector of any one of embodiments 47-49 wherein the AAV vector comprises a capsid protein with one or more substitutions or mutations compared to a wildtype AAV capsid protein.
  • composition comprising the nucleic acid of any one of embodiments 1 -43, the plasmid of embodiment 44, the cell of embodiment 45, or the recombinant AAV vector of any one of embodiments 47-51.
  • a method for treating a subject in need thereof comprising administering to the subject a therapeutically effective amount of the nucleic acid of any one of embodiments 1 -43, the plasmid of embodiment 44, the cell of embodiment 45, or the recombinant AAV vector of any one of embodiments 47-41.
  • [0200] 55 The method of embodiment 53 or 54, wherein the subject is a human subject.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Neurology (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physical Education & Sports Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurosurgery (AREA)
  • Psychology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2019/062531 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same Ceased WO2020106916A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
KR1020217017068A KR20210103469A (ko) 2018-11-21 2019-11-21 재조합 바이러스 벡터 및 이를 생산하기 위한 핵산
AU2019385506A AU2019385506A1 (en) 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same
CN201980088932.7A CN113302201A (zh) 2018-11-21 2019-11-21 重组病毒载体和用于产生所述重组病毒载体的核酸
CA3120289A CA3120289A1 (en) 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same
MX2021005997A MX2021005997A (es) 2018-11-21 2019-11-21 Vectores virales recombinantes y acidos nucleicos para producirlos.
SG11202105326WA SG11202105326WA (en) 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same
PE2021000747A PE20211419A1 (es) 2018-11-21 2019-11-21 Vectores virales recombinantes y acidos nucleicos para producirlos
JP2021529002A JP7704998B2 (ja) 2018-11-21 2019-11-21 組換えウイルスベクター及びそれの産生のための核酸
EP19887003.2A EP3883954A4 (en) 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same
EA202191418A EA202191418A1 (ru) 2018-11-21 2019-11-21 Рекомбинантные вирусные векторы и нуклеиновые кислоты для их получения
BR112021009733A BR112021009733A2 (pt) 2018-11-21 2019-11-21 Vetores de vírus recombinantes e ácidos nucleicos para a produção dos mesmos
PH12021551155A PH12021551155A1 (en) 2018-11-21 2021-05-20 Recombinant viral vectors and nucleic acids for producing the same
IL283344A IL283344A (en) 2018-11-21 2021-05-20 Recombinant viral vectors and nucleic acids for compatible production
US17/326,884 US20210324418A1 (en) 2018-11-21 2021-05-21 Recombinant viral vectors and nucleic acids for producing the same
CONC2021/0008120A CO2021008120A2 (es) 2018-11-21 2021-06-21 Vectores virales recombinantes y ácidos nucleicos para producirlos
JP2025034621A JP2025102783A (ja) 2018-11-21 2025-03-05 組換えウイルスベクター及びそれの産生のための核酸

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862770202P 2018-11-21 2018-11-21
US62/770,202 2018-11-21

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/326,884 Continuation US20210324418A1 (en) 2018-11-21 2021-05-21 Recombinant viral vectors and nucleic acids for producing the same

Publications (1)

Publication Number Publication Date
WO2020106916A1 true WO2020106916A1 (en) 2020-05-28

Family

ID=70773595

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/062531 Ceased WO2020106916A1 (en) 2018-11-21 2019-11-21 Recombinant viral vectors and nucleic acids for producing the same

Country Status (20)

Country Link
US (1) US20210324418A1 (cg-RX-API-DMAC7.html)
EP (1) EP3883954A4 (cg-RX-API-DMAC7.html)
JP (2) JP7704998B2 (cg-RX-API-DMAC7.html)
KR (1) KR20210103469A (cg-RX-API-DMAC7.html)
CN (1) CN113302201A (cg-RX-API-DMAC7.html)
AR (1) AR117145A1 (cg-RX-API-DMAC7.html)
AU (1) AU2019385506A1 (cg-RX-API-DMAC7.html)
BR (1) BR112021009733A2 (cg-RX-API-DMAC7.html)
CA (1) CA3120289A1 (cg-RX-API-DMAC7.html)
CL (1) CL2021001327A1 (cg-RX-API-DMAC7.html)
CO (1) CO2021008120A2 (cg-RX-API-DMAC7.html)
EA (1) EA202191418A1 (cg-RX-API-DMAC7.html)
EC (1) ECSP21044840A (cg-RX-API-DMAC7.html)
IL (1) IL283344A (cg-RX-API-DMAC7.html)
MX (1) MX2021005997A (cg-RX-API-DMAC7.html)
PE (1) PE20211419A1 (cg-RX-API-DMAC7.html)
PH (1) PH12021551155A1 (cg-RX-API-DMAC7.html)
SG (1) SG11202105326WA (cg-RX-API-DMAC7.html)
TW (1) TW202039533A (cg-RX-API-DMAC7.html)
WO (1) WO2020106916A1 (cg-RX-API-DMAC7.html)

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022010277A1 (en) * 2020-07-08 2022-01-13 Neuracle Genetics Inc. Novel intron fragments
WO2022026410A3 (en) * 2020-07-27 2022-03-03 Voyager Therapeutics, Inc Compositions and methods for the treatment of niemann-pick type c1 disease
US20220098617A1 (en) * 2020-09-29 2022-03-31 NeuExcell Therapeutics Inc. Ascl1 vector
US20220098255A1 (en) * 2020-09-29 2022-03-31 NeuExcell Therapeutics Inc. Neurod1 combination vector
US20220106614A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Dlx2 vector
US20220106613A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Neurod1 vector
WO2023221942A1 (en) * 2022-05-16 2023-11-23 Shanghai Vitalgen Biopharma Co., Ltd. Recombinant aav vectors for treating glutaric aciduria type i
JP2023549456A (ja) * 2020-10-21 2023-11-27 デューク ユニバーシティ デュシェンヌ型筋ジストロフィーの処置のための大きい変異ホットスポットの二重aavベクター媒介欠失
US11976096B2 (en) 2018-04-03 2024-05-07 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US11981914B2 (en) 2019-03-21 2024-05-14 Ginkgo Bioworks, Inc. Recombinant adeno-associated virus vectors
US12031128B2 (en) 2021-04-07 2024-07-09 Battelle Memorial Institute Rapid design, build, test, and learn technologies for identifying and using non-viral carriers
US12060390B2 (en) 2018-04-03 2024-08-13 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
WO2024163678A3 (en) * 2023-02-01 2024-09-12 Tune Therapeutics, Inc. Fusion proteins and systems for targeted activation of frataxin (fxn) and related methods
US12104163B2 (en) 2020-08-19 2024-10-01 Sarepta Therapeutics, Inc. Adeno-associated virus vectors for treatment of Rett syndrome
US12109223B2 (en) 2020-12-03 2024-10-08 Battelle Memorial Institute Polymer nanoparticle and DNA nanostructure compositions and methods for non-viral delivery
US12116384B2 (en) 2018-04-03 2024-10-15 Ginkgo Bioworks, Inc. Virus vectors for targeting ophthalmic tissues
EP4271420A4 (en) * 2021-01-04 2025-07-30 Univ Florida METHODS AND COMPOSITIONS FOR THE TREATMENT OF FRIEDREICH'S ATAXIA
US12441996B2 (en) 2023-12-08 2025-10-14 Battelle Memorial Institute Use of DNA origami nanostructures for molecular information based data storage systems
US12458606B2 (en) 2023-09-29 2025-11-04 Battelle Memorial Institute Polymer nanoparticle compositions for in vivo expression of polypeptides
EP4401756A4 (en) * 2021-09-17 2025-12-03 Astellas Gene Therapies Inc FRATAXIN GENE THERAPY
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN107686842A (zh) * 2016-08-03 2018-02-13 南京大学 一种靶多核苷酸编辑方法及其应用
JP2022551739A (ja) 2019-10-17 2022-12-13 ストライドバイオ,インコーポレイテッド ニーマン・ピック病c型の治療のためのアデノ随伴ウイルスベクター
US12611436B2 (en) 2019-10-17 2026-04-28 Sarepta Therapeutics, Inc. AAV transfer cassette
US20250361525A1 (en) * 2022-06-08 2025-11-27 Scribe Therapeutics Inc. Aav vectors for gene editing
EP4598590A1 (en) * 2022-10-08 2025-08-13 Lingyi Biotech Co., Ltd. Construct for enhancing gene expression
CN117701638B (zh) * 2023-12-18 2024-10-18 苏州新芽基因生物技术有限公司 一种抑制残留aav载体质粒和质粒骨架转录活性的方法
WO2026019230A1 (ko) * 2024-07-15 2026-01-22 삼성바이오에피스 주식회사 스터퍼를 포함하는 재조합 aav 생산을 위한 벡터 시스템

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090221620A1 (en) * 2008-02-20 2009-09-03 Celera Corporation Gentic polymorphisms associated with stroke, methods of detection and uses thereof
WO2016115503A1 (en) * 2015-01-16 2016-07-21 Voyager Therapeutics, Inc. Central nervous system targeting polynucleotides
US20160256571A1 (en) * 2013-09-30 2016-09-08 Sanofi Invention

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002081632A2 (en) * 2001-04-04 2002-10-17 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Nucleic acids for transgene expression
AU2014255665B2 (en) * 2013-04-18 2018-08-02 Fondazione Telethon Effective delivery of large genes by dual AAV vectors
US10947596B2 (en) 2014-05-06 2021-03-16 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of cancer using NFS1 biomarkers and modulators
US11697825B2 (en) * 2014-12-12 2023-07-11 Voyager Therapeutics, Inc. Compositions and methods for the production of scAAV
CR20170406A (es) * 2015-02-10 2017-11-14 Genzyme Corp Arni variante
US11040113B2 (en) * 2015-03-23 2021-06-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical composition for the treatment and the prevention of neurological phenotype associated with Friedreich ataxia
WO2016164642A1 (en) * 2015-04-08 2016-10-13 The United States Of America, As Represented By The Secretary Of Health And Human Services Viral gene therapy as treatment for cholesterol storage disease or disorder
BR112017024514A2 (pt) * 2015-05-16 2018-07-24 Genzyme Corporation edição genética de mutações intrônicas profundas
MX390848B (es) * 2015-06-23 2025-03-21 Childrens Hospital Philadelphia Factor ix modificado, y composiciones, metodos y usos para la transferencia de genes a celulas, organos y tejidos.
WO2017023708A1 (en) * 2015-07-31 2017-02-09 California Institute Of Technology Activity-dependent expression of nucleic acids
SG11201802408RA (en) * 2015-11-05 2018-05-30 Bamboo Therapeutics Inc Modified friedreich ataxia genes and vectors for gene therapy
MX2018007330A (es) * 2015-12-15 2019-03-14 Genzyme Corp Vectores virales adeno-asociados para tratar mucolipidosis de tipo ii.
EP4484443A3 (en) * 2016-06-29 2025-03-26 CRISPR Therapeutics AG Materials and methods for treatment of friedreich ataxia and other related disorders
CA3045335A1 (en) * 2016-12-01 2018-06-07 Universite Laval Crispr-based treatment of friedreich ataxia
WO2018204764A1 (en) * 2017-05-05 2018-11-08 Camp4 Therapeutics Corporation Identification and targeted modulation of gene signaling networks
AU2018338728B2 (en) * 2017-09-29 2025-01-02 Centre National De La Recherche Scientifique (Cnrs) Rescue of central and peripheral neurological phenotype of Friedreich's Ataxia by intravenous delivery

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090221620A1 (en) * 2008-02-20 2009-09-03 Celera Corporation Gentic polymorphisms associated with stroke, methods of detection and uses thereof
US20160256571A1 (en) * 2013-09-30 2016-09-08 Sanofi Invention
WO2016115503A1 (en) * 2015-01-16 2016-07-21 Voyager Therapeutics, Inc. Central nervous system targeting polynucleotides

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3883954A4 *

Cited By (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
US12116384B2 (en) 2018-04-03 2024-10-15 Ginkgo Bioworks, Inc. Virus vectors for targeting ophthalmic tissues
US12060390B2 (en) 2018-04-03 2024-08-13 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US12091435B2 (en) 2018-04-03 2024-09-17 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US11976096B2 (en) 2018-04-03 2024-05-07 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US11981914B2 (en) 2019-03-21 2024-05-14 Ginkgo Bioworks, Inc. Recombinant adeno-associated virus vectors
KR20220031023A (ko) * 2020-07-08 2022-03-11 주식회사 뉴라클제네틱스 신규한 인트론 단편
US12173304B2 (en) 2020-07-08 2024-12-24 Neuracle Genetics Inc. Intron fragments
KR102742928B1 (ko) 2020-07-08 2024-12-16 주식회사 뉴라클제네틱스 신규한 인트론 단편
WO2022010277A1 (en) * 2020-07-08 2022-01-13 Neuracle Genetics Inc. Novel intron fragments
KR102599534B1 (ko) 2020-07-08 2023-11-08 주식회사 뉴라클제네틱스 신규한 인트론 단편
KR20230156799A (ko) * 2020-07-08 2023-11-14 주식회사 뉴라클제네틱스 신규한 인트론 단편
WO2022026410A3 (en) * 2020-07-27 2022-03-03 Voyager Therapeutics, Inc Compositions and methods for the treatment of niemann-pick type c1 disease
US12104163B2 (en) 2020-08-19 2024-10-01 Sarepta Therapeutics, Inc. Adeno-associated virus vectors for treatment of Rett syndrome
WO2022072308A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Neurod1 vector
US20220106613A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Neurod1 vector
US20220098617A1 (en) * 2020-09-29 2022-03-31 NeuExcell Therapeutics Inc. Ascl1 vector
US20220098255A1 (en) * 2020-09-29 2022-03-31 NeuExcell Therapeutics Inc. Neurod1 combination vector
US20220106614A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Dlx2 vector
JP2023549456A (ja) * 2020-10-21 2023-11-27 デューク ユニバーシティ デュシェンヌ型筋ジストロフィーの処置のための大きい変異ホットスポットの二重aavベクター媒介欠失
US12433910B2 (en) 2020-12-03 2025-10-07 Battelle Memorial Institute Polymer nanoparticle and DNA nanostructure compositions and methods for non-viral delivery
US12109223B2 (en) 2020-12-03 2024-10-08 Battelle Memorial Institute Polymer nanoparticle and DNA nanostructure compositions and methods for non-viral delivery
EP4271420A4 (en) * 2021-01-04 2025-07-30 Univ Florida METHODS AND COMPOSITIONS FOR THE TREATMENT OF FRIEDREICH'S ATAXIA
US12031128B2 (en) 2021-04-07 2024-07-09 Battelle Memorial Institute Rapid design, build, test, and learn technologies for identifying and using non-viral carriers
EP4401756A4 (en) * 2021-09-17 2025-12-03 Astellas Gene Therapies Inc FRATAXIN GENE THERAPY
WO2023221942A1 (en) * 2022-05-16 2023-11-23 Shanghai Vitalgen Biopharma Co., Ltd. Recombinant aav vectors for treating glutaric aciduria type i
US12491266B2 (en) 2022-05-16 2025-12-09 Shanghai Vitalgen Biopharma Co., Ltd. Recombinant AAV vectors for treating glutaric aciduria type I
WO2024163678A3 (en) * 2023-02-01 2024-09-12 Tune Therapeutics, Inc. Fusion proteins and systems for targeted activation of frataxin (fxn) and related methods
US12458606B2 (en) 2023-09-29 2025-11-04 Battelle Memorial Institute Polymer nanoparticle compositions for in vivo expression of polypeptides
US12441996B2 (en) 2023-12-08 2025-10-14 Battelle Memorial Institute Use of DNA origami nanostructures for molecular information based data storage systems

Also Published As

Publication number Publication date
CO2021008120A2 (es) 2021-08-09
AU2019385506A1 (en) 2021-06-03
SG11202105326WA (en) 2021-06-29
JP2025102783A (ja) 2025-07-08
PE20211419A1 (es) 2021-08-03
EP3883954A4 (en) 2022-08-10
MX2021005997A (es) 2021-08-11
JP7704998B2 (ja) 2025-07-09
PH12021551155A1 (en) 2021-11-03
BR112021009733A2 (pt) 2022-01-04
CN113302201A (zh) 2021-08-24
EP3883954A1 (en) 2021-09-29
EA202191418A1 (ru) 2021-08-05
CL2021001327A1 (es) 2021-12-31
US20210324418A1 (en) 2021-10-21
AR117145A1 (es) 2021-07-14
IL283344A (en) 2021-07-29
TW202039533A (zh) 2020-11-01
JP2022508182A (ja) 2022-01-19
ECSP21044840A (es) 2021-09-30
CA3120289A1 (en) 2020-05-28
KR20210103469A (ko) 2021-08-23

Similar Documents

Publication Publication Date Title
US20210324418A1 (en) Recombinant viral vectors and nucleic acids for producing the same
AU2019287468B2 (en) Synthetic liver-tropic adeno-associated virus capsids and uses thereof
CN112543766A (zh) 抗体逃避性病毒载体
US12104163B2 (en) Adeno-associated virus vectors for treatment of Rett syndrome
KR20240090694A (ko) 변종 aav 및 조성물, 세포, 기관 및 조직으로의 유전자 전이를 위한 방법 및 용도
JP2018503376A (ja) 標的化遺伝子移入のための方法および組成物
CN105612253A (zh) 含有填充者/填充物多核苷酸序列的载体及其制备方法
Flotte et al. Viral vector–mediated and cell-based therapies for treatment of cystic fibrosis
WO2021226008A1 (en) Modified adeno-associated virus 5 capsids and uses thereof
US20240226206A9 (en) Aav transfer cassette
US20240123085A1 (en) Aav vectors targeting t-cells
EA049295B1 (ru) Рекомбинантные вирусные векторы и нуклеиновые кислоты для их получения
WO2024124019A2 (en) Aav vectors targeting hematopoietic stem cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19887003

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3120289

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021529002

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021009733

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019385506

Country of ref document: AU

Date of ref document: 20191121

Kind code of ref document: A

Ref document number: 20217017068

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: DZP2021000306

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: NC2021/0008120

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2019887003

Country of ref document: EP

Effective date: 20210621

WWP Wipo information: published in national office

Ref document number: NC2021/0008120

Country of ref document: CO

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112021009733

Country of ref document: BR

Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870210061093 DE 06/07/2021 NAO POSSUI TODOS OS CAMPOS OBRIGATORIOS INFORMADOS, NAO CONSTANDO OS CAMPOS 140 / 141 UMA VEZ QUE O DEPOSITANTE JA POSSUI O NUMERO DO PEDIDO NO BRASIL

ENP Entry into the national phase

Ref document number: 112021009733

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210519

WWG Wipo information: grant in national office

Ref document number: 202191418

Country of ref document: EA

WWR Wipo information: refused in national office

Ref document number: 1020217017068

Country of ref document: KR