WO2020086776A1 - Fc silenced antibody drug conjugates (adcs) and uses thereof - Google Patents
Fc silenced antibody drug conjugates (adcs) and uses thereof Download PDFInfo
- Publication number
- WO2020086776A1 WO2020086776A1 PCT/US2019/057741 US2019057741W WO2020086776A1 WO 2020086776 A1 WO2020086776 A1 WO 2020086776A1 US 2019057741 W US2019057741 W US 2019057741W WO 2020086776 A1 WO2020086776 A1 WO 2020086776A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antigen
- amino acid
- binding portion
- acid substitution
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC1*CC*C1 Chemical compound CC1*CC*C1 0.000 description 2
- VLFPYRIXHFRSNH-HMMYKYKNSA-N CC(C)(C)CC(N/N=C(\C)/c(cc1)ccc1OCCCC(C)=O)=O Chemical compound CC(C)(C)CC(N/N=C(\C)/c(cc1)ccc1OCCCC(C)=O)=O VLFPYRIXHFRSNH-HMMYKYKNSA-N 0.000 description 1
- QHMUGZJIYVXPGE-KYJUHHDHSA-N COc(cc(c(NC[C@H]1N2c3ccccc3C1)c1)C2=O)c1OCc1cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)cc(N[IH]I)c1 Chemical compound COc(cc(c(NC[C@H]1N2c3ccccc3C1)c1)C2=O)c1OCc1cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)cc(N[IH]I)c1 QHMUGZJIYVXPGE-KYJUHHDHSA-N 0.000 description 1
- ODLADRGZLSQHCP-URIFHXJUSA-N C[C@@H]([C@H]1O[C@H]([C@@H](OC)OCC2)N2C1C1)O[C@H]1O[C@@H](C[C@@](Cc1c(c(C(c2cccc(OC)c22)=O)c3C2=O)O)(C(NC)=O)O)c1c3O Chemical compound C[C@@H]([C@H]1O[C@H]([C@@H](OC)OCC2)N2C1C1)O[C@H]1O[C@@H](C[C@@](Cc1c(c(C(c2cccc(OC)c22)=O)c3C2=O)O)(C(NC)=O)O)c1c3O ODLADRGZLSQHCP-URIFHXJUSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
- A61K47/6809—Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
- A61K47/6831—Fungal toxins, e.g. alpha sarcine, mitogillin, zinniol or restrictocin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2806—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/289—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD45
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
Definitions
- the present disclosure relates to the field of antibodies or antibody drug conjugates thereof comprising an Fc region that has altered effector functions as a result of one or more amino acid substitutions in the Fc region.
- the present disclosure further relates to the treatment of patients suffering from various pathologies, such as blood diseases, metabolic disorders, cancers, and autoimmune diseases, among others, by administration of an antibody or antibody drug conjugate (ADC) having a modified Fc region, wherein the antibody or ADC is capable of binding an antigen expressed by a hematopoietic cell, such as a hematopoietic stem cell or cells of the host immune system.
- ADC antibody or antibody drug conjugate
- the Fc region of an antibody controls antibody cytotoxic activities and can impact serum half-life of the antibody.
- the cytotoxic effector function of an antibody is often not desirable and can create safety concerns and unwanted side effects by activating host immune defenses.
- Several amino acid changes in the Fc region have been reported to silence or reduce the effector function of antibodies. In fact, previous studies have identified amino acid positions within the Fc region of antibodies that impact the ability of the antibody to bind to an Fc receptor (see, for example, Wang et at. (201 8) Protein Cell. 2018 Jan; 9(1 ): 63-73).
- Fc mutations S239D and I332E have been described in the literature as enhancing ADCC function (see, e.g., Lazar et al. (2006) Engineered antibody Fc variants with enhanced effector function. Proc Natl Acad Sci USA. 1 03:4005-4010).
- Other mutations are associated with reduced FcyFt and C1 q binding, e.g., in an IgG 1 , amino acid changes L234A/L235A, or in an lgG4, amino acid changes F234A/L235A (Xu et al. In vitro characterization of five humanized OKT3 effector function variant antibodies. Cell Immunol. 2000; 200:16-26).
- ADCs antibody drug conjugates
- hematopoietic stem cells have significant therapeutic potential
- a limitation that has hindered their use in the clinic has been the difficulty associated with ensuring engraftment of hematopoietic stem cell (HSC) transplants in a host.
- HSC hematopoietic stem cell
- hematopoietic stem cell therapies involving antibodies that target cell surface antigens on endogenous HSCs can trigger unwanted immunostimulatory and effector functions that impede engraftment of an exogenous HSC transplant.
- hematopoietic stem cell grafts such that the multi-potency and hematopoietic functionality of these cells is preserved following transplantation.
- ADCs for example, that can be used for conditioning having reduced effector function to reduce potential cytokine secretion and possible side effects.
- antibodies, and antigen binding portions thereof comprising an Fc region that has altered effector functions as a result of one or more amino acid substitutions in the Fc region, as well as antibody drug conjugates, compositions, and methods of using said antibodies.
- antibodies or antibody drug conjugates (ADC) that have modified Fc regions, wherein the antibodies or ADCs are capable of binding an antigen expressed by a hematopoietic cell, such as a hematopoietic stem cell or a mature immune cell (e.g., T cells).
- ADCs containing Fc mutations that provide a conjugation site for the toxin and reduce effector function, as well as provide stability.
- the disclosure provides unique combinations of Fc mutations for ADCs.
- an antibody comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions L234 and L235 (EU index), and amino acid substitution D265C (EU index), and wherein the antibody is an intact IgG antibody.
- the Fc region comprises an amino acid substitution at positions L234 and L235 (EU index), and amino acid substitution D265A (EU index), and wherein the antibody is an intact IgG antibody.
- the L234 amino acid substitution is L234A.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position H435 (EU index).
- the H435 amino acid substitution is H435A.
- the antibody comprising amino acid substitution H435A has a decreased half-life relative to an identical intact IgG antibody comprising an unmodified Fc region.
- an antibody comprising an Fc region having amino acid substitutions consisting essentially of amino acid substitutions L234A, L235A, and D265C (EU index), and wherein the antibody is an intact IgG antibody.
- the antibody comprising an Fc region having amino acid substitutions consisting essentially of amino acid substitutions L234A, L235A, and D265A (EU index), and wherein the antibody is an intact IgG antibody.
- ct is an antibody, or an antigen-binding portion thereof, comprising an Fc region, wherein the Fc regions comprises amino acid substitutions at positions L234, L235 (EU index), and D265(EU index).
- the D265 amino acid substitution is D265C or D265A (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position E233 (EU index). In another embodiment, the E233 amino acid substitution is E233P (EU index). In another embodiment, the Fc region further comprises a deletion of G236 (EU index). In another embodiment, the Fc region further comprises an amino acid substitution at position P331 (EU index). In another embodiment, the P331 amino acid substitution is P331 G. In another embodiment, the Fc region does not include a substitution at position P331 (EU index). In another embodiment, the Fc region further comprises an amino acid substitution at position P329 (EU index). In another embodiment, the P329 amino acid substitution is P329G. In another embodiment, the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index). In another embodiment, the I253 amino acid substitution is I253A. In another embodiment, the Fc region further comprises an amino acid substitution at position H310 (EU index). In another embodiment, the H310 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at position N297 and D265 (EU index).
- the amino acid substitution at position D265 is D265C or D265A (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at positions L234 and L235 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position E233 (EU index). In another embodiment, the E233 amino acid substitution is E233P (EU index). In another embodiment, the Fc region further comprises a deletion of G236 (EU index). In another embodiment, the Fc region further comprises an amino acid substitution at position P331 (EU index). In another embodiment, the P331 amino acid substitution is P331 G. In another embodiment, the Fc region does not include a substitution at position P331 (EU index). In another embodiment, the Fc region further comprises an amino acid substitution at position P329 (EU index). In another embodiment, the P329 amino acid substitution is P329G. In another embodiment, the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index). In another embodiment, the I253 amino acid substitution is I253A. In another embodiment, the Fc region further comprises an amino acid substitution at position H310 (EU index). In another embodiment, the H31 0 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions E233, L234, L235, and D265 (EU index) and a deletion of G236 (EU index), and an amino acid substitution at D265 (EU index).
- the amino acid substitution at D265 is D265C or D265A (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P331 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index). In another embodiment, the I253 amino acid substitution is I253A. In another embodiment, the Fc region further comprises an amino acid substitution at position H310 (EU index). In another embodiment, the H310 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at position H435 and D265 (EU index).
- the amino acid substitution at position D265 is D265C or D265A (EU index).
- the H435 amino acid substitution is H435A.
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at positions L234 and L235 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position E233 (EU index).
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises a deletion of G236 (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P331 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index).
- the I253 amino acid substitution is I253A.
- the Fc region further comprises an amino acid substitution at position H310 (EU index).
- the H310 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions L234 and L235 (EU index), and amino acid substitution P329 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position D265 (EU index).
- the D265 amino acid substitution is D265C or D265A (EU index).
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position E233 (EU index).
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises a deletion of G236 (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P331 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index).
- the I253 amino acid substitution is I253A.
- the Fc region further comprises an amino acid substitution at position H310 (EU index).
- the H31 0 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions L234 and L235 (EU index), and amino acid substitution P331 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region further comprises an amino acid substitution at position D265 (EU index).
- the D265 amino acid substitution is D265C or D265A (EU index).
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position E233 (EU index).
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises a deletion of G236 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index).
- the I253 amino acid substitution is I253A.
- the Fc region further comprises an amino acid substitution at position H310 (EU index).
- the H31 0 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions E233 and L234 and L235 (EU index), a deletion of G236 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises an amino acid substitution at position H435 (EU index).
- the H435 amino acid substitution is H435A.
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P331 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index).
- the I253 amino acid substitution is I253A.
- the Fc region further comprises an amino acid substitution at position H310 (EU index).
- the H310 amino acid substitution is H310A.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at positions I253, H31 0 and H345 (EU index).
- the I253 amino acid substitution is I253A.
- the H310 amino acid substitution is H310A.
- the H435 amino acid substitution is H435A.
- the Fc region further comprises an amino acid substitution at position N297 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q (EU index).
- the Fc region further comprises an amino acid substitution at position D265 (EU index).
- the D265 amino acid substitution is D265C or D265A (EU index).
- the Fc region further comprises an amino acid substitution at position E233 (EU index).
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises a deletion of G236 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P329 (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises an amino acid substitution at position N297 (EU index).
- the Fc region further comprises an amino acid substitution at positions L234 and L235 (EU index).
- the L234 amino acid substitution is L234A or L234V.
- the L235 amino acid substitution is L235A.
- the Fc region does not include a substitution at positions L234 and L235 (EU index).
- the N297 amino acid substitution is selected from the group consisting of N297A, N297G and N297Q.
- the Fc region further comprises an amino acid substitution at position E233 (EU index).
- the E233 amino acid substitution is E233P (EU index).
- the Fc region further comprises a deletion of G236 (EU index).
- the Fc region further comprises an amino acid substitution at position P331 (EU index).
- the P331 amino acid substitution is P331 G.
- the Fc region does not include a substitution at position P331 (EU index).
- the Fc region further comprises an amino acid substitution at position P329 (EU index).
- the P329 amino acid substitution is P329G.
- the Fc region does not include a substitution at position P329 (EU index).
- the Fc region further comprises an amino acid substitution at position I253 (EU index).
- the I253 amino acid substitution is I253A.
- the Fc region further comprises an amino acid substitution at position H310 (EU index).
- the H310 amino acid substitution is H310A.
- the antibody, or antigen-binding portion thereof comprises any combination of substitutions to the Fc region as described herein.
- the antibody, or antigen-binding portion thereof further comprises an amino acid substitution at position S239 (EU index).
- S239 amino acid substitution is S239C.
- the antibody, or antigen-binding portion thereof further comprises an amino acid substitution at position H435 (EU index).
- H435 amino acid substitution is H435A.
- the antibody comprises an amino acid substitution H435A and has a decreased half-life relative to an identical intact IgG antibody comprising an unmodified Fc region.
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions L234A, L235A, S239C and D265A (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions L234A, L235A, S239C and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions L234A, L235A, and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions L234A, L235A, and D265A (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions L234A, L235A, S239C and D265A (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions H435A, L234A, L235A, and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297A and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297G and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297Q and D265C (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297A and D265A (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297G and D265A (EU index).
- an antibody, or antigen-binding portion thereof comprising an Fc region, wherein the Fc region comprises amino acid substitutions consisting essentially of amino acid substitutions N297Q and D265A (EU index).
- an antibody, or antigen-binding portion thereof wherein the antibody has a decrease in an effector function defined as a decrease in binding to an Fc gamma receptor (FcyFt) relative to binding of an identical antibody comprising an unmodified Fc region to the FcyFt.
- the decrease in binding is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in antibody binding to a FcyFt relative to binding of the identical antibody comprising an unmodified Fc region to the FcyFt.
- the antibody does not detectably bind the FcyFt.
- antibody binding to the FcyFt is assessed by biolayer interferometry (BLI).
- antibody binding to the FcyFt is assessed using assays known to one of ordinary skill in the art.
- the FcyFt is an FcyR1 receptor.
- the FcyFt receptor is an FcyR2 receptor or an FcyR3 receptor.
- the FcyR2 receptor is FcyR2A, FcyR2B, or FcyR2C.
- the FcyR3 receptor is FcyR3A or FcyR3B.
- the Fc receptor is a human Fc receptor. In other embodiments, the FcyR receptor is a the FcyR2A 167R receptor. In other embodiments, the FcyR receptor is a the FcyR3A 176V receptor. In other embodiments, the FcyR receptor is a the FcyR3A 176F receptor.
- an antibody, or antigen-binding portion thereof wherein the antibody decreases cytokine release in an in vitro cytokine release assay with a decrease in cytokine release of at least 50% relative to cytokine release of an identical antibody comprising an unmodified Fc region.
- the decrease in cytokine release is at least a 60% decrease, at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in cytokine release relative to cytokine release of the identical antibody comprising an unmodified Fc region.
- the antibody does not show detectable cytokine release.
- the in vitro cytokine release assay is a Meso Scale Discovery (MSD) tissue culture (TC) proinflammatory assay.
- the in vitro cytokine release assay is assessed using assays known to one of ordinary skill in the art.
- the antibody decreases mast cell degranulation in an in vitro mast cell degranulation assay with a decrease in mast cell degranulation of at least 50% relative to mast cell degranulation of an identical antibody comprising an unmodified Fc region.
- the decrease in mast cell degranulation is at least a 60% decrease, at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in mast cell degranulation relative to mast cell degranulation of the identical antibody comprising an unmodified Fc region.
- the antibody does not show detectable mast cell derganulation.
- the in vitro mast cell degranulation assay is a beta-hexosaminidase- based mast cell degranulation assay.
- the IgG isotype is an IgG 1 isotype, a lgG2 isotype, a lgG3 isotype, or a lgG4 isotype.
- the antibody is a human antibody, a chimeric or a humanized antibody.
- the antibody is a bispecific antibody.
- the antibody is a monoclonal antibody.
- the antibody is an intact IgG antibody.
- the antibody specifically binds CD1 17, CD45, CD2, CD5, CD137, or CD252.
- an antibody drug conjugate comprising the antibody, or antigen-binding portion thereof, as set for the herein, wherein the antibody, or antigen-binding portion thereof, is conjugated to a cytotoxin via a linker.
- the cytotoxin is an RNA polymerase inhibitor.
- the RNA polymerase inhibitor is an amatoxin.
- the amatoxin is represented by formula (III)
- Ri is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group
- R3 is H, Rc, or RD
- R4, Rs, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD
- RS is OH, NH2, ORc, ORD, NHRC, or NRCRD
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-
- Rc is -L-Z
- RD is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C6 al
- Ri is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group
- R3 is H, Rc, or RD
- R4, Rs, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD
- RS is OH, NH2, ORc, ORD, NHRC, or NRCRD
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-
- Rc is -L-Z
- RD is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C6 al
- the RNA polymerase inhibitor is an amanitin.
- the amanitin is selected from the group consisting of a-amanitin, b-amanitin, y- amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- the cytotoxin selected from the group consisting of an pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, maytansine, a maytansinoid, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an
- the auristatin is MMAE or MMAF.
- the antibody, or antigen-binding portion thereof is conjugated to the cytotoxin via an interchain conjugation to a native hinge cysteine.
- the antibody or antigen-binding portion thereof is conjugated to the cytotoxin by way of a cysteine residue in the Fc domain of the antibody.
- the cysteine residue is introduced by way of an amino acid substitution in the Fc domain of the antibody.
- the amino acid substitution is D265C.
- the amino acid substitution is S239C.
- composition comprising the antibody or ADC of any one of claims 1 to 218, and a pharmaceutically acceptable carrier.
- a method of depleting a population of hematopoietic stem cells (HSC) in a human patient comprising administering to the patient an effective amount of the antibody or ADC as described herein.
- the method comprises administering to the patient a transplant comprising hematopoietic stem cells.
- the transplant is allogeneic.
- the transplant is autologous.
- a method comprising administering to a human patient a transplant comprising hematopoietic stem cells, wherein the patient has been previously administered the antibody or the ADC as described herein, in an amount sufficient to deplete a population of hematopoietic stem cells in the patient.
- the hematopoietic stem cell is a CD1 17+ or CD45+ cell.
- the patient has a blood disease, a metabolic disorder, cancer, or an autoimmune disease, or severe combined immunodeficiency disease (SCID).
- SCID severe combined immunodeficiency disease
- provided herein is a method of treating leukemia in a human patient, said method comprising administering the antibody or ADC as described herein, to the human patient having leukemia.
- a method comprising administering to a human patient a transplant comprising hematopoietic stem cells, wherein the patient has been previously administered the antibody or the ADC as described herein, in an amount sufficient to deplete a population of immune cells in the patient.
- the immune cell is a CD137+, CD2+, or CD5+ cell.
- the immune cell is a T cell.
- composition comprising the antibody or ADC as described herein, wherein the composition comprises less than 25% hydrophobic degradant following thermal stress.
- the composition comprises less than 20% hydrophobic degradant following thermal stress. In another embodiment, the composition comprises less than 15% hydrophobic degradant following thermal stress. In another embodiment, the composition comprises less than 10% hydrophobic degradant following thermal stress. In another embodiment, the composition comprises less than 5% hydrophobic degradant following thermal stress.
- a method of treating a stem cell disorder in a human patient comprising administering to the patient a therapeutically effective amount of an antibody, antigen-binding fragment thereof, or ADC as described herein.
- an immunodeficiency disorder in a human patient, the method comprising administering to the patient a therapeutically effective amount of an antibody, antigen-binding fragment thereof, or ADC as described herein.
- the immunodeficiency disorder is a congenital immunodeficiency or an acquired immunodeficiency.
- a method of treating a metabolic disorder in a human patient comprising administering to the patient a therapeutically effective amount of an antibody, antigen-binding fragment thereof, or ADC as described herein.
- the metabolic disorder is selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy.
- a method of treating an autoimmune disorder in a human patient comprising administering to the patient a therapeutically effective amount of an antibody, antigen-binding fragment thereof, or ADC as described herein.
- the autoimmune disorder is selected from the group consisting of multiple sclerosis, human systemic lupus, rheumatoid arthritis, inflammatory bowel disease, treating psoriasis, Type 1 diabetes mellitus, acute disseminated encephalomyelitis, Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome, aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome, autoimmune oophoritis, Balo disease,
- Behcet's disease bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pemphigoid, coeliac sprue-dermatitis herpetiformis, cold agglutinin disease, CREST syndrome, Degos disease, discoid lupus, dysautonomia, endometriosis, essential mixed cryoglobulinemia, fibromyalgia- fibromyositis, Goodpasture' s syndrome, Grave's disease, Guillain-Barre syndrome, Hashimoto' s thyroiditis, Hidradenitis suppurativa, idiopathic and/or acute thrombocytopenic purpura, idiopathic pulmonary fibrosis, IgA neuropathy, interstitial cystitis, juvenile arthritis, Kawasaki's disease, lichen planus, Lyme disease, Meniere disease
- a method of treating cancer in a human patient comprising administering to the patient a therapeutically effective amount of an antibody, antigen-binding fragment thereof, or ADC as described herein.
- the cancer is selected from the group consisting of leukemia, lymphoma, multiple myeloma, and neuroblastoma.
- the antibody has a decrease in an effector function defined as a decrease in binding to an Fc gamma receptor (FcyR) relative to binding of an identical antibody comprising an unmodified Fc region to the FcyR.
- the decrease in binding is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 1 00% decrease in antibody binding to a FcyR relative to binding of the identical antibody comprising an unmodified Fc region to the FcyR.
- the antibody does not detectably bind the FcyR.
- the FcyR is an FcyR1 receptor, an FcyR2 receptor, or an FcyR3 receptor.
- the FcyR1 receptor is FcyRI A, FcyRI B, or FcyRI C.
- the FcyR1 receptor is FcyR2A, FcyR2B, or FCYR2C.
- the FcyR1 receptor is FcyR3A or FcyR3B.
- the Fc receptor is a human Fc receptor.
- the IgG isotype is an lgG1 isotype, a lgG2 isotype, a lgG3 isotype, or a lgG4 isotype.
- the antibody is a human antibody.
- the antibody is a chimeric or humanized antibody.
- the antibody is a monoclonal antibody.
- the antibody specifically binds CD1 17, CD45
- CD2 CD5, CD137, or CD252.
- an antibody drug conjugate comprising any of the antibodies herein, wherein the antibody is conjugated to a cytotoxin via a linker.
- the cytotoxin is an RNA polymerase inhibitor. In some embodiments, the RNA polymerase inhibitor is an amatoxin.
- amatoxin is represented by formula (IA)
- RA and RB together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocyclolalkyl group
- R3 is H, Rc, or RD
- R4, R5, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD;
- Re is OH, NH2, ORc, ORD, NHRC, or NRCRD;
- R9 is H, OH, ORc, or ORD
- RD is optionally substituted C1 -C6 alkyl, optionally substituted C1 -C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C6 alkynyl, optionally substituted C2-C6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl ;
- L is optionally substituted C1 -C6 alkylene, optionally substituted C1 -C6 heteroalkylene, optionally substituted C2-C6 alkenylene, optionally substituted C2-C6 heteroalkenylene, optionally substituted C2-C6 alkynylene, optionally substituted C2-C6 heteroalkynylene, optionally substituted cycloalkylene, optionally substituted heterocycloalkylene, optionally substituted arylene, or optionally substituted heteroarylene; and
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
- amatoxin is represented by formula (IB)
- RA and RB together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocyclolalkyl group
- R3 is H, Rc, or RD
- R4, R5, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD;
- Re is OH, NH2, ORc, ORD, NHRC, or NRCRD;
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-;
- Rc is -L-Z
- RD is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C6 alkynyl, optionally substituted C2-C6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl ;
- L is optionally substituted C1-C6 alkylene, optionally substituted C1-C6 heteroalkylene, optionally substituted C2-C6 alkenylene, optionally substituted C2-C6 heteroalkenylene, optionally substituted C2-C6 alkynylene, optionally substituted C2-C6 heteroalkynylene, optionally substituted cycloalkylene, optionally substituted heterocycloalkylene, optionally substituted arylene, or optionally substituted heteroarylene; and
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
- the RNA polymerase inhibitor is an amanitin.
- the amanitin is selected from the group consisting of a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- the cytotoxin selected from the group consisting of an pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, maytansine, a maytansinoid, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a
- the auristatin is MMAE or MMAF.
- the antibody is conjugated to the toxin by way of a cysteine residue in the Fc domain of the antibody.
- the cysteine residue is introduced by way of an amino acid substitution in the Fc domain of the antibody.
- the amino acid substitution is D265C.
- composition comprising an antibody or ADC described herein, and a pharmaceutically acceptable carrier.
- HSC hematopoietic stem cells
- the method further comprises administering to the patient a transplant comprising hematopoietic stem cells.
- the transplant is allogeneic. In some embodiments, the transplant is autologous.
- a method comprising administering to a human patient a transplant comprising hematopoietic stem cells, wherein the patient has been previously administered an antibody or the ADC described herein in an amount sufficient to deplete a population of hematopoietic stem cells in the patient.
- the patient has a blood disease, a metabolic disorder, cancer, or an autoimmune disease, or severe combined immunodeficiency disease (SCID).
- SCID severe combined immunodeficiency disease
- a method of treating leukemia in a human patient comprising administering an antibody or ADC described herein to the human patient having leukemia.
- a method of depleting a population of CD1 17+ cells in a human patient in need thereof comprising administering to the patient an effective amount of an anti- CD1 17 antibody drug conjugate (ADC), wherein the antibody drug conjugate (ADC) is comprises an anti- CD1 17 antibody conjugated to an amatoxin via a linker and is represented by the formula Ab-Z-L-Am, wherein Ab is an anti-CD1 17 antibody comprising an H435A mutation (EU index) in the Fc region of the antibody, L is a linker, Z is a chemical moiety, and Am is an amatoxin.
- ADC anti- CD1 17 antibody drug conjugate
- the ADC is administered prior to the patient receiving a transplant comprising hematopoietic stem cells. In another embodiment, the ADC is administered concommittanlty with the patient receiving a transplant comprising hematopoietic stem cells.
- an anti-CD1 17 antibody drug conjugate in an amount sufficient to deplete a population of CD1 17+ cells in the patient in need thereof, wherein the antibody drug conjugate (ADC) is comprises an anti-CD1 17 antibody conjugated to an amatoxin via a linker and is represented by the formula Ab-Z-L-Am, wherein Ab is an anti- CD1 17 antibody comprising an H435A mutation (EU index) in the Fc region of the antibody, L is a linker, Z is a chemical moiety, and Am is an amatoxin; and subsequently administering to the patient a transplant comprising hematopoietic stem cells.
- ADC anti-CD1 17 antibody drug conjugate
- the transplant comprising hematopoietic stem cells is administered to the patient after the concentration of the ADC has substantially cleared from the blood of the patient.
- the hematopoietic stem cells or progeny thereof maintain hematopoietic stem cell functional potential after two or more days following transplantation of the hematopoietic stem cells into the patient.
- the hematopoietic stem cells or progeny thereof are capable of localizing to hematopoietic tissue and/or reestablishing hematopoiesis following transplantation of the hematopoietic stem cells into the patient.
- the patient has a disorder selected from the group consisting of adenosine deaminase deficiency and severe combined immunodeficiency, hyper immunoglobulin M syndrome, Chediak-Higashi disease, hereditary
- the patient has an autoimmune disorder or a hematological cancer.
- the autoimmune disorder is selected from the group consisting of multiple sclerosis, human systemic lupus, rheumatoid arthritis, inflammatory bowel disease, treating psoriasis, Type 1 diabetes mellitus, acute disseminated encephalomyelitis, Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome, aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome, autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pemphigoid, coeliac sprue-dermatitis herpetiformis, cold agglutinin disease, CREST syndrome, Degos disease
- a method of treating a human subject having a hematological cancer comprising administering an effective amount of an anti-CD1 17 antibody drug conjugate (ADC) to the human subject having the hematological cancer, wherein the antibody drug conjugate (ADC) is comprises an anti-CD1 17 antibody conjugated to an amatoxin via a linker and is represented by the formula Ab-Z-L- Am, wherein Ab is an anti-CD1 17 antibody comprising an H435A mutation (EU index) in the Fc region of the antibody, L is a linker, Z is a chemical moiety, and Am is an amatoxin.
- ADC anti-CD1 17 antibody drug conjugate
- the antibody drug conjugate (ADC) is comprises an anti-CD1 17 antibody conjugated to an amatoxin via a linker and is represented by the formula Ab-Z-L- Am, wherein Ab is an anti-CD1 17 antibody comprising an H435A mutation (EU index) in the Fc region of the antibody, L is a linker, Z
- the Fc region of the anti-CD1 17 antibody comprises a D265C mutation (EU index).
- the anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 7, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO:8, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 9; and comprising a light chain variable region comprising a CDR1 comprising the amino acid sequence as set forth in SEQ ID NO: 10, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO:1 1 , and a CDR3 comprising the amino acid sequence as set forth in SEQ ID NO: 12.
- the anti-CD1 17 antibody comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 13, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 14.
- the ADC is internalized by a cancer cell, autoimmune cell, or hematopoietic stem cell following administration to the patient.
- the Am-L-Z is represented by formula (I)
- Ri is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group
- Fh is H, Rc, or RD
- R4, Rs, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD
- Re is OH, NH2, ORc, ORD, NHRC, or NRCRD
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-
- Rc is -L-Z
- RD is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C
- R1 is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group
- R3 is H, Rc, or RD
- R4, Rs, R6, and R7 are each independently H, OH, ORc, ORD, RC, or RD
- Re is OH, NH2, ORc, ORD, NHRC, or NRCRD
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-
- Rc is -L-Z
- RD is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-
- Figs. 1 A - 1 E graphically depict the results of a standard bio-layer interferometery (BLI) assay to assess the binding response of antibodies having the indicated amino acid substitutions to Fc gamma receptors indicated in the legend.
- the normalized binding response of each anti-CD1 17 antibody variant relative to WT IgG 1 binding is shown in Fig. 1 A and quantification of the normalized binding response of each anti-CD1 17 antibody variant is shown in Fig. 1 B.
- Fig. 1C depicts the quantification of the normalized binding responses of anti-CD45 antibody variants relative to WT anti-CD45 antibody binding (Fig. 1C;“ic” as used herein refers to interchain conjugates to native hinge cysteines).
- Fig. 1 D The normalized binding response of additional anti-CD1 17 antibody variants relative to WT lgG1 (isotype control) binding is shown in Fig. 1 D and quantification of the normalized binding response of each anti-CD1 17 antibody variant is shown in Fig. 1 E.
- Fig. 2 graphically depicts the results of a mast cell degranulation assay, in which Beta- hexosaminidase was measured following incubation of mast cells with the indicated antibodies. Beta- hexosaminidase release from mast cells was measured by monitoring para-nitrophenol production from 4- Nitrophenyl N-acetyl-p-D-glucosaminide substrate and is presented as the absorbance of para-nitrophenol at 405 nm on the y-axis.
- Figs. 3A, 3B, 3C, 3D and 3E graphically depicts the results of an in vitro cytokine release assay to measure the release of IL-6 (Fig. 3A), IL-8 (Fig. 3B), TNFa (Fig. 3C), IL-1 B (Fig. 3D) and GM-CSF (Fig. 3E) from human peripheral blood mononuclear cells (PBMC) following incubation with the indicated antibodies.
- PBMC peripheral blood mononuclear cells
- Figs. 4A and 4B graphically depict the results of an in vitro antibody-dependent cellular phagocytosis (ADCP) assay that shows a reduction in ADCP activity due to Fc effector silencing in certain Fc variants in comparison to the controls.
- Fig. 4A depicts results of flow cytometry analysis of the co expression of CFSE and CD134 staining.
- Fig. 4B depicts results of incubating a mixture of MDM and Kasumi-1 cells (1 :2 molar ratio) for two hours at 37°C with increasing concentrations of the indicated antibody.
- Figs. 5A, 5B and 5C depict chromatograms demonstrating the results of a thermostability assay in which the melting temperature of each indicated antibody was assessed.
- Figs. 6A and 6B are tables showing the Tm 1 (CFI2 Unfolding) and Tm2 (fab/CFI3 unfolding) melting temperature for each indicated antibody as determined in the thermostability assay depicted in Fig. 5A (see Fig. 6A) and Figs. 5B and 5C (see Fig. 6B).
- Figs. 8A - 8E graphically depicts the results of the HIC assays of Figs. 7A and 7B, showing the percent area of the antibody monomer (i.e. ,“Main”) peak (Figs. 8A and 8D) or hydrophobic degradant peak (Figs. 8B, 8C and 8E) for the indicated antibodies after exposure to stressed or non-stressed conditions.
- the percent area of the antibody monomer i.e. ,“Main”
- Figs. 8B, 8C and 8E hydrophobic degradant peak
- Figs. 10A and 10B graphically depict the results of a non-human primate pharmacokinetic assay expressed as the concentration (ng/ml_) of an engineered fast half-life anti-CD1 17-amatoxin ADC at varying doses (0.1 mg/kg and 0.3 mg/kg) as a function time (i.e., hours post-administration; x-axis).
- Fig. 10B illustrates that the timing of ADC-mediated depletion and clearance provides a window for transplant conditioning post-administration.
- Figs. 11 A-11 E graphically depict the results of assays detecting the depletion of phenotypic hematopoietic stem cells (i.e., CD34+ CD90+ CD45RA- HSCs) using flow cytometry (Figs. 11 A and Fig.
- FIG. 11 C shows an assessment of colony forming units from the bone marrow aspirate (Figs. 11 B and Fig. 11 D) as a function of varying doses of the ADC1 antibody drug conjugate (ADC) versus a control (i.e., PBS) (x-axis).
- Figs. 11 C and 11 D further show data corresponding to the unconjugated anti-CD1 17 antibody (“anti- CD1 17”).
- Fig. 11 E shows a phenotypic analysis of bone marrow hematopoietic stem cells (treated versus untreated) using flow cytometry (at day 7 post-dose administration).
- Figs. 12A-12C graphically depict the results of assays detecting (Fig. 12A) the neutrophil count (10 3 /mL) and (Figs. 12B and 12C) the lymphocyte count (10 3 /mL) as a function of days post dose administration of varying doses of the ADC1 antibody drug conjugate (ADC) versus a control (i.e., PBS).
- ADC ADC1 antibody drug conjugate
- Fig. 12C further shows data corresponding to the lymphocyte count for cynomolgus monkeys administered an unconjugated anti-CD1 17 antibody (“anti-CD1 17”).
- Figs. 13A-13C graphically depict the results of assays detecting levels of (Figs. 13A and 13C) plasma alanine aminotransaminase (ALT ; in U/mL) and (Fig. 13B) plasma bilirubin (in U/mL) as a function of days post dose administration of varying doses of the ADC1 antibody drug conjugate (ADC) versus a control (i.e., PBS).
- Fig. 13C further shows data corresponding to the plasma levels of ALT in cynomolgus monkeys administered an unconjugated anti-CD1 17 antibody (“anti-CD117”).
- Fig. 14 shows images of liver and kidney tissue isolated from cynomolgus monkeys 35 days post- administration of ADC1 (0.3 mg/kg) or a control (PBS).
- Fig. 15 graphically depicts the results of an assay detecting reticulocyte count (10 9 /mL) as a function of days post dose administration of varying doses (0.1 mg/kg or 0.3 mg/kg) of an ADC1 antibody drug conjugate versus a control (i.e. , PBS) or an unconjugated anti-CD1 17 antibody.
- antibodies, and conjugates thereof having modified Fc regions, wherein the modifications decrease or substantially eliminate antibody effector functions.
- the modifications to the Fc region may further permit antibody-drug conjugation and/or decrease the half-life of the antibody.
- the interaction of antibodies and antibody-antigen complexes with cells of the immune system may effect a variety of responses, including antibody-dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- Binding of the Fc region of an antibody to Fc receptors on a cell surface may trigger a number of biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (i.e., ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
- ADCC killer cells
- the presently disclosed antibodies can, for example, advantageously avoid triggering various immune system reactions (e.g., avoid cytokine release or avoid mast cell-degranulation) that can be detrimental in certain therapies, e.g., hematopoietic stem cell therapies (for example, hematopoietic stem cell transplant therapy) and depletion of hematopoietic cells (e.g., for treatment of blood cancers, immune system diseases and disorders, autoimmune diseases, graft-versus-host disease, etc.).
- hematopoietic stem cell therapies for example, hematopoietic stem cell transplant therapy
- depletion of hematopoietic cells e.g., for treatment of blood cancers, immune system diseases and disorders, autoimmune diseases, graft-versus-host disease, etc.
- anti-hematopoietic cell antibodies also referred to as anti-HC antibodies
- the antibodies or ADCs herein are useful in conditioning procedures, in which a patient is prepared for receipt of a transplant comprising hematopoietic stem cells. Such procedures promote the engraftment of a hematopoietic stem cell transplant.
- a patient may be conditioned (for example for hematopoietic stem cell transplant therapy or immune system reset) by administration to the patient of an ADC, an antibody, or an antigen-binding fragment thereof, capable of binding an antigen expressed by hematopoietic cells (e.g., hematopoietic stem cells, e.g., hematopoietic stem cells and or mature immune cells (e.g., T cells)), such as CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, CD252 and combinations thereof.
- the antibodies or ADCs contemplated herein may be used for the treatment of diseases or disorders of the hematopoietic system.
- the antibodies or ADCs contemplated herein may be used for the treatment of blood cancers.
- the antibodies or ADCs contemplated herein may be used for the treatment of graft-versus-host disease (“GvHD”).
- the antibodies or ADCs contemplated herein may be used for the treatment of a T-cell-mediated disease or disorder.
- the antibody may be covalently conjugated to a cytotoxin so as to form an antibody drug conjugate (ADC).
- Administration of an ADC, an antibody, or an antigen-binding fragment thereof, capable of binding one or more of the foregoing antigens to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a vacancy filled by an exogenous hematopoietic stem cell transplant.
- the invention provides isolated anti-CD1 17 antibodies, specifically isolated human anti-CD1 17 antibodies, that bind to the ectodomain of human CD1 17, wherein the isolated anti- CD1 17 antibodies have modified Fc regions, wherein the modifications decrease or substantially eliminate antibody effector functions.
- the binding regions of the isolated anti-CD1 17 antibodies identified herein are described below.
- the sections that follow provide a description of the antibodies, or conjugates thereof, that can be administered to a patient, such as a patient suffering from a cancer or autoimmune disease, or a patient in need of hematopoietic stem cell transplant therapy in order to promote engraftment of hematopoietic stem cell grafts, as well as methods of administering such therapeutics to a patient (e.g., prior to hematopoietic stem cell transplantation).
- the term“about” refers to a value that is within 5% above or below the value being described.
- the term“allogeneic”, when used in the context of transplantation, is used to define cells (or tissue or an organ) that are transplanted from a donor to a recipient of the same species but who is genetically different.
- the term“allogeneic cells” refers to cell types that are genetically distinct between two individuals, yet belong to the same species, e.g., human.
- the term“allogeneic” is used to define cells, such as stem cells, that are transplanted from a donor to an unrelated recipient of the same species.
- autologous refers to cells or a graft where the donor and recipient are the same subject.
- xenogeneic refers to cells where the donor and recipient species are different.
- Immune cell is intended to include, but is not limited to, a cell that is of hematopoietic origin and that plays a role in the immune response.
- Immune cells include, but are not limited to, T cells and natural killer (NK) cells. Natural killer cells are well known in the art.
- natural killer cells include cell lines, such as NK-92 cells. Further examples of NK cell lines include NKG, YT, NK-YS, HANK-1 , YTS cells, and NKL cells.
- An immune cell can be allogeneic or autologous.
- an antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen.
- An antibody includes, but is not limited to, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), genetically engineered antibodies, and otherwise modified forms of antibodies, including but not limited to chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad-specific antibodies, diabodies, triabodies, and tetrabodies), and antibody fragments (i.e. , antigen binding fragments of antibodies), including, for example, Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments, so long as they exhibit the desired antigen-binding activity.
- the antibodies of the present disclosure are generally isolated or recombinant.
- isolated when used herein refers to a polypeptide, e.g., an antibody, that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Ordinarily, an isolated antibody will be prepared by at least one purification step. Thus, an “isolated antibody,” refers to an antibody which is substantially free of other antibodies having different antigenic specificities. For instance, an isolated antibody that specifically binds to CD1 17 is substantially free of antibodies that specifically bind antigens other than CD1 17.
- monoclonal antibody refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, by any means available or known in the art, and is not limited to antibodies produced through hybridoma technology.
- Monoclonal antibodies useful with the present disclosure can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
- mAb monoclonal antibody
- mAb monoclonal antibody
- Fab and F(ab')2 fragments refer to antibody fragments that lack the Fc fragment of an intact antibody.
- an antibody fragment comprises an Fc region.
- antibodies comprise heavy and light chains containing antigen binding regions.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- antigen-binding fragment refers to one or more portions of an antibody that retain the ability to specifically bind to a target antigen.
- the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- the antibody fragments can be, for example, a Fab, F(ab’)2, scFv, diabody, a triabody, an affibody, a nanobody, an aptamer, or a domain antibody.
- binding fragments encompassed of the term“antigen-binding fragment” of an antibody include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VFI and CH1 domains; (iv) a Fv fragment consisting of the VL and VFI domains of a single arm of an antibody, (v) a dAb including VFI and VL domains; (vi) a dAb fragment that consists of a VH domain (see, e.g., Ward et al., Nature 341 :544-546, 1 989); (vii) a dAb which consists of a VH or a VL domain; (viii) an isolated complementarity determining region (C
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al., Science 242:423-426, 1 988 and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
- scFv single chain Fv
- These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies.
- Antigen-binding fragments can be produced by recombinant DNA techniques, enzymatic or chemical cleavage of intact immunoglobulins, or, in certain cases, by chemical peptide synthesis procedures known in the art.
- an antigen-binding fragment of an antibody comprises an Fc region.
- anti-CD1 17 antibody or “an antibody that binds to CD1 17” refers to an antibody that is capable of binding CD1 17 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD1 17.
- anti-CD45 antibody or “an antibody that binds to CD45” refers to an antibody that is capable of binding CD45 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD45.
- anti-CD2 antibody or “an antibody that binds to CD2” or an“anti-CD2 ADC” or“an ADC that binds to CD2” refers to an antibody or ADC that specifically binds to human CD2 as CD2 is found on the cell surface of cells, such as T cells.
- an“anti-CD5 antibody” or “an antibody that binds to CD5" or an“anti-CD5 ADC” or“an ADC that binds to CD5” refers to an antibody or ADC that specifically binds to human CD5 as CD5 is found on the cell surface of cells, such as T cells.
- anti-CD137 antibody or an“antibody that binds to CD137” refers to an antibody that is capable of binding CD137 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD137.
- the term“anti-CD252 antibody” or an“antibody that binds to CD252” refers to an antibody that is capable of binding CD252 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD252.
- the antibody specifically binds to human CD252 (hCD252).
- CD252 is found on antigen presenting cells.
- the term“bispecific antibody” refers to, for example, a monoclonal, e.g., a human or humanized antibody, that is capable of binding at least two different antigens or two different epitopes.
- one of the binding specificities can be directed towards an epitope on a hematopoietic stem cell surface antigen, CD1 17 (e.g., GNNK+ CD1 17), and the other can specifically bind an epitope on a different hematopoietic stem cell surface antigen or another cell surface protein, such as a receptor or receptor subunit involved in a signal transduction pathway that potentiates cell growth, among others.
- the binding specificities can be directed towards unique, non-overlapping epitopes on the same target antigen (i.e. , a biparatopic antibody).
- An“intact” or“full length” antibody refers to an antibody having two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- CDR complementarity determining region
- FRs framework regions
- the amino acid positions that delineate a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions.
- variable domains of native heavy and light chains each contain four framework regions that primarily adopt a b-sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the b-sheet structure.
- the CDRs in each chain are held together in close proximity by the framework regions in the order FR1 -CDR1 -FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody chains, contribute to the formation of the target binding site of antibodies (see Kabat et al. , Sequences of Proteins of
- numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino acid residue numbering system of Kabat et al., unless otherwise indicated (although any antibody numbering scheme, including, but not limited to IMGT and Chothia, can be utilized).
- thermal stress refers to stress created by any change in temperature to a molecule, e.g., an antibody, an Fc containing antigen-binding fragment thereof, or an ADC.
- thermal stress is incubation of an antibody, an Fc contianing antigen-binding fragment thereof, or an ADC at 60 degrees Celsius for 30 minutes.
- the term "specifically binds”, as used herein, refers to the ability of an antibody (or ADC) to recognize and bind to a specific protein structure (epitope) rather than to proteins generally. If an antibody is specific for epitope "A", the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled "A” and the antibody, will reduce the amount of labeled A bound to the antibody. By way of example, an antibody "binds specifically" to a target if the antibody, when labeled, can be competed away from its target by the corresponding non-labeled antibody.
- an antibody specifically binds to a target, e.g., an antigen expressed by hematopoietic stem cells, such as CD1 1 7 (e.g., GNNK+ CD1 1 7), or CD45; or an antigen expressed by mature immune cells (e.g., T-cells), such as CD45, CD2, CD5, CD137, or CD252, if the antibody has a for the target of at least about 10 -4 M, 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 1 0 -9 M, 10 10 M, 10 1 1 M, 10 12 M, or less (less meaning a number that is less than 10 -12 , e.g. 10 -13 ).
- a target e.g., an antigen expressed by hematopoietic stem cells, such as CD1 1 7 (e.g., GNNK+ CD1 1 7), or CD45; or an antigen expressed by mature immune cells (e.g., T-cells), such as CD45
- the term“specifically binds” refers to the ability of a antibody to bind to an antigen with an Kd of at least about 1 x10 6 M, 1 x10 7 M, 1 x10 8 M, 1 x10 9 M, 1 x10 10 M, 1 x 10 _1 1 M, 1 x1 0 12 M, or more and/or bind to an antigen with an affinity that is at least two-fold greater than its affinity for a nonspecific antigen. In one embodiment, is determined according to standard bio-layer interferometery (BLI). It shall be understood, however, that the antibody may be capable of specifically binding to two or more antigens which are related in sequence.
- BBI bio-layer interferometery
- an antibody can specifically bind to both human and a non-human (e.g., mouse or non-human primate) orthologs of an antigen, e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252.
- a non-human e.g., mouse or non-human primate
- an antigen e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252.
- chimeric antibody refers to an antibody having variable sequences derived from a non-human immunoglobulin, such as a rat or a mouse antibody, and human immunoglobulin constant regions, typically chosen from a human immunoglobulin template.
- Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, 1 985, Science 229(4719):1202-7; Oi et al., 1986, BioTechniques 4:214-221 ; Gillies et al., 1985, J. Immunol. Methods 125:191 -202; U.S. Pat. Nos. 5,807,715; 4,81 6,567; and 4,816,397.
- Fc refers to the portion of an immunoglobulin, e.g., an IgG molecule, that correlates to a crystallizable fragment obtained by papain digestion of an IgG molecule.
- the Fc region comprises the C-terminal half of two heavy chains of an IgG molecule that are linked by disulfide bonds. It has no antigen binding activity but contains the carbohydrate moiety and binding sites for complement and Fc receptors, including the FcFtn receptor (see below).
- an Fc domain contains the second constant domain CH2 (e.g., residues at EU positions 231 -340 of human lgG1 ) and the third constant domain CH3 (e.g., residues at EU positions 341 -447 of human lgG1 ).
- the Fc domain includes the“lower hinge region” (e.g., residues at EU positions 233-239 of lgG1 ).
- Fc can refer to this region in isolation, or this region in the context of an antibody, antibody fragment, or Fc fusion protein. Polymorphisms have been observed at a number of positions in Fc domains, including but not limited to EU positions 270, 272, 312, 315, 356, and 358, and thus slight differences between the sequences presented in the instant application and sequences known in the art can exist. Thus, a "wild type IgG Fc domain" or “WT IgG Fc domain” refers to any naturally occurring IgG Fc region (i.e., any allele).
- sequences of the heavy chains of human lgG1 , lgG2, lgG3 and lgG4 can be found in a number of sequence databases, for example, at the Uniprot database (www.uniprot.org) under accession numbers P01857 (IGHG1_HUMAN), P01859 (IGHG2_HUMAN), P01860 (IGHG3_HUMAN), and P01861 (IGHG1_HUMAN), respectively.
- An example of a“WT” Fc region is provided in SEQ ID NO: 1 5 (which provides a heavy chain constant region containing an Fc region).
- modified Fc region or "variant Fc region” as used herein refers to an IgG Fc domain comprising one or more amino acid substitutions, deletions, insertions or modifications introduced at any position within the Fc domain.
- a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc gamma R and/or C1 q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- an antibody comprising a variant Fc domain can exhibit altered binding affinity for at least one or more Fc ligands (e.g., Fc gamma Rs) relative to a corresponding antibody otherwise having the same amino acid sequence but not comprising the one or more amino acid substitution, deletion, insertion or modifications such as, for example, an unmodified Fc region containing naturally occurring amino acid residues at the corresponding position in the Fc region.
- Fc ligands e.g., Fc gamma Rs
- the variant Fc domains described herein are defined according to the amino acid modifications that compose them. For all amino acid substitutions discussed herein in regard to the Fc region, numbering is always according to the EU index as in Kabat.
- D265C is an Fc variant with the aspartic acid (D) at EU position 265 substituted with cysteine (C) relative to the parent Fc domain.
- D265C/L234A/L235A defines a variant Fc variant with substitutions at EU positions 265 (D to C), 234 (L to A), and 235 (L to A) relative to the parent Fc domain.
- a variant can also be designated according to its final amino acid composition in the mutated EU amino acid positions.
- the L234A.L235A mutant can be referred to as“LALA”.
- the E233P.L234V.L235A.delG236 (deletion of 236) mutant can be referred to as“EPLVLAdeIG”.
- the I253A.H310A.H435A mutant can be referred to as ⁇ HH”. It is noted that the order in which substitutions are provided is arbitrary.
- Fc gamma receptor or “Fc gamma R” as used herein refer to any member of the family of proteins that bind the IgG antibody Fc region and are encoded by the Fc. gamma. R genes. In humans this family includes but is not limited to Fc.gamma.RI (CD64), including isoforms Fc. gamma. Rla, Fc.gamma.RIb, and Fc.gamma.RIc; Fc.gamma.RII (CD32), including isoforms Fc.gamma.Rlla (including allotypes H131 and R131 ), Fc. gamma.
- Fc.gamma receptor or "Fc gamma R” as used herein refer to any member of the family of proteins that bind the IgG antibody Fc region and are encoded by the Fc. gamma. R genes. In humans this family includes but is not limited to Fc.gamma.RI (CD64), including isoforms F
- Rllb (including Fc.gamma.Rllb-1 and Fc.gamma.Rllb-2), and Fc.gamma.Rllc; and Fc.gamma.RIII (CD16), including isoforms Fc. gamma. Rllla (including allotypes V158 and F158) and Fc.gamma.Rlllb (including allotypes Fc.gamma.Rlllb-NA1 and Fc. gamma. Rlllb-NA2), as well as any undiscovered human Fc.gamma.Rs or Fc. gamma. R isoforms or allotypes. An Fc. gamma.
- Mouse Fc.gamma.Rs include but are not limited to Fc.gamma.RI (CD64), Fc.gamma.RII (CD32), Fc. gamma. Rill (CD16), and Fc.gamma.RIII-2 (CD16-2), as well as any undiscovered mouse Fc.gamma.Rs or Fc.gamma.R isoforms or allotypes.
- effector function refers to a biochemical event that results from the interaction of an Fc domain with an Fc receptor. Effector functions include but are not limited to ADCC, ADCP, and CDC.
- effector cell as used herein is meant a cell of the immune system that expresses or one or more Fc receptors and mediates one or more effector functions. Effector cells include but are not limited to monocytes, macrophages, neutrophils, dendritic cells, eosinophils, mast cells, platelets, B cells, large granular lymphocytes, Langerhans' cells, natural killer (NK) cells, and .gamma. delta. T cells, and can be from any organism included but not limited to humans, mice, rats, rabbits, and monkeys.
- the term“silent”,“silenced”, or“silencing” as used herein refers to an antibody having a modified Fc region described herein that has decreased binding to an Fc gamma receptor (FcyR) relative to binding of an identical antibody comprising an unmodified Fc region to the FcyR (e.g., a decrease in binding to a FcyR by at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% relative to binding of the identical antibody comprising an unmodified Fc region to the FcyR as measured by, e.g., BLI).
- the Fc silenced antibody has no detectable binding to an FcyR.
- Binding of an antibody having a modified Fc region to an FcyR can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORE.RTM. analysis or Octet.RTM.
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)
- a surface plasmon resonance assay e.g., BIACORE.RTM. analysis or Octet.RTM.
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis.
- Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- the term“identical antibody comprising an unmodified Fc region” refers to an antibody that lacks the recited amino acid substitutions (e.g., D265C, L234A, L235A, and/or H435A), but otherwise has the same amino acid sequence as the Fc modified antibody to which it is being compared.
- ADCC antibody-dependent cell-mediated cytotoxicity
- a polypeptide comprising an Fc domain e.g., an antibody
- FcRs Fc receptors
- cytotoxic cells e.g., primarily NK cells, neutrophils, and macrophages
- ADCC activity the cell-mediated cytotoxicity resulting from the activity of a polypeptide comprising an Fc domain.
- a polypeptide of interest e.g., an antibody
- immune effector cells e.g., an antibody
- Cytolysis is generally detected by the release of label (e.g., radioactive substrates, fluorescent dyes or natural intracellular proteins) from the lysed cells.
- label e.g., radioactive substrates, fluorescent dyes or natural intracellular proteins
- useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- ADCC activity of the antibody of interest can be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al., Proc. Natl. Acad. Sci. USA 95:652 (1998).
- condition and“conditioning” refer to processes by which a patient is prepared for receipt of a transplant, e.g., a transplant containing hematopoietic stem cells. Such procedures promote the engraftment of a hematopoietic stem cell transplant (for instance, as inferred from a sustained increase in the quantity of viable hematopoietic stem cells within a blood sample isolated from a patient following a conditioning procedure and subsequent hematopoietic stem cell transplantation.
- a patient may be conditioned for hematopoietic stem cell transplant therapy by administration to the patient of an ADC, an antibody or antigen-binding fragment thereof capable of binding an antigen expressed by hematopoietic stem cells, such as CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252.
- an antibody or antigen-binding fragment thereof capable of binding an antigen expressed by hematopoietic stem cells, such as CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252.
- the antibody may be covalently conjugated to a cytotoxin so as to form an ADC.
- Administration of an antibody, antigen-binding fragment thereof, or an ADC capable of binding one or more of the foregoing antigens to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a vacancy filled by an exogenous hematopoietic stem cell transplant.
- the term“effective amount” or“therapeutically effective amount” refers to an amount that is sufficient to achieve the desired result or to have an effect on an autoimmune disease or cancer.
- the term“half-life” refers to the time it takes for the plasma concentration of the antibody drug in the body to be reduced by one half or 50%. This 50% reduction in serum concentration reflects the amount of drug circulating.
- the term“human antibody” is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. A human antibody may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or during gene rearrangement or by somatic mutation in vivo).
- human antibody is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a human antibody can be produced in a human cell (for example, by recombinant expression) or by a non-human animal or a prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (such as heavy chain and/or light chain) genes.
- a human antibody is a single chain antibody, it can include a linker peptide that is not found in native human antibodies.
- an Fv can contain a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain.
- linker peptides are considered to be of human origin.
- Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences. Human antibodies can also be produced using transgenic mice that are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes (see, for example, PCT Publication Nos. WO 1998/24893; WO 1992/01047; WO 1996/34096; WO 1996/33735; U.S. Patent Nos. 5,413,923; 5,625,126; 5,633,425;
- Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins that contain minimal sequences derived from non-human immunoglobulin.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
- Fc immunoglobulin constant region
- the term“engraftment potential” is used to refer to the ability of hematopoietic stem and progenitor cells to repopulate a tissue, whether such cells are naturally circulating or are provided by transplantation.
- the term encompasses all events surrounding or leading up to engraftment, such as tissue homing of cells and colonization of cells within the tissue of interest.
- the engraftment efficiency or rate of engraftment can be evaluated or quantified using any clinically acceptable parameter as known to those of skill in the art and can include, for example, assessment of competitive repopulating units (CRU);
- Engraftment can also be determined by measuring white blood cell counts in peripheral blood during a post-transplant period. Engraftment can also be assessed by measuring recovery of marrow cells by donor cells in a bone marrow aspirate sample.
- HSCs hematopoietic stem cells
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.g., reticulocytes, erythrocytes
- thrombocytes e.g., megakaryoblasts, platelet producing megakaryocytes, platelets
- monocytes e.g., monocytes, macrophages
- dendritic cells e.g., NK cells, B cells and T cells.
- Such cells may include CD34 + cells.
- CD34 + cells are immature cells that express the CD34 cell surface marker.
- CD34+ cells are believed to include a subpopulation of cells with the stem cell properties defined above, whereas in mice, HSCs are CD34-.
- HSCs also refer to long term repopulating HSCs (LT-HSC) and short term repopulating HSCs (ST- HSC).
- LT-HSCs and ST-HSCs are differentiated, based on functional potential and on cell surface marker expression.
- human HSCs are CD34+, CD38-, CD45RA-, CD90+, CD49F+, and lin- (negative for mature lineage markers including CD2, CD3, CD4, CD7, CD8, CD10, CD1 1 B, CD19, CD20, CD56, CD235A).
- bone marrow LT-HSCs are CD34-, SCA-1 +, C-kit+, CD135-, Slamfl/CD150+, CD48-, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL7ra), whereas ST-HSCs are CD34+, SCA-1 +, C-kit+, CD135-, Slamfl/CD150+, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL7ra).
- ST-HSCs are less quiescent and more proliferative than LT-HSCs under homeostatic conditions.
- LT-HSC have greater self-renewal potential (i.e. , they survive throughout adulthood, and can be serially transplanted through successive recipients), whereas ST-HSCs have limited self-renewal (i.e., they survive for only a limited period of time, and do not possess serial transplantation potential). Any of these HSCs can be used in the methods described herein.
- ST-HSCs are particularly useful because they are highly proliferative and thus, can more quickly give rise to differentiated progeny.
- anti-hematopoietic cell antibody or“anti-HC antibody” refers to an antibody that specifically binds an antigen expressed by hematopoietic stem cells, such as CD1 1 7 (e.g., GNNK+ CD1 17), or CD45; or an antigen expressed by mature immune cells (e.g., T-cells) such as CD45, CD2, CD5, CD137, or CD252.
- hematopoietic stem cell functional potential refers to the functional properties of hematopoietic stem cells which include 1 ) multi-potency (which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, T cells and B cells), 2) self-renewal (which refers to the ability of hematopoietic stem cells to give rise to daughter cells that have equivalent potential as the mother cell, and further that this ability can repeatedly occur
- multi-potency which
- the terms“subject” and“patient” refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein.
- a patient such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
- the term“donor” refers to a human or animal from which one or more cells are isolated prior to administration of the cells, or progeny thereof, into a recipient.
- the one or more cells may be, for example, a population of hematopoietic stem cells.
- the term“diabody” refers to a bivalent antibody containing two polypeptide chains, in which each polypeptide chain includes VH and VL domains joined by a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of VH and VL domains on the same peptide chain. This configuration forces each domain to pair with a complementary domain on another polypeptide chain so as to form a homodimeric structure.
- the term“triabody” refers to trivalent antibodies containing three peptide chains, each of which contains one VH domain and one VL domain joined by a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of VH and VL domains within the same peptide chain.
- a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of VH and VL domains within the same peptide chain.
- peptides configured in this way typically trimerize so as to position the VH and VL domains of neighboring peptide chains spatially proximal to one another (see, for example, Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-48, 1993).
- the term“endogenous” describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a cell of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte) that is found naturally in a particular organism, such as a human patient.
- a hematopoietic stem cell or a cell of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteo
- the term“recipient” refers to a patient that receives a transplant, such as a transplant containing a population of hematopoietic stem cells.
- the transplanted cells administered to a recipient may be, e.g., autologous, syngeneic, or allogeneic cells.
- sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
- a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
- scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain.
- scFv fragments contain a single polypeptide chain that includes the variable region of an antibody light chain (VL) (e.g., CDR-L1 , CDR-L2, and/or CDR-L3) and the variable region of an antibody heavy chain (VH) (e.g., CDR-FI1 , CDR-FI2, and/or CDR-FI3) separated by a linker.
- VL antibody light chain
- VH variable region of an antibody heavy chain
- the linker that joins the VL and VH regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
- linkers can be used to so as to increase the resistance of the scFv fragment to proteolytic degradation (for example, linkers containing D-amino acids), in order to enhance the solubility of the scFv fragment (for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues), to improve the biophysical stability of the molecule (for example, a linker containing cysteine residues that form intramolecular or intermolecular disulfide bonds), or to attenuate the
- variable regions of the scFv molecules described herein can be modified such that they vary in amino acid sequence from the antibody molecule from which they were derived. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at amino acid residues can be made (e.g., in CDR and/or framework residues) so as to preserve or enhance the ability of the scFv to bind to the antigen recognized by the corresponding antibody.
- the phrase“substantially cleared from the blood” refers to a point in time following administration of a therapeutic agent (such as an anti-CD1 17 antibody, or antigen-binding fragment thereof) to a patient when the concentration of the therapeutic agent in a blood sample isolated from the patient is such that the therapeutic agent is not detectable by conventional means (for instance, such that the therapeutic agent is not detectable above the noise threshold of the device or assay used to detect the therapeutic agent).
- a therapeutic agent such as an anti-CD1 17 antibody, or antigen-binding fragment thereof
- a variety of techniques known in the art can be used to detect antibodies, antibody fragments, and protein ligands, such as ELISA-based detection assays known in the art or described herein. Additional assays that can be used to detect antibodies, or antibody fragments, include immunoprecipitation techniques and immunoblot assays, among others known in the art.
- transfection refers to any of a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, such as electroporation, lipofection, calcium- phosphate precipitation, DEAE- dextran transfection and the like.
- to treat refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease, any improvement of any consequence of disease, such as prolonged survival, less morbidity, and/or a lessening of side effects which are the byproducts of an alternative therapeutic modality; as is readily appreciated in the art, full eradication of disease is a preferred but albeit not a requirement for a treatment act.
- Beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem cell transplant therapy Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent administration of an exogenous hematopoietic stem cell graft to the patient.
- Beneficial results of therapy described herein may also include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen- presenting cell, macrophage, dendritic cell, natural killer cell, T-lymphocyte, or B-lymphocyte, following conditioning therapy and subsequent hematopoietic stem cell transplant therapy.
- hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen- presenting cell, macrophage, dendritic cell, natural killer cell, T-lymphocyte, or B-lymph
- Additional beneficial results may include the reduction in quantity of a disease-causing cell population, such as a population of cancer cells (e.g., CD1 17+ leukemic cells) or autoimmune cells (e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen).
- a disease-causing cell population such as a population of cancer cells (e.g., CD1 17+ leukemic cells) or autoimmune cells (e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen).
- cancer cells e.g., CD1 17+ leukemic cells
- autoimmune cells e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with
- the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds of the present disclosuremay occur prior to onset of a disease. The term does not imply that the disease state is completely avoided.
- patients that are“in need of” a hematopoietic stem cell transplant include patients that exhibit a defect or deficiency in one or more blood cell types, as well as patients having a stem cell disorder, autoimmune disease, cancer, or other pathology described herein.
- Hematopoietic stem cells generally exhibit 1 ) multi-potency, and can thus differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and 3) the ability to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hem
- Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more cell types of the hematopoietic lineage in order to re-constitute the defective or deficient population of cells in vivo.
- the patient may be suffering from cancer, and the deficiency may be caused by administration of a chemotherapeutic agent or other medicament that depletes, either selectively or non-specifically, the cancerous cell population.
- the patient may be suffering from a hemoglobinopathy (e.g., a non-malignant hemoglobinopathy), such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy e.g., a non-malignant hemoglobinopathy
- the subject may be one that is suffering from adenosine deaminase severe combined immunodeficiency (ADA SCID), HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- ADA SCID adenosine deaminase severe combined immunodeficiency
- the subject may have or be affected by an inherited blood disorder (e.g., sickle cell anemia) or an autoimmune disorder.
- the subject may have or be affected by a malignancy, such as neuroblastoma or a hematologic cancer.
- the subject may have a leukemia, lymphoma, or myeloma.
- the subject has acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin’s lymphoma.
- the subject has myelodysplastic syndrome.
- the subject has an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn’s disease, Type 1 diabetes, or another autoimmune pathology described herein.
- the subject is in need of chimeric antigen receptor T-cell (CART) therapy.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its entirety as
- a patient“in need of” a hematopoietic stem cell transplant may one that is or is not suffering from one of the foregoing pathologies, but nonetheless exhibits a reduced level (e.g., as compared to that of an otherwise healthy subject) of one or more endogenous cell types within the hematopoietic lineage, such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T-lymphocytes, and B- lymphocytes.
- endogenous cell types within the hematopoietic lineage such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosin
- FACS fluorescence activated cell sorting
- variants and“derivative” are used interchangeably and refer to naturally- occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein.
- a variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
- stem cell disorder broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues.
- a target tissue e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- stem cells in a subject's target tissues e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- Type I diabetes has been shown to be cured by hematopoietic stem cell transplant and may benefit from conditioning in accordance with the compositions and methods described herein.
- Additional disorders that can be treated using the compositions and methods described herein include, without limitation, sickle cell anemia, thalassemias, Fanconi anemia, aplastic anemia, Wiskott-Aldrich syndrome, ADA SCID, HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- Additional diseases that may be treated using the patient conditioning and/or hematopoietic stem cell transplant methods described herein include inherited blood disorders (e.g., sickle cell anemia) and autoimmune disorders, such as scleroderma, multiple sclerosis, ulcerative colitis, and Crohn’s disease.
- Additional diseases that may be treated using the conditioning and/or transplantation methods described herein include a malignancy, such as a neuroblastoma or a hematologic cancer, such as leukemia, lymphoma, and myeloma.
- the cancer may be acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin’s lymphoma.
- Additional diseases treatable using the conditioning and/or transplantation methods described herein include myelodysplastic syndrome.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its
- the term“vector” includes a nucleic acid vector, such as a plasmid, a DNA vector, a plasmid, a RNA vector, virus, or other suitable replicon.
- Expression vectors described herein may contain a polynucleotide sequence as well as, for example, additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of antibodies and antibody fragments of the invention include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- kits for expression of antibodies and antibody fragments contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription. These sequence elements may include, for example, 5’ and 3’ untranslated regions and a polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- the expression vectors described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker include genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, and nourseothricin.
- conjugate refers to an antibody which is linked to a cytotoxin.
- An ADC is formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen-binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein.
- Conjugates may include a linker between the two molecules bound to one another, e.g., between an antibody and a cytotoxin. Examples of linkers that can be used for the formation of a conjugate include peptide-containing linkers, such as those that contain naturally occurring or non-naturally occurring amino acids, such as D-amino acids.
- Linkers can be prepared using a variety of strategies described herein and known in the art. Depending on the reactive components therein, a linker may be cleaved, for example, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571 -582, 2012).
- microtubule-binding agent refers to a compound which acts by disrupting the microtubular network that is essential for mitotic and interphase cellular function in a cell.
- microtubule-binding agents include, but are not limited to, maytasine, maytansinoids, and derivatives thereof, such as those described herein or known in the art, vinca alkaloids, such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine, taxanes, such as docetaxel and paclitaxel, macrolides, such as discodermolides, cochicine, and epothilones, and derivatives thereof, such as epothilone B or a derivative thereof.
- amatoxin refers to a member of the amatoxin family of peptides produced by Amanita phalloides mushrooms, or a variant or derivative thereof, such as a variant or derivative thereof capable of inhibiting RNA polymerase II activity.
- Amatoxins useful in conjunction with the compositions and methods described herein include compounds such, as but not limited to, compounds of Formulas (III),
- amatoxins may be conjugated to an antibody, or antigen-binding fragment thereof, for instance, by way of a linker moiety (L) (thus forming an ADC). Exemplary methods of amatoxin conjugation and linkers useful for such processes are described below. Exemplary linker-containing amatoxins useful for conjugation to an antibody, or antigen-binding fragment, in accordance with the compositions and methods are also described herein.
- L linker moiety
- R is hydrogen (“aldehyde”), C1 -C12 alkyl, C2-C12 alkenyl, C2-C12 alkynyl, C3-C7 carbocyclyl, C6-C20 aryl, 5-1 0 membered heteroaryl, or 5-10 membered heterocyclyl, as defined herein.
- Non-limiting examples include formyl, acetyl, propanoyl, benzoyl, and acryloyl.
- C1-C12 alkyl refers to a straight chain or branched, saturated hydrocarbon having from 1 to 12 carbon atoms.
- Representative C1-C12 alkyl groups include, but are not limited to, - methyl, -ethyl, -n-propyl, -n-butyl, -n-pentyl, and -n-hexyl; while branched C1-C12 alkyls include, but are not limited to, -isopropyl, -sec-butyl, -isobutyl, -tert-butyl, -isopentyl, and 2-methylbutyl.
- a C1-C12 alkyl group can be unsubstituted or substituted.
- alkenyl refers to C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e. , a carbon-carbon, sp2 double bond.
- alkenyl group can be unsubstituted or substituted.
- Alkynyl refers to a C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e., a carbon-carbon, sp triple bond. Examples include, but are not limited to acetylenic and propargyl. An alkynyl group can be unsubstituted or substituted.
- Aryl refers to a C6-C20 carbocyclic aromatic group.
- aryl groups include, but are not limited to, phenyl, naphthyl and anthracenyl.
- An aryl group can be unsubstituted or substituted.
- Arylalkyl refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp 3 carbon atom, is replaced with an aryl radical.
- Typical arylalkyl groups include, but are not limited to, benzyl, 2-phenylethan-1 -yl, 2-phenylethen-1 -yl,
- the arylalkyl group comprises 6 to 20 carbon atoms, e.g. the alkyl moiety, including alkanyl, alkenyl or alkynyl groups, of the arylalkyl group is 1 to 6 carbon atoms and the aryl moiety is 5 to 14 carbon atoms.
- An alkaryl group can be unsubstituted or substituted.
- Cycloalkyl refers to a saturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkyl groups include a ring having 3 to 7 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. A cycloalkyl group can be unsubstituted or substituted.
- Cycloalkenyl refers to an unsaturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkenyl groups include a ring having 3 to 6 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkenyl groups include 1 -cyclopent-1 -enyl, 1 -cyclopent-2- enyl, 1 -cyclopent-3-enyl, 1 -cyclohex-1 -enyl, 1 -cyclohex-2-enyl, and 1 -cyclohex-3-enyl. A cycloalkenyl group can be unsubstituted or substituted.
- Heteroaralkyl refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp 3 carbon atom, is replaced with a heteroaryl radical.
- Typical heteroarylalkyl groups include, but are not limited to, 2-benzimidazolylmethyl, 2-furylethyl, and the like.
- the heteroarylalkyl group comprises 6 to 20 carbon atoms, e.g. the alkyl moiety, including alkanyl, alkenyl or alkynyl groups, of the heteroarylalkyl group is 1 to 6 carbon atoms and the heteroaryl moiety is 5 to 14 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S.
- the heteroaryl moiety of the heteroarylalkyl group may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system.
- Heteroaryl and “heterocycloalkyl” as used herein refer to an aromatic or non-aromatic ring system, respectively, in which one or more ring atoms is a heteroatom, e.g. nitrogen, oxygen, and sulfur.
- the heteroaryl or heterocycloalkyl radical comprises 2 to 20 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S.
- a heteroaryl or heterocycloalkyl may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system.
- Heteroaryl and heterocycloalkyl can be unsubstituted or substituted. Heteroaryl and heterocycloalkyl groups are described in Paquette, Leo A. ; "Principles of Modern Heterocyclic Chemistry" (W. A.
- heteroaryl groups include by way of example and not limitation pyridyl, thiazolyl, tetrahydrothiophenyl, pyrimidinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, tetrazolyl, benzofuranyl, thianaphthalenyl, indolyl, indolenyl, quinolinyl, isoquinolinyl, benzimidazolyl, isoxazolyl, pyrazinyl, pyridazinyl, indolizinyl, isoindolyl, 3H-indolyl, 1 H-indazolyl, purinyl, 4H-quinolizinyl, phthalazinyl, naphthyridinyl, quinoxalinyl, quinazolinyl, cinnolinyl, pteridinyl, 4aH-carb
- heterocycloalkyls include by way of example and not limitation dihydroypyridyl, tetrahydropyridyl (piperidyl), tetrahydrothiophenyl, piperidinyl, 4-piperidonyl, pyrrolidinyl, 2-pyrrolidonyl, tetrahydrofuranyl, tetrahydropyranyl, bis-tetrahydropyranyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, octahydroisoquinolinyl, piperazinyl, quinuclidinyl, and morpholinyl.
- carbon bonded heteroaryls and heterocycloalkyls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1 , 3, 4, 5, 6, 7, or 8 of an isoquinoline.
- carbon bonded heterocycles include 2-pyridyl, 3-pyridyl, 4-pyridyl, 5-pyridyl, 6-pyridyl, 3- pyridazinyl, 4-pyridazinyl, 5-pyridazinyl, 6-pyridazinyl, 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl, 6- pyrimidinyl, 2-pyrazinyl, 3-pyrazinyl, 5-pyrazinyl, 6-pyrazinyl, 2-thiazolyl, 4-thiazolyl, or 5-thiazolyl.
- nitrogen bonded heteroaryls and heterocycloalkyls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2-pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, 1 H-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or beta-carboline.
- nitrogen bonded heterocycles include 1 - aziridyl, 1 -azetedyl, 1 -pyrrolyl, 1 -imidazolyl, 1 -pyrazolyl, and 1 -piperidinyl.
- Substituted as used herein and as applied to any of the above alkyl, alkenyl, alkynyl, aryl, arylalkyl, cycloalkyl, heteroaryl, heterocyclyl, and the like, means that one or more hydrogen atoms are each independently replaced with a substituent.
- the foregoing chemical moieties such as“alkyl”,“heteroalkyl”,“alkenyl”,“heteroalkenyl”, “alkynyl”,“heteroalkynyl”,“cycloalkyl”,“heterocyclolalkyl”,“aryl,” and“heteroaryl” groups can optionally be substituted with, for example, from 1 to 5 substituents selected from the group consisting of alkyl, alkynyl, cycloalkyl, heterocycloalkyl, alkyl aryl, alkyl heteroaryl, alkyl cycloalkyl, alkyl heterocycloalkyl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, alkoxy,
- substitution may include situations in which neighboring substituents have undergone ring closure, such as ring closure of vicinal functional substituents, to form, for instance, lactams, lactones, cyclic anhydrides, acetals, hemiacetals, thioacetals, aminals, and hemiaminals, formed by ring closure, for example, to furnish a protecting group.
- ring closure such as ring closure of vicinal functional substituents, to form, for instance, lactams, lactones, cyclic anhydrides, acetals, hemiacetals, thioacetals, aminals, and hemiaminals, formed by ring closure, for example, to furnish a protecting group.
- radical naming conventions can include either a mono-radical or a di-radical, depending on the context. For example, where a substituent requires two points of attachment to the rest of the molecule, it is understood that the substituent is a di-radical.
- a substituent identified as alkyl that requires two points of attachment includes di-radicals such as -CH2-, -CH2CH2-, - CH2CH(CH 3 )CH2- and the like.
- Other radical naming conventions clearly indicate that the radical is a di radical such as "alkylene,” “alkenylene,”“arylene,”“heterocycloalkylene,” and the like.
- the term“coupling reaction” refers to a chemical reaction in which two or more substituents suitable for reaction with one another react so as to form a chemical moiety that joins (e.g., covalently) the molecular fragments bound to each substituent.
- Coupling reactions include those in which a reactive substituent bound to a fragment that is a cytotoxin, such as a cytotoxin known in the art or described herein, reacts with a suitably reactive substituent bound to a fragment that is an antibody, or antigen-binding fragment thereof, such as an antibody, or antigen-binding fragment thereof, specific for CD1 17 (such as GNNK+ CD1 17) known in the art or described herein.
- suitably reactive substituents include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others), a diene/dienophile pair (e.g., an azide/alkyne pair, among others), and the like.
- a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others
- diene/dienophile pair e.g., an azide/alkyne pair, among others
- Coupling reactions include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine condensation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
- cycloaddition e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloa
- CRU competitive repopulating unit
- drug-to-antibody ratio refers to the number of cytotoxins, e.g., amatoxin, attached to the antibody of an ADC.
- the DAR of an ADC can range from 1 to 8, although higher loads are also possible depending on the number of linkage sites on an antibody.
- an ADC described herein has a DAR of 1 , 2, 3, 4, 5, 6, 7, or 8.
- a substituent is depicted as a di-radical (i.e., has two points of attachment to the rest of the molecule), it is to be understood that the substituent can be attached in any directional configuration unless otherwise indicated.
- the present disclosure is based in part on the discovery that antibodies, or antigen-binding fragments thereof, having Fc modifications that allow Fc silencing, capable of binding an antigen expressed by hematopoietic cells can be used as therapeutic agents.
- the present disclosure is based in part on the discovery that antibodies, or antigen-binding fragments thereof, having Fc modifications that allow Fc silencing, capable of binding (i) an antigen expressed by hematopoietic cells, including but not limited toCD1 17 (e.g., GNNK+ CD1 1 7), or CD45; or an antigen expressed by mature immune cells (e.g., T- cells), including but not limited CD45, CD2, CD5, CD137, or CD252, can be used as therapeutic agents (e.g., as“naked” antibodies or as ADCs to (i) treat cancers and autoimmune diseases characterized by CD1 17+ (e.g., GNNK+ CD1 17) or CD45+ hematopoietic stem cells; or CD45+
- HC anti-hematopoietic cell
- an anti-hematopoietic cell (HC)-antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti- CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, anti-CD252 antibody, etc.
- an antigen e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, CD252, etc.
- a hematopoietic cell e.g., hematopoietic stem cell leukocyte, immune cell, e.g., mature immune cell (e.g., T cell)
- a cancer cell e.g., autoimmune cell, or hematopoietic stem cell and subsequently inducing cell death.
- transplanted hematopoietic stem cells may successfully engraft in a patient, such as human patient suffering from a stem cell disorder described herein.
- the antibodies, or antigen-binding fragments thereof, described herein may also include modifications and/or mutations that alter the properties of the antibodies and/or fragments, such as those that increase half-life, or increase or decrease ADCC.
- antibodies comprising one or more radiolabeled amino acids are provided.
- a radiolabeled antibody may be used for both diagnostic and therapeutic purposes (conjugation to radiolabeled molecules is another possible feature).
- Non-limiting examples of labels for polypeptides include, but are not limited to 3H, 14C, 15N, 35S, 90Y, 99Tc, and 1251, 131 1, and 1 86Re.
- Methods for preparing radiolabeled amino acids and related peptide derivatives are known in the art (see for instance Junghans et al. , in Cancer Chemotherapy and Biotherapy 655-686 (2d edition, Chafner and Longo, eds., Lippincott Raven (1996)) and U.S. Pat. No.
- a radioisotope may be conjugated by a chloramine T method.
- the anti-HC antibody (e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody), or antigen-binding fragment thereof, comprises a modified Fc region, wherein said modified Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for or binding to an FcgammaR (FcyR).
- FcyR FcgammaR
- Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcyR. Specifically, amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C'/E loop), and amino acids 327-332 (F/G) loop (see
- the antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an FcyR based on structural and crystallographic analysis.
- the Fc region of the anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, anti-CD252 antibody, etc.
- antigen-fragment thereof comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
- the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation. In some embodiments, the Fc region of the antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L234A mutation.
- the Fc region of the anti-HC antibody comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat.
- the Fc region comprises a L235A mutation.
- the Fc region comprises a L234A and L235A mutation (also referred to herein as “L234A.L235A” or as“LALA”).
- the Fc region comprises a L234A and L235A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a D265C, L234A, and L235A mutation (also referred to herein as“D265C.L234A.L235A”).
- the Fc region comprises a D265C, L234A, and L235A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a D265C, L234A, L235A, and H435A mutation (also referred to herein as“D265C.L234A.L235A.H435A”).
- the Fc region comprises a D265C, L234A, L235A, and H435A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a D265C and H435A mutation (also referred to herein as“D265C.H435A”).
- the Fc region comprises a D265A, S239C, L234A, and L235A mutation (also referred to herein as“D265A.S239C.L234A.L235A”).
- the Fc region comprises a D265A, S239C, L234A, and L235A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a D265C, N297G, and H435A mutation (also referred to herein as“D265C.N297G.H435A”).
- the Fc region comprises a D265C, N297Q, and FI435A mutation (also referred to herein as “D265C.N297Q.FI435A”).
- the Fc region comprises a E233P, L234V, L235A and delG236 (deletion of 236) mutation (also referred to herein as“E233P.L234V.L235A.delG236” or as “EPLVLAdeIG”).
- the Fc region comprises a E233P, L234V, L235A and delG236 (deletion of 236) mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a E233P, L234V, L235A, delG236 (deletion of 236) and H435A mutation (also referred to herein as“E233P.L234V.L235A.delG236.H435A” or as“EPLVLAdelG.H435A”).
- the Fc region comprises a E233P, L234V, L235A, delG236 (deletion of 236) and H435A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a L234A, L235A, S239C and D265A mutation.
- the Fc region comprises a L234A, L235A, S239C and D265A mutation, wherein the Fc region does not include a P329G mutation.
- the Fc region comprises a H435A, L234A, L235A, and D265C mutation.
- the Fc region comprises a H435A, L234A, L235A, and D265C mutation, wherein the Fc region does not include a P329G mutation.
- the antibody has a modified Fc region such that, the antibody decreases an effector function in an in vitro effector function assay with a decrease in binding to an Fc receptor (Fc R) relative to binding of an identical antibody comprising an unmodified Fc region to the FcR.
- the antibody has a modified Fc region such that, the antibody decreases an effector function in an in vitro effector function assay with a decrease in binding to an Fc gamma receptor (FcyR) relative to binding of an identical antibody comprising an unmodified Fc region to the FcyR.
- the FcyR is FcyR1 .
- the FcyR is FcyR2A.
- the FcyR is FcyR2B.
- the FcyR is FcyR2C.
- the FcyR is FcyR3A.
- the FcyR is FcyR3B.
- the decrease in binding is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in antibody binding to a FcyR relative to binding of the identical antibody comprising an unmodified Fc region to the FcyR.
- the decrease in binding is at least a 70% to a 100% decrease, at least a 80% to a 100% decrease, at least a 90% to a 100% decrease, at least a 95% to a 100% decrease, or at least a 98% to a 100% decrease, in antibody binding to a FcyR relative to binding of the identical antibody comprising an unmodified Fc region to the FcyR
- the antibody has a modified Fc region such that, the antibody decreases cytokine release in an in vitro cytokine release assay with a decrease in cytokine release of at least 50% relative to cytokine release of an identical antibody comprising an unmodified Fc region.
- the decrease in cytokine release is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in cytokine release relative to cytokine release of the identical antibody comprising an unmodified Fc region.
- the decrease in cytokine release is at least a 70% to a 100% decrease, at least a 80% to a 100% decrease, at least a 90% to a 1 00% decrease, at least a 95% to a 100% decrease in cytokine release relative to cytokine release of the identical antibody comprising an unmodified Fc region.
- cytokine release is by immune cells.
- the antibody has a modified Fc region such that, the antibody decreases mast cell degranulation in an in vitro mast cell degranulation assay with a decrease in mast cell
- the decrease in mast cell degranulation is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in mast cell degranulation relative to mast cell degranulation of the identical antibody comprising an unmodified Fc region.
- the decrease in mast cell degranulation is at least a 70% to a 100% decrease, at least a 80% to a 100% decrease, at least a 90% to a 100% decrease, or at least a 95% to a 100% decrease, in mast cell degranulation relative to mast cell degranulation of the identical antibody comprising an unmodified Fc region.
- the antibody has a modified Fc region such that, the antibody decreases or prevents antibody dependent cell phagocytosis (ADCP) in an in vitro antibody dependent cell phagocytosis assay, with a decrease in ADCP of at least 50% relative to ADCP of an identical antibody comprising an unmodified Fc region.
- ADCP antibody dependent cell phagocytosis
- the decrease in ADCP is at least a 70% decrease, at least a 80% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 1 00% decrease in antibody dependent cell phagocytosis to antibody dependent cell phagocytosis of the identical antibody comprising an unmodified Fc region.
- the anti-HC antibody (e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti- CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody) described herein comprises an Fc region comprising one of the following modifications or combinations of modifications: D265A, D265C, D265C / H435A, D265C / LALA, D265C / LALA / H435A, D265A / S239C / L234A / L235A / H435A, D265A / S239C / L234A / L235A, D265C / N297G, D265C / N297G / H435A, D265C (EPLVLAdeIG * ), D265C (EPLVLAdeIG ) / H435A, D265C / N297Q / H435A, D265C / N2
- Binding or affinity between a modified Fc region and a Fc gamma receptor can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme- linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52- 60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORE.RTM. analysis or Octet.RTM.
- equilibrium methods e.g., enzyme- linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52- 60, 2008
- RIA radioimmunoassay
- a surface plasmon resonance assay e.g., BIACORE.RTM. analysis or Octet.R
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a radioimmuno assay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis.
- Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- an antibody having the Fc modifications described herein has at least a 70% decrease, at least a 75% decrease, at least a 80% decrease, at least a 85% decrease, at least a 90% decrease, at least a 95% decrease, at least a 98% decrease, at least a 99% decrease, or a 100% decrease in binding to a Fc gamma receptor relative to binding of the identical antibody comprising an unmodified Fc region to the Fc gamma receptor (e.g., as assessed by biolayer interferometry (BLI), e.g., as described in Example 1 ).
- BLI biolayer interferometry
- an antibody comprising a modified Fc region (e.g., comprising a L234A, L235A, and/or a D265C mutation) has substantially reduced or abolished effector functions.
- Effector functions can be assayed using a variety of methods known in the art, e.g., by measuring cellular responses (e.g., mast cell degranulation or cytokine release) in response to the antibody of interest.
- the Fc-modified antibodies can be assayed for their ability to trigger mast cell degranulation in vitro (e.g., as described in Example 2) or for their ability to trigger cytokine release, e.g. by human peripheral blood mononuclear cells (e.g., as described in Example 3).
- the Fc region comprises a mutation resulting in a decrease in half-life (e.g., relative to an antibody having an unmodified Fc region).
- An antibody having a short half-life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by FISCs.
- the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express a target antigen (e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252) but are not the target of the anti-HC antibody (e.g., anti-CD1 1 7 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody), unlike the endogenous stem cells.
- the Fc region comprises a mutation at position 435 (EU index according to Kabat).
- the mutation is an H435A mutation.
- the anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- a half-life e.g., in humans
- the anti-HC antibody has a half-life (e.g., in humans) equal to or less than about 24 hours, equal to or less than about 23 hours, equal to or less than about 22 hours, equal to or less than about 21 hours, equal to or less than about 20 hours, equal to or less than about 19 hours, equal to or less than about 1 8 hours, equal to or less than about 17 hours, equal to or less than about 16 hours, equal to or less than about 15 hours, equal to or less than about 14 hours, equal to or less than about 13 hours, equal to or less than about 12 hours, or equal to or less than about 1 1 hours.
- the anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- has a half-life e.g., in humans) of about 1 -5 hours, about 5-10 hours, about 10-15 hours, about 15-20 hours, or about 20 to 25 hours.
- the Fc region comprises two or more mutations that confer reduced half-life and reduce an effector function of the antibody.
- the Fc region comprises a mutation resulting in a decrease in half-life and a mutation of at least one residue that can make direct contact with an FcyFt (e.g., as based on structural and crystallographic analysis).
- the Fc region comprises a H435A mutation, a L234A mutation, and a L235A mutation.
- the Fc region comprises a H435A mutation and a D265C mutation.
- the Fc region comprises a H435A mutation, a L234A mutation, a L235A mutation, and a D265C mutation.
- the antibody or antigen-binding fragment thereof is conjugated to a cytotoxin (e.g., amatoxin) by way of a cysteine residue in the Fc domain of the antibody or antigen-binding fragment thereof.
- a cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue may be selected from the group consisting of Cys1 18, Cys239, and Cys265.
- the Fc region of the anti-HC antibody (e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody), or antigen-binding fragment thereof, comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat.
- the Fc region comprises a D265C mutation.
- the Fc region comprises a D265C and H435A mutation.
- the Fc region comprises a D265C, a L234A, and a L235A mutation.
- the Fc region comprises a D265C, a L234A, a L235A, and a H435A mutation.
- the Fc region of the anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- the Fc region comprises an amino acid substitution at amino acid 239 according to the EU index as in Kabat.
- the Fc region comprises a S239C mutation.
- the Fc region comprises a L234A mutation, a L235A mutation, a S239C mutation and a D265A mutation.
- the Fc region comprises a S239C and H435A mutation. In another embodiment, the Fc region comprises a L234A mutation, a L235A mutation, and S239C mutation. In yet another embodiment, the Fc region comprises a H435A mutation, a L234A mutation, a L235A mutation, and S239C mutation. In yet another embodiment, the Fc region comprises a H435A mutation, a L234A mutation, a L235A mutation, a S239C mutation and D265A mutation.
- Fc amino acid positions are in reference to the EU numbering index unless otherwise indicated.
- Methods of engineering antibodies to include any of the Fc modifications herein are well known in the art. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide- mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of a prepared DNA molecule encoding the antibody or at least the constant region of the antibody.
- Site-directed mutagenesis is well known in the art (see, e.g., Carter et al. , Nucleic Acids Res., 13:4431 -4443 (1985) and Kunkel et al., Proc. Natl. Acad. Sci.
- PCR mutagenesis is also suitable for making amino acid sequence variants of the starting polypeptide. See Higuchi, in PCR Protocols, pp. 177-183 (Academic Press, 1990); and Vallette et al., Nuc. Acids Res. 17:723-733 (1989). Another method for preparing sequence variants, cassette mutagenesis, is based on the technique described by Wells et al., Gene, 34:315-323 (1985).
- the present disclosure is also based in part on the discovery that antibodies, or antigen-binding fragments thereof, capable of binding CD1 17, such as GNNK+ CD1 17, can be used as therapeutic agents alone or as ADCs to (i) treat cancers (such as acute myelogenous leukemia or myelodysplastic syndrome) and autoimmune diseases characterized by CD1 17+ cells and (ii) promote the engraftment of transplanted hematopoietic stem cells in a patient in need of transplant therapy.
- cancers such as acute myelogenous leukemia or myelodysplastic syndrome
- autoimmune diseases characterized by CD1 17+ cells characterized by CD1 17+ cells
- These therapeutic activities can be caused, for instance, by the binding of anti-CD1 17 antibodies, or antigen-binding fragments thereof, to CD1 17 (e.g., GNNK+ CD1 17) expressed on the surface of a cell, such as a cancer cell, autoimmune cell, or hematopoietic stem cell and subsequently inducing cell death.
- CD1 17 e.g., GNNK+ CD1 17
- the depletion of endogenous hematopoietic stem cells can provide a niche toward which transplanted hematopoietic stem cells can home, and subsequently establish productive hematopoiesis. In this way, transplanted hematopoietic stem cells may successfully engraft in a patient, such as human patient suffering from a stem cell disorder described herein.
- Antibodies and antigen-binding fragments capable of binding human CD1 17 can be used in conjunction with the compositions and methods described herein in order to condition a patient for hematopoietic stem cell transplant therapy.
- Polymorphisms affecting the coding region or extracellular domain of CD1 17 in a significant percentage of the population are not currently well-known in non-oncology indications.
- the two extracellular isoforms are located on the intracellular domain of the protein, and two are present in the external juxtamembrane region.
- the two extracellular isoforms, GNNK+ and GNNK- differ in the presence (GNNK+) or absence (GNNK-) of a 4 amino acid sequence. These isoforms are reported to have the same affinity for the ligand (SCF), but ligand binding to the GNNK- isoform was reported to increase internalization and degradation.
- the GNNK+ isoform can be used as an immunogen in order to generate antibodies capable of binding CD1 17, as antibodies generated against this isoform will be inclusive of the GNNK+ and GNNK- proteins.
- the anti-CD1 1 7 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 13, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 14.
- the anti-CD1 17 antibody, or antigen binding portion thereof comprises the three CDR sequences of the heavy chain variable region (VH) amino acid sequence and the three CDR sequences of the light chain variable region (LH) amino acid sequence of Ab85.
- the anti-CD1 17 antibody, or antigen binding portion thereof comprises the heavy chain variable region (VH) amino acid sequence and the light chain variable region (LH) amino acid sequence of Ab85 (also referred to herein interchangeably as Ab2).
- VH heavy chain variable region
- LH light chain variable region
- VH heavy chain variable region amino acid sequence provided below as SEQ ID NO: 13.
- the VH CDR amino acid sequences of Ab85 are underlined below and are as follows: NYWIG (VH CDR1 ; SEQ ID NO: 7); IINPRDSDTRYRPSFQG (VH CDR2; SEQ ID NO: 8); and HGRGYEGYEGAFDI (VH CDR3; SEQ ID NO: 9).
- VL light chain variable region amino acid sequence of Ab85
- SEQ ID NO 14 The light chain variable region (VL) amino acid sequence of Ab85 is provided below as SEQ ID NO 14.
- the VL CDR amino acid sequences of Ab85 are underlined below and are as follows: RSSQGIRSDLG (VL CDR1 ; SEQ ID NO: 10); DASNLET (VL CDR2; SEQ ID NO: 1 1 ; and QQANGFPLT (VL CDR3; SEQ ID NO: 12).
- the anti-CD1 17 antibody, or antigen binding portion thereof comprises the heavy chain variable region (VH) amino acid sequence and the light chain variable region (LH) amino acid sequence of Ab249 (also referred to herein interchangeably as Ab3).
- VH heavy chain variable region
- LH light chain variable region
- VH heavy chain variable region amino acid sequence of Ab249
- SEQ ID NO: 346 The heavy chain variable region amino acid sequence of Ab249 is provided below as SEQ ID NO: 346.
- the VH CDR amino acid sequences of Ab249 are underlined below and are as follows: TSWIG (VH CDR1 ; SEQ ID NO: 340); IIYPGDSDTRYSPSFQG (VH CDR2; SEQ ID NO: 341 ); and
- HGLGYNGYEGAFDI VH CDR3; SEQ ID NO: 3412.
- VL variable region amino acid sequence of Ab249
- SEQ ID NO: 347 The VL CDR amino acid sequences of Ab249 are underlined below and are as follows:
- RASQGIGSALA VL CDR1 ; SEQ ID NO: 343
- DASNLET VL CDR2; SEQ ID NO: 344
- QQLNGYPLT VL CDR3; SEQ ID NO: 345
- Ab85 and Ab249 were both derived from antibody CK6, which is an antagonist anti-CD1 17 antibody. Ab85 and Ab249 have improved properties, e.g., improved binding characteristics, over CK6.
- an anti-CD1 17 antibody comprises a heavy chain comprising a CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 7, 8, and 9, and a light chain comprising a CDR set as set forth in SEQ ID Nos: 10, 1 1 , and 12.
- an anti-CD1 17 antibody comprises a heavy chain comprising a CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 340, 341 , and 342, and a light chain comprising a CDR set as set forth in SEQ ID Nos: 343, 344, and 345.
- the anti-CD1 17 antibody, or antigen binding portion thereof comprises the heavy chain variable region (VH) amino acid sequence and the light chain variable region (LH) amino acid sequence of Ab67 (a neutral antibody; also referred to herein interchangeably as Ab1 ).
- VH heavy chain variable region
- LH light chain variable region
- VH heavy chain variable region amino acid sequence of Ab67 is provided below as SEQ ID NO: 354.
- VH CDR amino acid sequences of Ab67 are underlined below and are as follows:
- FTFSDADMD VH CDR1 ; SEQ ID NO: 348
- RTRNKAGSYTTEYAASVKG VH CDR2; SEQ ID NO: 349
- AREPKYWIDFDL VH CDR3; SEQ ID NO: 350
- VL light chain variable region amino acid sequence of Ab67
- SEQ ID NO: 355 The light chain variable region (VL) amino acid sequence of Ab67 is provided below as SEQ ID NO: 355.
- the VL CDR amino acid sequences of Ab67 are underlined below and are as follows: RASQSISSYLN (VL CDR1 ; SEQ ID NO: 351 ); AASSLQS (VL CDR2; SEQ ID NO: 352); and QQSYIAPYT (VL CDR3; SEQ ID NO: 353).
- an anti-CD1 17 antibody comprises a heavy chain comprising a CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 348, 349, and 350, and a light chain comprising a CDR set as set forth in SEQ ID Nos: 351 , 352, and 353.
- anti-CD1 17 antibodies or binding fragments described herein may also include modifications and/or mutations that alter the properties of the antibodies and/or fragments, such as those that increase half-life, increase or decrease ADCC, etc., as is known in the art.
- the anti-CD1 1 7 antibody, or binding fragment thereof comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR.
- variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR.
- an anti-CD1 17 antibody described herein comprises an Fc region comprising an amino acid substitution at L234 and/or L235, e.g., L234A and L235A (EU index).
- the anti-CD1 17 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an FcyR based on structural and crystallographic analysis.
- the Fc region of the anti-CD1 17 antibody (or Fc containing fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991 ), expressly incorporated herein by references.
- the "EU index as in Kabat” or“EU index” refers to the numbering of the human lgG1 EU antibody and is used herein in reference to Fc amino acid positions unless otherwise indicated.
- the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation.
- the Fc region of the anti-CD1 1 7 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L234A mutation. In some embodiments, the Fc region of the anti-CD1 17 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L235A mutation. In yet another embodiment, the Fc region comprises a L234A and L235A mutation. In a further embodiment, the Fc region comprises a D265C, L234A, and L235A mutation.
- a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an FcgammaR and/or C1 q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- an antibody comprising a modified Fc region e.g., comprising a L234A, L235A, and a D265C mutation
- Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORETM analysis or OctetTM analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a
- radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- an anti-CD1 17 antibody described herein comprises an Fc region comprising L235A, L235A, and D265C (EU index).
- the antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al. (201 0) Nat Biotechnol 28: 157-9), (Hinton et al. (2004) J Biol Chem 279: 6213-6), (Hinton et al. (2006) J Immunol 176: 346-56), (Shields et al.
- the Fc region comprises a mutation resulting in a decrease in half life.
- An antibody having a short half life also referred to herein as a“fast” half life
- the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express CD1 17 but are not the target of the anti-CD1 17 antibody, unlike the endogenous stem cells.
- the Fc region comprises a mutation at position 435 (EU index according to Kabat).
- the mutation is an H435A mutation.
- the mutation is a D265C mutation.
- the mutations are an H435A mutation and a D265C mutation.
- the anti-CD1 1 7 antibody described herein has a half life of equal to or less than 24 hours, equal to or less than 22 hours, equal to or less than 20 hours, equal to or less than 18 hours, equal to or less than 16 hours, equal to or less than 14 hours, equal to or less than 13 hours, equal to or less than 12 hours, equal to or less than 1 1 hours, equal to or less than 10 hours, equal to or less than 9 hours, equal to or less than 8 hours, equal to or less than 7 hours, equal to or less than 6 hours, or equal to or less than 5 hours.
- the half life of the antibody is 5 hours to 7 hours; is 5 hours to 9 hours; is 15 hours to 1 1 hours; is 5 hours to 13 hours; is 5 hours to 1 5 hours; is 5 hours to 20 hours; is 5 hours to 24 hours; is 7 hours to 24 hours; is 9 hours to 24 hours; is 1 1 hours to 24 hours; 12 hours to 22 hours; 10 hours to 20 hours; 8 hours to 18 hours; or 14 hours to 24 hours.
- Anti-CD1 1 7 antibodies that can be used in conjunction with the patient conditioning methods described herein include, for instance, antibodies produced and released from ATCC Accession No. 10716 (deposited as BA7.3C.9), such as the SR-1 antibody, which is described, for example, in US Patent No. 5,489,51 6, the disclosure of which is incorporated herein by reference as it pertains to anti-CD1 17 antibodies.
- an anti-CD1 17 antibody described herein comprises an Fc region comprising L235A, L235A, D265C, and H435A (EU index).
- Additional anti-CD1 1 7 antibodies that can be used in conjunction with the patient conditioning methods described herein include those described in US Patent No. 7,915,391 , which describes, e.g., humanized SR-1 antibodies; US Patent No. 5,808,002, which describes, e.g., the anti-CD1 1 7 A3C6E2 antibody, as well as those described in, for example, WO 2015/050959, which describes anti-CD1 17 antibodies that bind epitopes containing Pro317, Asn320, Glu329, Val331 , Asp332, Lus358, Glue360, Glue376, His378, and/or Thr380 of human CD1 17; and US 2012/0288506 (also published as US Patent No. 8,552,157), which describes, e.g., the anti-CD1 17 antibody CK6 (also referred to herein interchangeably as Ab4), having the CDR sequences of:
- the heavy chain variable region amino acid sequence of CK6 is provided in SEQ ID NO: 27): QVQLVQSGAAVKKPGESLKISCKGSGYRFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTI
- the light chain amino acid variable sequence of CK6 is provided in SEQ ID NO: 28:
- Additional anti-CD1 1 7 antibodies and antigen-binding fragments thereof that may be used in conjunction with the compositions and methods described herein include those described in US
- 2015/0320880 such as the clones 9P3, NEG024, NEG027, NEG085, NEG086, and 20376.
- Antibodies and antigen-binding fragments that may be used in conjunction with the compositions and methods described herein include the above-described antibodies and antigen binding fragments thereof, as well as humanized variants of those non-human antibodies and antigen binding fragments described above and antibodies or antigen-binding fragments that bind the same epitope as those described above, as assessed, for instance, by way of a competitive CD1 17 binding assay.
- Exemplary antigen-binding fragments of the foregoing antibodies include a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’)2 molecule, and a tandem di-scFv, among others.
- scFv single-chain Fv molecule
- Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567.
- isolated nucleic acid encoding an anti-CD1 17 antibody described herein is provided.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is provided.
- a host cell comprises (e.g., has been transformed with): (1 ) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
- nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.)
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al. , J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- the anti-CD1 1 7 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD1 1 7 antibody, or antigen binding fragment thereof comprises a heavy chain variable region and a heavy chain constant region having an amino acid sequence that is disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises a light chain variable region and a light chain constant region having an amino acid sequence that is disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region and a light chain constant region having an amino acid sequence that is disclosed herein.
- the anti-CD1 17 antibodies and ADCs described herein can be used in methods of treating a variety of disorders, such as diseases of a cell type in the hematopoietic lineage, cancers, autoimmune diseases, metabolic disorders, and stem cell disorders, among others.
- compositions and methods described herein may (i) directly deplete a population of cells that give rise to a pathology, such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T-cells), and/or (ii) deplete a population of endogenous hematopoietic stem cells so as to promote the engraftment of transplanted hematopoietic stem cells by providing a niche to which the transplanted cells may home.
- a pathology such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T-cells)
- autoimmune cells e.g., autoreactive T-cells
- deplete a population of endogenous hematopoietic stem cells so as to promote the engraftment of transplanted hematopoietic stem cells by providing a niche to which the transplanted cells may home.
- the foregoing activities
- this administration can cause a reduction in the quantity of the cells that give rise to the pathology of interest.
- this administration can cause the selective depletion of a population of endogenous hematopoietic stem cells, thereby creating a vacancy in the hematopoietic tissue, such as the bone marrow, that can subsequently be filled by transplanted, exogenous hematopoietic stem cells.
- the invention is based in part on the discovery that ADCs, antibodies, or antigen-binding fragments thereof, capable of binding CD1 17 (such as GNNK+ CD1 17) can be administered to a patient to affect both of the above activities.
- ADCs, antibodies, or antigen-binding fragments thereof, that bind CD1 17 can be administered to a patient suffering from a cancer or autoimmune disease to directly deplete a population of cancerous cells or autoimmune cells, and can also be administered to a patient in need of hematopoietic stem cell transplant therapy in order to promote the survival and engraftment potential of transplanted hematopoietic stem cells.
- Engraftment of hematopoietic stem cell transplants due to the administration of anti-CD1 17 ADCs, antibodies, or antigen-binding fragments thereof, can manifest in a variety of empirical measurements. For instance, engraftment of transplanted hematopoietic stem cells can be evaluated by assessing the quantity of competitive repopulating units (CRU) present within the bone marrow of a patient following administration of an ADC, antibody or antigen-binding fragment thereof capable of binding CD1 17 and subsequent administration of a hematopoietic stem cell transplant.
- CRU competitive repopulating units
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- Human CD2 is also referred to as T-cell Surface Antigen T1 1 /Leu-5, T1 1 , CD2 antigen (p50), and Sheep Red Blood Cell Receptor (SRBC).
- CD2 is expressed on T cells.
- Two isoforms of human CD2 have been identified. Isoform 1 contains 351 amino acids is described in Seed, B. et al. (1987) 84: 3365-69 (see also Sewell et al. (1986) 83: 871 8-22) and below (NCBI Reference Sequence: NP_001758.2): msfpckfvas fllifnvssk gavskeitna letwgalgqd inldipsfqm sddiddikwe
- a second isoform of CD2 is 377 amino acids and is identified herein as NCBI Reference Sequence:
- an anti-CD2 antibody that may be used in conjunction with the compositions and methods described herein include those that have one or more, or all, of the following CDRs:
- an anti-CD2 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 36, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 37.
- an anti-CD2 antibody that may be used in conjunction with the compositions and methods described herein include those that have one or more, or all, of the following CDRs:
- an anti-CD2 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 45, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 47.
- an anti-CD2 antibody that may be used in conjunction with the compositions and methods described herein include those that have one or more, or all, of the following CDRs: a. a CDR-H1 having the amino acid sequence GFTFSSY (SEQ ID NO: 38);
- an anti-CD2 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 46, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 47.
- Antibodies and antigen-binding fragments thereof containing the foregoing CDR sequences are described, e.g., in US Patent No. 6,849,258, the disclosure of which is incorporated herein by reference as it pertains to anti-CD2 antibodies and antigen-binding fragments thereof.
- the anti-CD2 ADC has a serum half-life in a human subject of 3 days or less.
- anti-CD2 antibodies, antigen-binding fragments thereof, or ADCs thereof that can be used in the compositions and methods as described herein can be identified using techniques known in the art, such as hybridoma production. Hybridomas can be prepared using a murine system. Protocols for Immunization and subsequent isolation of spienocytes for fusion are known in the art. Fusion partners and procedures for hybridoma generation are also known. Alternatively, anti-CD2 anitbodies can be generated using the HuMAb-Mouse® or XenoMouseTM. In making additional anti-CD2 antibodies, the CD2 antigen is isolated and/or purified. The CD2 antigen may be a fragment of CD2 from the extracellular domain of CD2.
- Immunization of animals can be performed by any method known in the art. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, New York: Cold Spring Harbor Press, 1990. Methods for immunizing animals such as mice, rats, sheep, goats, pigs, cattle and horses are well known in the art. See, e.g.,
- the CD2 antigen may be administered with an adjuvant to stimulate the immune response.
- adjuvants known in the art include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
- lymph node and/or splenic B cells are immortalized by methods known in the art (e.g., oncogene transfer, oncogenic virus transduction, exposure to carcinogenic or mutating compounds, fusion with an immortalized cell, e.g., a myeloma cell, and inactivating a tumor suppressor gene. See, e.g., Harlow and Lane, supra.
- Hybridomas can be selected, cloned and further screened for desirable characteristics, including robust growth, high antibody production and desirable antibody characteristics.
- Anti-CD2 antibodies for use in the anti-CD2 ADCs described herein can also be identified using high throughput screening of libraries of antibodies or antibody fragments for molecules capable of binding CD2.
- Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian cell display, ribosome display, mRNA display, and cDNA display, among others.
- phage display to isolate antibodies, antigen-binding fragments, or ligands that bind biologically relevant molecules has been reviewed, for example, in Felici et al., Biotechnol. Annual Rev. 1 :149-183,
- Proteins such as multimeric proteins have been successfully phage-displayed as functional molecules (see, for example, EP 0349578; EP 4527839; and EP 0589877, as well as Chiswell and McCafferty, Trends Biotechnol. 10:80-84 1992, the disclosures of each of which are incorporated herein by reference as they pertain to the use of in vitro display techniques for the discovery of antigen-binding molecules.
- functional antibody fragments such as Fab and scFv fragments, have been expressed in in vitro display formats (see, for example, McCafferty et al., Nature 348:552- 554, 1990; Barbas et al., Proc. Natl. Acad. Sci.
- computational modeling techniques can be used to design and identify anti-CD2 antibodies or antibody fragments in silico, for instance, using the procedures described in US 2013/0288373, the disclosure of which is incorporated herein as it pertains to molecular modeling methods for identifying anti-CD2 antibodies.
- computational modeling techniques one of skill in the art can screen libraries of antibodies or antibody fragments in silico for molecules capable of binding specific epitopes on CD2, such as extracellular epitopes of CD2.
- the anti-CD2 antibody used in the ADCs described herein are able to internalize into the cell.
- additional techniques can be used to identify antibodies or antigen-binding fragments that bind CD2 on the surface of a cell (e.g., a T cell) and further are able to be internalized by the cell, for instance, by receptor-mediated endocytosis.
- the in vitro display techniques described above can be adapted to screen for antibodies or antigen-binding fragments thereof that bind CD2 on the surface of a hematopoietic stem cell and that are subsequently internalized. Phage display represents one such technique that can be used in conjunction with this screening paradigm.
- anti-CD2 antibodies or fragments thereof that bind CD2 and are subsequently internalized a CD2+ cell
- phage display techniques described in Williams et al., Leukemia 19:1432-1438, 2005, the disclosure of which is incorporated herein by reference in its entirety.
- the internalizing capacity of an anti-CD2 antibody or fragment thereof can be assessed, for instance, using radionuclide internalization assays known in the art.
- an anti-CD2 antibody or fragment thereof, identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, 67 Ga, 1 1 1n, "Tc, 169 Yb, 186 Re, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As, 86 Y, 90 Y, 89 Zr, 212 Bi, 213 Bi, or 225 Ac.
- a radioactive isotope such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, 67 Ga, 1 1 1n, "Tc, 169 Yb, 186 Re, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As,
- radioactive halogens such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, can be incorporated into antibodies, fragments thereof, or ligands using beads, such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA). Radiolabeled antibodies, or fragments thereof, can be incubated with hematopoietic stem cells for a time sufficient to permit internalization.
- electrophilic halogen reagents e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA.
- Internalized antibodies, or fragments thereof, can be identified by detecting the emitted radiation (e.g., g-radiation) of the resulting hematopoietic stem cells in comparison with the emitted radiation (e.g., g-radiation) of the recovered wash buffer.
- the foregoing internalization assays can also be used to characterize ADCs.
- the anti-CD2 antibody (or fragment thereof) has a defined serum half-life.
- an anti-CD2 antibody (or fragment thereof) may have a serum half-life of about 1 -24 hours in the human patient.
- ADCs containing such anti-CD2 antibodies can also, for example, have a serum half-life of about 1 -24 hours in a human patient.
- Pharmacokinetic analysis by measurement of serum levels can be performed by assays known in the art.
- nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BFIK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (FIELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Flep G2) ; mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CFIO) cells, including DFIFR- CFIO cells (Urlaub et al., Proc. Natl.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- CHO Chinese Hamster Ovary
- Human CD5 is also referred to as Lymphocyte Antigen T1 , T1 , Leu-1 , and LEU1 .
- CD5 is expressed on human T cells.
- Two isoforms of human CD5 have been identified. Isoform 1 contains 495 amino acids and is described in Gladkikh et al (2017) Cancer Med.6(12) :2984 and Jones et al. (1986) Nature 323 (6086): 346).
- the amino acid sequence of CD5 is provided below (NCBI Reference Sequence:
- a second isoform (SEQ ID NO: 339) of human CD5 is 438 amino acids (see underlined portion above) and is identified as NCBI Reference Sequence: NR 001333385.1 .
- CD5 isoform 2 is an intracellular protein. Isoform 2 contains a distinct 5' UTR and lacks an in-frame portion of the 5' coding region, compared to isoform 1 . The resulting isoform 2 has a shorter N-terminus, compared to isoform 1 .
- the CD5 isoform 2 lacks the leader peptide, compared to isoform 1 and represents an intracellular isoform found in a subset of B lymphocytes.
- the ADCs described herein are specific for human CD5 isoform 1 which represents the extracellular version of human CD5.
- an anti-CD5 antibody that may be used in the methods and compositions described herein is Antibody 5D7v (Ab5D7v).
- the heavy chain variable region (VH) amino acid sequence of Ab5D7v is provided below as SEQ ID NO: 49.
- VH CDR amino acid sequences of Ab5D7v are underlined above and are as follows:
- VH CDR1 SEQ ID NO: 51
- WWDDD VH CDR2; SEQ ID NO: 52
- RRATGTGFDY VH CDR3; SEQ ID NO: 53.
- VL light chain variable region amino acid sequence of Ab5D7v
- VL CDR amino acid sequences of Ab5D7v are underlined above and are as follows: QDVGTA (VL CDR1 ; SEQ ID NO: 54); WTSTRHT (VL CDR2; SEQ ID NO: 55); and YNSYNT (VL CDR3; SEQ ID NO: 56).
- an anti-CD5 ADC comprises an anti-CD5 antibody comprising a heavy chain comprising a CDR1 domain comprising the amino acid sequence set forth in SEQ ID NO: 51 , a CDR2 domain comprising the amino acid sequence set forth in SEQ ID NO: 52, and a CDR3 domain comprising the amino acid sequence set forth in SEQ ID NO: 53, and comprises a light chain comprising a CDR1 domain comprising the amino acid sequence set forth in SEQ ID NO: 54, a CDR2 domain comprising the amino acid sequence set forth in SEQ ID NO: 55, and a CDR3 domain comprising the amino acid sequence set forth in SEQ ID NO: 56, wherein the antibody is conjugated to a cytotoxin via a linker.
- an anti-CD5 ADC comprises an anti-CD5 antibody comprising a heavy chain comprising a variable region comprising an amino acid sequence as set forth in SEQ ID NO:49, and a light chain comprising a variable region comprising an amino acid sequence as set forth in SEQ ID NO: 50, wherein the antibody is conjugated to a cytotoxin via a linker.
- an anti-CD5 antibody used in the ADCs described herein is the 5D7 antibody (see, e.g., US 20080254027, the disclosure of which is incorporated herein by reference).
- an anti-CD5 antibody that may be used in the methods and compositions (including ADCs) described herein is a variant of the 5D7 antibody (see, e.g., US 20080254027, the disclosure of which is incorporated herein by reference).
- the anti-CD5 ADC has a serum half-life in a human subject of 3 days or less.
- anti-CD5 antibodies that can be used in the ADCs described herein can be identified using techniques known in the art, such as hybridoma production. Hybridomas can be prepared using a murine system. Protocols for immunization and subsequent Isolation of spienocyies for fusion are known in the art. Fusion partners and procedures for hybridoma generation are also known. Alternatively, anti-CD5 antibodies can be generated using the HuMAb-Mouse® or XenoMouseTM. In making additional anti-CD5 antibodies, the CD5 antigen is isolated and/or purified. The CD5 antigen may be a fragment of CD5 from the extracellular domain of CD5. Immunization of animals can be performed by any method known in the art.
- the CD5 antigen may be administered with an adjuvant to stimulate the immune response.
- adjuvants known in the art include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
- antibody-producing immortalized cell lines are prepared from cells isolated from the immunized animal. After immunization, the animal is sacrificed and lymph node and/or splenic B cells are immortalized by methods known in the art (e.g., oncogene transfer, oncogenic virus transduction, exposure to carcinogenic or mutating compounds, fusion with an immortalized cell, e.g., a myeloma cell, and inactivating a tumor suppressor gene. See, e.g., Harlow and Lane, supra. Hybridomas can be selected, cloned and further screened for desirable characteristics, including robust growth, high antibody production and desirable antibody characteristics.
- Anti-CD5 antibodies for use in the anti-CD5 ADCs described herein can also be identified using high throughput screening of libraries of antibodies or antibody fragments for molecules capable of binding CD5.
- Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian cell display, ribosome display, mRNA display, and cDNA display, among others.
- phage display to isolate antibodies, antigen-binding fragments, or ligands that bind biologically relevant molecules has been reviewed, for example, in Felici et al., Biotechnol. Annual Rev. 1 :149-183,
- Proteins such as multimeric proteins have been successfully phage-displayed as functional molecules (see, for example, EP 0349578; EP 4527839; and EP 0589877, as well as Chiswell and McCafferty, Trends Biotechnol. 10:80-84 1992, the disclosures of each of which are incorporated herein by reference as they pertain to the use of in vitro display techniques for the discovery of antigen-binding molecules.
- functional antibody fragments such as Fab and scFv fragments, have been expressed in in vitro display formats (see, for example, McCafferty et al., Nature 348:552- 554, 1990; Barbas et al., Proc. Natl. Acad. Sci.
- computational modeling techniques can be used to design and identify anti-CD5 antibodies or antibody fragments in silico, for instance, using the procedures described in US 2013/0288373, the disclosure of which is incorporated herein as it pertains to molecular modeling methods for identifying anti-CD5 antibodies.
- computational modeling techniques one of skill in the art can screen libraries of antibodies or antibody fragments in silico for molecules capable of binding specific epitopes on CD5, such as extracellular epitopes of CD5.
- the anti-CD5 antibody used in the ADCs described herein are able to internalize into the cell.
- additional techniques can be used to identify antibodies or antigen-binding fragments that bind CD5 on the surface of a cell (e.g., a T cell) and further are able to be internalized by the cell, for instance, by receptor-mediated endocytosis.
- the in vitro display techniques described above can be adapted to screen for antibodies or antigen-binding fragments thereof that bind CD5 on the surface of a hematopoietic stem cell and that are subsequently internalized. Phage display represents one such technique that can be used in conjunction with this
- an anti-CD5 antibody or fragment thereof can be assessed, for instance, using radionuclide internalization assays known in the art.
- an anti-CD5 antibody or fragment thereof, identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, 67 Ga, 1 1 1n, "Tc, 169 Yb, 186 Re, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As, 86 Y, 90 Y, 89 Zr, 212 Bi, 213 Bi, or 225 Ac.
- a radioactive isotope such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, 67 Ga, 1 1 1n
- radioactive halogens such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, can be incorporated into antibodies, fragments thereof, or ligands using beads, such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA). Radiolabeled antibodies, or fragments thereof, can be incubated with hematopoietic stem cells for a time sufficient to permit internalization.
- electrophilic halogen reagents e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA.
- Internalized antibodies, or fragments thereof, can be identified by detecting the emitted radiation (e.g., g-radiation) of the resulting hematopoietic stem cells in comparison with the emitted radiation (e.g., g-radiation) of the recovered wash buffer.
- the foregoing internalization assays can also be used to characterize ADCs.
- the anti-CD5 antibody has a defined serum half-life.
- an anti-CD5 antibody (or fragment thereof) may have a serum half-life of about 1 -24 hours in the human patient.
- ADCs containing such anti-CD5 antibodies can also, for example, have a serum half-life of about 1 -24 hours in a human patient.
- Pharmacokinetic analysis by measurement of serum levels can be performed by assays known in the art.
- nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.)
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2) ; mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- CHO Chinese Hamster Ovary
- the anti-CD5 antibodies that can be used in conjunction with the
- compositions and methods described herein include those that contain a combination of CDR-H1 , CDR-H2, CDR-H3, CDR-L1 , CDR-L2, and CDR-L3 regions set forth in Tables 1 and 2, below.
- CD137 is also referred to as CDw137, TNFRSF9, 4-1 BB, and ILA.
- Anti-CD137 antibodies, antigen binding fragments thereof and ADCs thereof can be used as therapeutic agents to prevent and treat GVFID from hematopoietic stem cells in a patient suffering from or at risk for GVFID or an autoimmune disease.
- ligands that bind CD137 such as human CD137L, can be used as a therapeutic agent to prevent or treat patient suffering from or at risk for GVHD.
- These ligands, such as soluble human CD137 can be covalently bound to an effector domain, such as an Fc domain, for instance, in order to promote antibody-dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- T cells have been shown to express CD137, as this antigen is a transmembrane TNF receptor superfamily of costimulatory molecules and is expressed on a variety of hematopoietic cells and promotes T cell activation and regulates proliferation and survival of T cells (see, e.g., Cannons et al., J. Immunol.
- Antibodies, and antigen-binding fragments thereof can be identified using techniques known in the art and described herein, such as by immunization, computational modeling techniques, and in vitro selection methods, such as the phage display and cell-based display platforms described below.
- Anti-CD137 antibodies that can be used to prevent and treat GVHD or an autoimmune disease by the methods disclosed herein include those that have one or more, or all, of the following CDRs:
- Additional anti-CD137 antibodies that can be used to prevent and treat GVHD and autoimmune diseases by the methods disclosed herein include those that have one or more, or all, of the following CDRs: a. a CDR-H1 having the amino acid sequence STYWIS (SEQ ID NO: 278);
- Additional anti-CD137 antibodies include those that have one or more, or all, of the following CDRs: a. a CDR-H1 having the amino acid sequence NSYAIS (SEQ ID NO: 285);
- Additional anti-CD137 antibodies or ADCs include those that have one or more, or all, of the following CDRs: a. a CDR-H1 having the amino acid sequence SDYYMH (SEQ ID NO: 291 );
- an anti-CD137 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine anti-CD137 antibody BBK2 (Thermo Fisher; MS621 PABX) or an anti-CD137 antibody comprising antigen binding regions corresponding to the BBK2 antibody.
- the BBK2 antibody (which may also be referred to as a BBK-2 antibody or an anti-4-1 BB antibody), is a mouse monoclonal antibody (lgG1 , kappa) that binds to the ectodomain of human 4-1 BB recombinant protein (4- 1 BB is also known as CD137).
- the methods and compositions of the disclosure include an anti-CD137 antibody comprising the binding regions (e.g., the CDRs) of the BBK2 antibody.
- the methods and compositions of the disclosure comprise an antibody that competitively inhibits the binding of the BBK2 antibody to its epitope on CD137.
- the anti-CD137 antibody is humanized BBK2 or chimeric BBK2.
- the methods and compositions described herein include a chimeric anti-CD137 (ch-BBK2) antibody comprising the variable heavy and light chain regions of BBK2.
- the chimeric BBK2 antibody is an IgG 1 antibody comprising human constant regions.
- the heavy chain amino acid sequence of ch-BBK2 is described in SEQ ID NO: 297, and the light chain amino acid sequence of ch-BBK2 is described in SEQ ID NO: 298.
- the CDR regions (CDR1 , CDR2, and CDR3) of each of the heavy and light chain sequences are described in bold below.
- the variable regions are italicized.
- the VH CDR amino acid sequences of anti- CD137 antibody BBK2 are as follows: SGYTFTSYW (VH CDR1 ; SEQ ID NO: 299); NIYPSDSYT (VH CDR2; SEQ ID NO: 300) and TRNGVEGYPHYYAME (VH CDR3; SEQ ID NO: 301 ).
- the VL CDR amino acid sequences of anti-CD137 antibody BBK2 are as follows:
- VL CDR1 SEQ ID NO: 302
- YYTS VL CDR2; SEQ ID NO: 303
- CQQGYTLPY VL CDR3; SEQ ID NO: 304
- CDR regions of BBK2 can be defined according to Kabat numbering. CDRs as defined by Kabat numbering are described below for each of the heavy and light chain sequences
- variable regions of BBK2 are italicized.
- the VH CDR amino acid sequences of anti-CD137 antibody BBK2 are as follows: SYWIN (VH CDR1 ; SEQ ID NO: 305); NIYPSDSYTNYNQKFKD (VH CDR2; SEQ ID NO: 306) and NGVEGYPHYYAMEY (VH CDR3; SEQ ID NO: 307), and the VL CDR amino acid sequences of anti-CD137 antibody BBK2 (including ch-BBK2) are as follows: RASQDLSNHLY (VL CDR1 ; SEQ ID NO: 308); YTSRLHS (VL CDR2; SEQ ID NO: 309) and QQGYTLPYT (VL CDR3; SEQ ID NO: 310).
- the heavy chain variable region of BBK2 is set forth in SEQ ID NO: 31 1 as
- the light chain variable region of BBK2 is set forth in SEQ ID NO: 312 as
- Anti-CD137 antibodies can comprise the heavy and light chain variable region amino acid sequences as set forth in SEQ ID Nos:
- the anti-CD137 antibody e.g., a chimeric (ch-BBK2) antibody or a humanized BBK2 antibody, comprises a heavy chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 305, a CDR2 comprising the amino acid sequence of SEQ ID NO: 306, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 307; and comprises a light chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 308, a CDR2 comprising the amino acid sequence of SEQ ID NO: 309, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 310.
- ch-BBK2 chimeric antibody
- humanized BBK2 antibody comprises a heavy chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 305, a CDR2 comprising the amino acid sequence of SEQ ID NO: 306, and a CDR3 comprising the amino acid
- the anti-CD137 antibody e.g., a chimeric (ch-BBK2) antibody or a humanized BBK2 antibody, comprises a heavy chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 299, a CDR2 comprising the amino acid sequence of SEQ ID NO: 300, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 301 ; and comprises a light chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 302, a CDR2 comprising the amino acid sequence of SEQ ID NO: 303, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 304.
- ch-BBK2 chimeric antibody
- humanized BBK2 antibody comprises a heavy chain variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 299, a CDR2 comprising the amino acid sequence of SEQ ID NO: 300, and a CDR3 comprising the amino
- BBK2, humanized BBK2, or chimeric BBK2 antibodies can be used in the anti-CD137 ADCs and methods described herein. Each of these antibodies can be conjugated to any of the cytotoxin described below using methods known in the art and those described herein.
- anti-CD137 antibodies that can be used in conjunction with a cytotoxin described herein can be identified using techniques known In the art (e.g., hybridoma production). Hybridomas can be prepared using a murine system. Protocols for immunization and subsequent isolation of spienocytes for fusion are known in the art. Fusion partners and procedures for hybridoma generation are also known. Human anti- CD137 antibodies can also be generated in the HuMAb-Mouse® or XenoMouseTM. In making anti-CD137 antibodies, the CD137 antigen is isolated and/or purified. The CD137 antigen may be a fragment of CD137 from the extracellular domain of CD137. Immunization of animals can be performed by any method known in the art.
- the CD137 antigen may be administered with an adjuvant to stimulate the immune response.
- adjuvants known in the art include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
- antibody-producing immortalized cell lines are prepared from cells isolated from the immunized animal. After immunization, the animal is sacrificed and lymph node and/or splenic B cells are immortalized by methods known in the art (e.g., oncogene transfer, oncogenic virus transduction, exposure to carcinogenic or mutating compounds, fusion with an immortalized cell, e.g., a myeloma cell, and inactivating a tumor suppressor gene. See, e.g., Harlow and Lane, supra. Hybridomas can be selected, cloned and further screened for desirable characteristics, including robust growth, high antibody production and desirable antibody characteristics.
- Anti-CD137 antibodies can be generated from an isolated nucleic acid molecule that comprises a nucleotide sequence encoding an amino acid sequence of a CD137 binding molecule provided by the present disclosure.
- the amino acid sequence encoded by the nucleotide sequence may be any portion of an antibody, such as a CDR, a sequence comprising one, two, or three CDRs, a variable region of a heavy chain, variable region of a light chain, or may be a full-length heavy chain or full length light chain.
- a nucleic acid of the disclosure can be, for example, DNA or RNA, and may or may not contain intronic sequences. Typically, the nucleic acid is a cDNA molecule.
- soluble CD137 ligands such as human CD137 ligand
- soluble CD137 ligands can be administered to a patient according to the methods described herein to condition a patient prior to hematopoietic stem cell transplant therapy.
- CD137 ligands such as human CD137 ligand
- CD137 ligands can be conjugated to a cytotoxin (e.g., according to the methods described below or known in the art) or another effector molecule, such as an Fc domain.
- Maytansine cytotoxins for use with the methods described herein include, for example, human CD137 Mgand-lgGI Fc conjugates, human CD137 ligand-lgG2 Fc conjugates, human CD137 Mgand-lgG3 Fc conjugates, human CD137 ligand-lgG4 Fc conjugates, human CD137 ligand-lgA Fc conjugates, human CD137 ligand-lgE Fc conjugates, human CD137 ligand-lgM Fc conjugates, and human CD137 ligand-lgD Fc conjugates.
- Antibodies and ligands for use in conjunction with the compositions and methods described herein include variants of those antibodies described above, such as antibody fragments that contain or lack an Fc domain, as well as humanized variants of non-human antibodies described herein and antibody-like protein scaffolds (e.g., 10 Fn3 domains) containing one or more, or all, of the CDRs or equivalent regions thereof of an antibody, antibody fragment, or soluble ligand described herein.
- the present invention also provides antibodies, or antigen-binding fragments thereof, capable of binding CD252 (also referred to as 0X40 ligand (OX40L), Protein NCBI Reference Sequence:
- NP_003317.1 Uniprot Accession No: P23510; SEQ ID NOs: 313 or 314) can be used as a therapeutic agent to prevent and treat GVHD.
- Such antibodies can be used alone or conjugated to a cytotoxin as an antibody drug conjugate (ADC).
- ADC antibody drug conjugate
- methods and compositions (e.g., ADCs) described herein include an anti- CD252 antibody whose heavy and light chain amino acid sequences are set forth in SEQ ID NOs. 315 and 316, respectively.
- an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 315, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 316.
- an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 31 5, and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 316.
- the amino acid sequences of SEQ ID NOs: 315 and 31 6 are provided below.
- an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NOs: 317- 319, and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 320-322.
- the amino acid sequences of SEQ ID NOs: 3-8 are provided below.
- Anti-CD252 VH amino acid sequence (the following CDR sequences are defined by IMGT)
- CDR-H2 ISGSGGAT (SEQ ID NO: 318)
- CDR-H3 TKDRLIMATVRGPYYYGMDV (SEQ ID NO: 319)
- Anti-CD252 VL amino acid sequence (the following CDR sequences are defined by IMGT)
- CDR-L2 AAS (SEQ ID NO: 321 )
- an anti-CD252 antibody used in the methods and compositions disclosed herein is an intact antibody comprising a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 31 5, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 316.
- the anti-CD252 antibody is engineered to have a short half life.
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is an antibody selected from 1 1 C3.1 (Biolegend, Catalog #326302), 159403 (R&D Systems, Catalog #MAB10541 ), 159408 (R&D Systems, Catalog #MAB1054), MM0505-8S23 (Novus, Catalog #NBP2-1 1969), or oxelumab (Novus Catalog #NBP2-52687-0.1 ).
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 1 1 C3.1 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 1 1 C3.1 antibody. 1 1 C3.1 (sold by Biolegend Cat. No. 326302 (date February 27, 2019)).
- an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 1 C3.1 , and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 1 C3.1 .
- an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 1 1 C3.1 antibody.
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 159403 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 159403 antibody. 159403 (sold by R&D Systems, Catalog #MAB10541 (date February 27, 201 9)).
- an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 59403, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159403.
- an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 159403 antibody.
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 159408 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 159408 antibody. 159408 (sold by R&D Systems, Catalog #MAB1054 (date February 27, 2019)).
- an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 59408, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159408.
- an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 159408 antibody.
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody MM0505-8S23 or an anti- CD252 antibody comprising antigen binding regions corresponding to the MM0505-8S23 antibody.
- MM0505- 8S23 sold by Novus, Catalog #NBP2-1 1 969 (date February 27, 2019)
- This antibody was produced from a hybridoma (mouse myeloma fused with spleen cells from a mouse immunized with human TNFSF4, also called 0X40 ligand.
- an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody MM0505-8S23, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody MM0505-8S23.
- an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized MM0505-8S23 antibody.
- an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the rabbit monoclonal anti-CD252 antibody oxelumab or an anti-CD252 antibody comprising antigen binding regions corresponding to the oxelumab antibody.
- Oxelumab sold by Novus, Catalog #NBP2-52687-0.1 (date February 27, 2019)).
- an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody oxelumab, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody oxelumab.
- an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized oxelumab antibody.
- the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain as set forth in the amino acid sequence of SEQ ID NO: 323, and a light chain chain as set forth in the amino acid sequence of SEQ ID NO: 324.
- the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 331 , and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 332.
- an anti- CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 325-327, and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 328-330.
- the antibody is an intact antibody comprising a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 331 , and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 332.
- the amino acid sequences of SEQ ID NOs: 323-330 are provided below.
- oxelumab full length heavy chain sequence (the following CDR sequences are defined by IMGT ; the heavy chain variable region (SEQ ID NO: 331 ) has been underlined):
- CDR-H2 ISGSGGFT (SEQ ID NO: 326)
- CDR-H3 AKDRLVAPGTFDY (SEQ ID NO: 327) oxelumab full length light chain sequence (the following CDR sequences are defined by IMGT ; the light chain variable region (SEQ ID NO: 332) has been underlined):
- CDR-L2 AAS (SEQ ID NO: 329)
- CDR-L3 QQYNSYPYT (SEQ ID NO: 330)
- anti-CD252 antibodies or binding fragments described herein may also include modifications and/or mutations that alter the properties of the antibodies and/or fragments, such as those that increase half-life, increase or decrease ADCC, etc., as is known in the art.
- an anti-CD252 antibody, or binding fragment thereof, used in the methods and compositions disclosed herein comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR. Certain amino acid positions within the Fc region are known through
- the anti-CD252 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an Fc.y.R based on structural and crystallographic analysis.
- the Fc region of the anti-CD252 antibody comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991 ), expressly incorporated herein by references.
- the "EU index as in Kabat” refers to the numbering of the human lgG1 EU antibody.
- the Fc region comprises a D265A mutation.
- the Fc region comprises a D265C mutation.
- the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat.
- the Fc region comprises a L234A mutation.
- the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat.
- the Fc region comprises a L235A mutation.
- the Fc region comprises a L234A and L235A mutation.
- the Fc region comprises a D265C,
- a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc. gamma. R and/or C1 q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- an anti-CD252 antibody comprising a modified Fc region e.g., comprising a L234A, L235A, and a D265C mutation
- Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORETM. analysis or OctetTM analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a
- radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- the antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9), (Hinton et al. (2004) J Biol Chem 279: 6213-6), (Hinton et al. (2006) J Immunol 176: 346-56), (Shields et al. (2001 ) J Biol Chem 276: 6591 - 604), (Petkova et al. (2006) Int Immunol 18: 1759-69), (Datta-Mannan et al.
- Fc mutations such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9), (Hi
- Exemplary mutations that may be made singularly or in combination are T250Q, M252Y, 1253A, S254T, T256E, P2571 , T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R mutations.
- the Fc region comprises a mutation resulting in a decrease in half life.
- An antibody having a short half life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by HSCs. Ideally, the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express CD252 but are not the target of the anti-CD252 antibody, unlike the endogenous stem cells.
- the Fc regions comprises a mutation at position 435 (EU index according to Kabat). In one embodiment, the mutation is an H435A mutation.
- the anti-CD252 antibody described herein has a half life of equal to or less than about 14 hours, equal to or less than about 13 hours, equal to or less than about 12 hours, or equal to or less than about 1 1 hours. In one embodiment, the anti-CD252 antibody described herein has a half life of equal to or less than about 24 hours, a half life of equal to or less than about 22 hours, a half life of equal to or less than about 20 hours, a half life of equal to or less than about 18 hours, a half life of equal to or less than about 16 hours, a half life of equal to or less than about 14 hours, equal to or less than about 13 hours, equal to or less than about 12 hours, or equal to or less than about 1 1 hours.
- the half life of the antibody is between about 1 hour to about 20 hours, between about 2 hours to about 18 hours, between about 4 hours to about 16 hours, between about 6 hours to about 14 hours, between about 8 hours to about 12 hours, between about 1 1 hours to about 12 hours, between about 1 1 hours to about 24 hours; between about 12 hours to about 22 hours; between about 10 hours to about 20 hours; between about 8 hours to about 1 8 hours; between about 1 hours to about 6 hours, between about 2 hours to about 5 hours, between about 3 hours to about 4 hours, or between about 14 hours to about 24 hours.
- the Fc region comprises two or more mutations that confer reduced half-life and greatly diminish or completely abolish an effector function of the antibody.
- the Fc region comprises a mutation resulting in a decrease in half-life and a mutation of at least one residue that can make direct contact with an FcyR (e.g., as based on structural and crystallographic analysis).
- the Fc region comprises a H435A mutation, a L234A mutation, and a L235A mutation.
- the Fc region comprises a H435A mutation and a D265C mutation.
- the Fc region comprises a FI435A mutation, a L234A mutation, a L235A mutation, and a D265C mutation.
- the antibody or antigen-binding fragment thereof is conjugated to a cytotoxin (e.g., amatoxin) by way of a cysteine residue in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue may be selected from the group consisting of Cys1 18, Cys239, and Cys265.
- the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat.
- the Fc region comprises a D265C mutation.
- the Fc region comprises a D265C and H435A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, and a L235A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, a L235A, and a H435A mutation.
- the cysteine residue is naturally occurring in the Fc domain of the antibody or antigen-binding fragment thereof.
- the Fc domain may be an IgG Fc domain, such as a human IgG 1 Fc domain, and the cysteine residue may be selected from the group consisting of Cys261 , Csy321 , Cys367, and Cys425.
- D265C is an Fc variant with the aspartic acid (D) at EU position 265 substituted with cysteine (C) relative to the parent Fc domain.
- D aspartic acid
- C cysteine
- D265C/L234A/L235A defines a variant Fc variant with substitutions at EU positions 265 (D to C), 234 (L to A), and 235 (L to A) relative to the parent Fc domain.
- a variant can also be designated according to its final amino acid composition in the mutated EU amino acid positions.
- the L234A/L235A mutant can be referred to as LALA. It is noted that the order in which substitutions are provided is arbitrary.
- the anti-CD252 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD252 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- an anti-CD252 antibody, or antigen binding fragment thereof has a certain dissociation rate which is particularly advantageous when used as a part of a conjugate.
- an anti-CD252 antibody has, in certain embodiments, an off rate constant (Koff) for human CD252 and/or rhesus CD252 of 1 x 10 2 to 1 x 10 3 , 1 x 10 3 to 1 x 1 0 4 , 1 x 10 5 to 1 x 10 6 , 1 x 1 0 6 to 1 x 10 7 or 1 x 1 0 7 to 1 x 10 -8 , as measured by bio-layer interferometry (BLI).
- Koff off rate constant
- the antibody or antigen binding fragment thereof binds CD252 (e.g., human CD252 and/or rhesus CD252) with a KD of about 100 nM or less, about 90nM or less, about 80 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 20 nM or less, about 1 0 nM or less, about 8 nM or less, about 6 nM or less, about 4 nM or less, about 2 nM or less, about 1 nM or less as determined by a Bio- Layer Interferometry (BLI) assay.
- BBI Bio- Layer Interferometry
- the antibody or antigen-binding fragment thereof binds CD252 (e.g., human CD252 and/or rhesus CD252) with a KD of between about 90 nM - 100 nM, between about 80 nM - 90nM, between about 70 nM - 80 nM, between about 60 nM - 70 nM, between about 50 nM - 60 nM, between about 40 nM - 50 nM, between about 30 nM - 40 nM, between about 20 nM - 30 nM, between about 1 0 nM - 20 nM, between about 8 nM - 10 nM, between about 6 nM - 8 nM, between about 4 nM - 6 nM, between about 2 nM - 4 nM, between about 1 nM - 2 nM, or about 1 nM or less as determined by a Bio-Layer Interferometry (BLI
- antibodies, and binding fragments thereof, disclosed herein can be used in conjugates, as described in more detail below.
- Exemplary antigen-binding fragments of the foregoing antibodies include a dual-variable
- the anti-CD252 antibodies described herein can be in the form of full-length antibodies, bispecific antibodies, dual variable domain antibodies, multiple chain or single chain antibodies, and/or binding fragments that specifically bind human CD252, including but not limited to Fab, Fab', (Fab')2, Fv), scFv (single chain Fv), surrobodies (including surrogate light chain construct), single domain antibodies, camelized antibodies and the like. They also can be of, or derived from, any isotype, including, for example,
- the anti-CD252 antibody is an IgG (e.g. lgG1 , lgG2, lgG3 or lgG4).
- the anti-CD252 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD252 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- Antibodies and antigen-binding fragments capable of binding human CD45 can be used in conjunction with the compositions and methods disclosed herein, such as to promote engraftment of hematopoietic stem cell grafts in a patient in need of
- compositions and methods disclosed herein include an anti-CD45 antibody or ADC that binds to human CD45RO as set forth in the amino acid sequence of SEQ ID NO: 336.
- Anitbodies that bind to the various isoforms of CD45 disclosed herein are also contemplated for use in the methods and compositions disclosed herein.
- Multiple isoforms of CD45 arise from the alternative splicing of 34 exons in the primary transcript. Splicing of exons 4, 5, 6, and potentially 7 give rise to multiple CD45 variations. Selective exon expression is observed in the CD45 isoforms described in Table 3, below. Table 3. Exon expression in various CD45 isoforms
- CD45RO lacks expression of exons 4-6 and is generated from a combination of exons 1 -3 and 7-34.
- exon 7 can also be excluded from the protein, resulting in splicing together of exons 1 -3 and 8-34.
- This protein, designated E3-8, has been detected at the mRNA level but has not been currently identified by flow cytometry.
- CD45RO is currently the only known CD45 isoform expressed on hematopoietic stem cells.
- CD45RA and CD45RABC have not been detected or are excluded from the phenotype of hematopoietic stem cells.
- CD45RB is expressed on fetal hematopoietic stem cells, but it is not present on adult bone marrow hematopoietic stem cells.
- CD45RC has a high rate of polymorphism in exon 6 found within Asian populations (a polymorphism at exon 6 in CD45RC is found in approximately 25% of the Japanese population). This polymorphism leads to high expression of CD45RO and decreased levels of CD45RA, CD45RB, and CD45RC.
- CD45RA variants exhibit a polymorphism in exon 4 that has been associated with autoimmune disease.
- CD45RO on hematopoietic stem cells and its comparatively limited expression on other immune cells (such as T and B lymphocyte subsets and various myeloid cells) renders CD45RO a particularly well-suited target for conditioning therapy for patients in need of a hematopoietic stem cell transplant.
- CD45RO only lacks expression of exons 4, 5, and 6, its use as an immunogen enables the screening of pan CD45 Abs and CD45RO-specific antibodies.
- Anti-CD45 antibodies that can be used in conjunction with the patient conditioning methods described herein include anti-CD45 antibodies, and antigen-binding portions thereof. Antigen-binding portions of antibodies are well known in the art, and can readily be constructed based on the antigen-binding region of the antibody.
- the anti-CD45 antibody used in conjunction with the conditioning methods described herein can be a monoclonal antibody or antigen-binding fragment thereof, a polyclonal antibody or antigen-binding fragment thereof, a humanized antibody or antigen-binding fragment thereof, a fully human antibody or antigen-binding fragment thereof, a chimeric antibody or antigen-binding fragment thereof, a bispecific antibody or antigen-binding fragment thereof, a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’)2 molecule, or a tandem di-scFv.
- Exemplary anti-CD45 antibodies which may be used in whole or in part in the ADCs or methods described herein are provided below.
- the anti-CD45 antibody is or is derived from clone HI30, which is commercially available from BIOLEGEND® (San Diego, CA), or a humanized variant thereof. Humanization of antibodies can be performed by replacing framework residues and constant region residues of a non-human antibody with those of a germline human antibody according to procedures known in the art (as described, for instance, in Example 7, below).
- Additional anti-CD45 antibodies that can be used in conjunction with the methods described herein include the anti-CD45 antibodies ab10558, EP322Y, MEM-28, ab10559, 0.N.125, F10-89-4, Hle-1 , 2B1 1 , YTH24.5, PD7/26/1 6, F10-89-4, 1 B7, ab154885, B-A1 1 , phosphor S1007, ab170444, EP350, Y321 , GA90, D3/9, X1 6/99, and LT45, which are commercially available from ABCAM® (Cambridge, MA), as well as humanized variants thereof.
- Further anti-CD45 antibodies that may be used in conjunction with the patient conditioning procedures described herein include anti-CD45 antibody
- HPA000440 which is commercially available from SIGMA-ALDRICH® (St. Louis, MO), and humanized variants thereof.
- Additional anti-CD45 antibodies that can be used in conjunction with the patient conditioning methods described herein include murine monoclonal antibody BC8, which is described, for instance, in Matthews et al. , Blood 78:1864-1874, 1991 , the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies, as well as humanized variants thereof.
- Further anti-CD45 antibodies that can be used in conjunction with the methods described herein include monoclonal antibody YAML568, which is described, for instance, in Glatting et al., J. Nucl. Med.
- anti-CD45 antibodies 8:1335-1341 , 2006, the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies, as well as humanized variants thereof.
- Additional anti-CD45 antibodies that can be used in conjunction with the patient conditioning procedures described herein include monoclonal antibodies YTH54.12 and YTH25.4, which are described, for instance, in Brenner et al., Ann. N.Y. Acad. Sci. 996:80-88, 2003, the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies, as well as humanized variants thereof.
- Additional anti-CD45 antibodies for use with the patient conditioning methods described herein include UCHL1 , 2H4, SN130, MD4.3, MBI, and MT2, which are described, for instance, in Brown et al., Immunology 64:331 -336, 1998, the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies, as well as humanized variants thereof.
- Additional anti-CD45 antibodies that can be used in conjunction with the methods described herein include those produced and released from American Type Culture Collection (ATCC) Accession Nos. RA3-6132, RA3-2C2, and TIB122, as well as monoclonal antibodies C363.16A, and 13/2, which are described, for instance, in Johnson et al., J. Exp. Med.
- anti-CD45 antibodies that can be used in conjunction with the patient conditioning methods described herein include the monoclonal antibodies AHN- 12.1 , AHN-12, AHN-12.2, AHN-12.3, AHN-12.4, HLe-1 , and KC56(T200), which are described, for instance, in Harvath et al., J. Immunol. 146:949-957, 1991 , the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies, as well as humanized variants thereof.
- Additional anti-CD45 antibodies that can be used in conjunction with the patient conditioning methods described herein include those described, for example, in US Patent Nos. 7,265,212 (which describes, e.g., anti-CD45 antibodies 39E1 1 , 16C9, and 1 G1 0, among other clones); 7,160,987 (which describe, e.g., anti-CD45 antibodies produced and released by ATCC Accession No. HB-1 1873, such as monoclonal antibody 6G3); and 6,099,838 (which describes, e.g., anti-CD45 antibody MT3, as well as antibodies produced and released by ATCC Accession Nos.
- HB220 also designated MB23G2
- HB223 also designated MB23G220
- US 2004/0096901 and US 2008/0003224 which describes, e.g., anti-CD45 antibodies produced and released by ATCC Accession No. PTA-7339, such as monoclonal antibody 17.1 ), the disclosures of each of which are incorporated herein by reference as they pertain to anti-CD45 antibodies.
- anti-CD45 antibodies that can be used in conjunction with the patient conditioning methods described herein include antibodies produced and released from ATCC Accession Nos. MB4B4, MB23G2, 14.8, GAP 8.3, 74-9-3, I/24.D6, 9.4, 4B2, M1 /9.3.4.HL.2, as well as humanized and/or affinity-matured variants thereof.
- Affinity maturation can be performed, for instance, using in vitro display techniques described herein or known in the art, such as phage display, as described in Example 6, below.
- anti-CD45 antibody T29/33 which is described, for instance, in Morikawa et al. , Int. J. Hematol. 54:495-504, 1991 , the disclosure of which is incorporated herein by reference as it pertains to anti-CD45 antibodies.
- the anti-CD45 antibody is selected from apamistamab (also known 90Y- BC8, lomab-B, BC8; as described in, e.g., US20170326259, WO2017155937, and Orozco et al. Blood.
- apamistamab also known 90Y- BC8, lomab-B, BC8; as described in, e.g., US20170326259, WO2017155937, and Orozco et al. Blood.
- BC8-B10 (as described, e.g., in Li et al. PloS one 13.1 0 (201 8): e0205135.), each of which is incorporated by reference.
- Other anti-CD45 antibodies have been described, for example, in W 02003/048327, WO2016/016442, US2017/0226209, US201 6/01 52733, US9,701 ,756; US201 1 /0076270, or US7,825,222, each of which is incorporated by reference in its entirety.
- the anti-CD45 antibody, or antigen-binding fragment thereof comprising binding regions, e.g., CDRs, variable regions, corresponding to those of apamistamab.
- the heavy chain variable region (VH) amino acid sequence of apamistamab is set forth in SEQ ID NO: 337.
- the light chain variable region (VL) amino acid sequence of apamistamab is described in SEQ ID NO: 338.
- an anti-CD45 antibody, or antigen-binding portion thereof comprises a variable heavy chain comprising the amino acid residues set forth in SEQ ID NO: 337, and a light chain variable region as set forth in SEQ ID NO: 338.
- the anti-CD45 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of apamistamab, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of apamistamab.
- the anti-CD45 antibody comprises a heavy chain of an anti-CD45 antibody described herein, and a light chain variable region of anti-CD45 antibody described herein. In one embodiment, the anti-CD45 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of an anti-CD45 antibody described herein, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of an anti-CD45 antibody described herein.
- the antibody, or antigen-binding fragment thereof comprises a heavy chain variable region that comprises an amino acid sequence having at least 95% identity to an anti-CD45 antibody herein, e.g., at least 95%, 96%, 97%, 98%, 99%, or 1 00% identity to an anti-CD45 antibody herein.
- an antibody comprises a modified heavy chain (HC) variable region comprising an HC variable domain of an anti-CD45 antibody herein, or a variant thereof, which variant (i) differs from the anti-CD45 antibody in 1 , 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from the anti-CD45 antibody in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from the anti-CD45 antibody in 1 -5, 1 -3, 1 -2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to the anti-CD45 antibody, wherein in any of (i)-(iv), an amino acid substitution may be a conservative amino acid substitution or a non-conservative amino acid substitution; and wherein the modified heavy chain variable region can have an enhanced biological activity relative to
- Antibodies and antigen-binding fragments that may be used in conjunction with the compositions and methods described herein include the above-described antibodies and antigen-binding fragments thereof, as well as humanized variants of those non-human antibodies and antigen-binding fragments described above and antibodies or antigen-binding fragments that bind the same epitope as those described above, as assessed, for instance, by way of a competitive CD45 binding assay.
- Methods for high throughput screening of antibody, or antibody fragment libraries for molecules capable of binding an antigen e.g., CD1 17 (e.g., GNNK+ CD1 1 7), or CD45
- an antigen e.g., CD2, CD5, CD137, or CD252
- mature immune cells e.g., T- cells
- Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian cell display, ribosome display, mRNA display, and cDNA display, among others.
- phage display to isolate antibodies, or antigen-binding fragments, that bind biologically relevant molecules has been reviewed, for example, in Felici et al., Biotechnol. Annual Rev. 1 :149-183, 1995; Katz, Annual Rev. Biophys. Biomol. Struct. 26:27-45, 1997; and Hoogenboom et al., Immunotechnology 4:1 -20, 1998, the disclosures of each of which are incorporated herein by reference as they pertain to in vitro display techniques.
- Randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind cell surface antigens as described in Kay, Perspect. Drug Discovery Des. 2:251 -268, 1995 and Kay et al., Mol. Divers. 1 :139-140, 1 996, the disclosures of each of which are incorporated herein by reference as they pertain to the discovery of antigen-binding molecules.
- Proteins, such as multimeric proteins have been successfully phage-displayed as functional molecules (see, for example, EP 0349578; EP 4527839; and EP 0589877, as well as Chiswell and McCafferty, Trends Biotechnol.
- Human anti-HC antibodies e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- HuMAb-Mouse® or XenoMouseTM can also be generated, for example, in the HuMAb-Mouse® or XenoMouseTM.
- computational modeling techniques can be used to design and identify antibodies capable of binding an antigen (e.g., CD1 1 7 (e.g., GNNK+ CD1 17), or CD45) expressed by hematopoietic stem cells or an antigen (e.g., CD2, CD5, CD137, or CD252) expressed by mature immune cells (e.g., T-cells), or antibody fragments in silico.
- an antigen e.g., CD1 1 7 (e.g., GNNK+ CD1 17), or CD45
- an antigen e.g., CD2, CD5, CD137, or CD252
- mature immune cells e.g., T-cells
- one of skill in the art can screen libraries of antibodies, or antibody fragments, in silico for molecules capable of binding specific epitopes on an antigen expressed by hematopoietic stem cells (e.g., CD1 17 (e.g., GNNK+ CD1 17) or CD45) or an antigen expressed by mature immune cells, such as T- cells (e.g., CD2, CD5, CD137, or CD252), such as extracellular epitopes of the antigen.
- the antibodies, or antigen-binding fragments thereof, identified by these computational techniques can be used in conjunction with the therapeutic methods described herein, such as, e.g., the cancer and autoimmune disease treatment methods described herein and the patient conditioning procedures described herein.
- Additional techniques can be used to identify antibodies, or antibody fragments, capable of binding an antigen expressed by hematopoietic stem cells (e.g., CD1 17 (e.g., GNNK+ CD1 17) or CD45) or an antigen expressed by mature immune cells, such as T-cells (e.g., CD2, CD5, CD137, or CD252) and that are internalized by the cell, for instance, by receptor-mediated endocytosis.
- CD1 17 e.g., GNNK+ CD1 17
- CD45 an antigen expressed by mature immune cells, such as T-cells (e.g., CD2, CD5, CD137, or CD252) and that are internalized by the cell, for instance, by receptor-mediated endocytosis.
- T-cells e.g., CD2, CD5, CD137, or CD252
- the in vitro display techniques described above can be adapted to screen for antibodies, or antibody fragments, that bind an antigen expressed by hematopoietic stem cells (e.g., CD1 17 (e.g., GNNK+ CD1 1 7) or CD45) or an antigen expressed by mature immune cells, such as T-cells (e.g., CD2, CD5, CD137, or CD252) and that are subsequently internalized.
- hematopoietic stem cells e.g., CD1 17 (e.g., GNNK+ CD1 1 7) or CD45
- an antigen expressed by mature immune cells such as T-cells (e.g., CD2, CD5, CD137, or CD252) and that are subsequently internalized.
- Phage display represents one such technique that can be used in conjunction with this screening paradigm.
- an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- hematopoietic stem cells or immune cells
- recombinant phage libraries can be produced that encode antibodies, antibody fragments, such as scFv fragments, Fab fragments, diabodies, triabodies, and 10 Fn3 domains, among others, or ligands that contain randomized amino acid cassettes (e.g., in one or more, or all, of the CDRs or equivalent regions thereof or an antibody or antibody fragment).
- the framework regions, hinge, Fc domain, and other regions of the antibodies or antibody fragments may be designed such that they are non-immunogenic in humans, for instance, by virtue of having human germline antibody sequences or sequences that exhibit only minor variations relative to human germline antibodies.
- phage libraries containing randomized antibodies, or antibody fragments, covalently bound to the phage particles can be incubated with an antigen (e.g., CD1 1 7 (e.g., GNNK+ CD1 1 7), CD45, CD2, CD5, CD137, or CD252), for instance, by first incubating the phage library with blocking agents (such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding antibodies, or antibody fragments, that exhibit non specific protein binding and phage that encode antibodies or fragments thereof that bind Fc domains, and then incubating the phage library with a population of hematopoietic stem cells or mature immune cells (e.g., T-cells), which express, e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252
- the phage library can be incubated with an antigen (e.g.
- anti-HC antibodies e.g., anti-CD1 17 antibody, anti- CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- anti-HC antibodies e.g., anti-CD1 17 antibody, anti- CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- antibody fragments thereof to bind the cognate cell-surface antigen (e.g., CD1 17 (e.g., GNNK+ CD1 17), CD45, CD2, CD5, CD137, or CD252) and to subsequently be internalized by the hematopoietic stem cells (e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C).
- Phage bound to antibodies, or antibody fragments thereof, that have been internalized by the target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells can be identified, for instance, by lysing the cells and recovering internalized phage from the cell culture medium.
- the phage can then be amplified in bacterial cells, for example, by incubating bacterial cells with recovered phage in 2xYT medium using methods known in the art. Phage recovered from this medium can then be characterized, for instance, by determining the nucleic acid sequence of the gene(s) encoding the antibodies, or antibody fragments, inserted within the phage genome.
- the encoded antibodies, or antibody fragments thereof can subsequently be prepared de novo by chemical synthesis (for instance, of antibody fragments thereof, such as scFv fragments) or by recombinant expression (for instance, of full-length antibodies).
- anti-HC antibodies e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti- CD252 antibody
- antibody fragments thereof identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, 67 Ga, 1 1 1n, "Tc, 169 Yb, 186 Re, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As, 86 Y, 90 Y, 89 Zr, 212 Bi, 213 Bi, or 225 Ac.
- a radioactive isotope such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21
- radioactive halogens such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 21 1 At, can be incorporated into antibodies, or antibody fragments, using beads, such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA).
- Radiolabeled antibodies, fragments thereof, or ADCs can be incubated with target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells, for a time sufficient to permit internalization (e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C).
- target cells such as cancer cells, autoimmune cells, or hematopoietic stem cells
- the cells can then be washed to remove non-internalized antibodies or fragments thereof, (e.g., using cold (4° C) 0.1 M glycine buffer at pH 2.8).
- Internalized antibodies, or antibody fragments thereof, can be identified by detecting the emitted radiation (e.g., g-radiation) of the resulting target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells in comparison with the emitted radiation (e.g., g-radiation) of the recovered wash buffer.
- the foregoing internalization assays can also be used to characterize ADCs.
- Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,81 6,567.
- isolated nucleic acid encoding an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors comprising such nucleic acid are provided.
- a host cell comprising such nucleic acid.
- a host cell comprises (e.g., has been transformed with): (1 ) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g.
- a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
- nucleic acid encoding an antibody e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.)
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2) ; mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- CHO Chinese Hamster Ovary
- ADCs Antibody Drug Conjugates
- Antibodies can be conjugated (linked) to a cytotoxin via a linker.
- the cytotoxic molecule is conjugated to a cell internalizing antibody, or antigen-binding fragment thereof as disclosed herein such that following the cellular uptake of the antibody, or fragment thereof, the cytotoxin may access its
- cytotoxins can be conjugated to the anti-CD1 17 antibody, e.g., 1 , 2, 3, 4, 5, 6, 7, or 8.
- Cytotoxins suitable for use with the compositions and methods described herein include DNA- intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein
- biosynthesis e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain
- agents that exhibit rRNA N-glycosidase activity such as saporin and ricin A-chain
- cytotoxins can be conjugated to an anti-HC antibody (e.g., an anti-CD1 17 antibody, an anti- CD45 antibody, an anti-CD2 antibody, an anti-CD5 antibody, an anti-CD137 antibody, or an anti-CD252 antibody) via a linker for use in the therapies described herein.
- the anti-HC ADCs e.g., anti- CD1 17 ADC, anti-CD45 ADC, anti-CD2 ADC, anti-CD5 ADC, anti-CD137 ADC, or anti-CD252 ADC
- the cytotoxic moiety exhibits reduced or no cytotoxicity when bound in a conjugate, but resumes cytotoxicity after cleavage from the linker. In various embodiments, the cytotoxic moiety maintains cytotoxicity without cleavage from the linker.
- the cytotoxic molecule is conjugated to a cell internalizing antibody, or antigen-binding fragment thereof as disclosed herein, such that following the cellular uptake of the antibody, or fragment thereof, the cytotoxin may access its intracellular target and, e.g., mediate T cell death.
- ADCs of the present disclosurepresent disclosure therefore may be of the general formula Ab-(Z-L- D)n, wherein an antibody or antigen-binding fragment thereof (Ab) is conjugated (covalently linked) to linker (L), through a chemical moiety (Z), to a cytotoxic moiety (“drug,” D), each as disclosed herein.
- the antibody or antigen-binding fragment thereof may be conjugated to a number of drug moieties as indicated by integer n, which represents the average number of cytotoxins per antibody, which may range, e.g., from about 1 to about 20. In some embodiments, n is from 1 to 4. In some embodiments, n is 1 .
- the average number of drug moieties per antibody in preparations of ADC from conjugation reactions may be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC. The quantitative distribution of ADC in terms of n may also be determined. In some instances, separation, purification, and characterization of homogeneous ADC where n is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
- anti-HC ADCs may be limited by the number of attachment sites on the antibody.
- an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
- antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety; primarily, cysteine thiol residues in antibodies exist as disulfide bridges.
- an antibody may be reduced with a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or total reducing conditions, to generate reactive cysteine thiol groups.
- a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP)
- DTT dithiothreitol
- TCEP tricarbonylethylphosphine
- higher drug loading e.g. n>5
- an antibody may contain, for example, lysine residues that do not react with the drug-linker intermediate or linker reagent, as discussed below. Only the most reactive lysine groups may react with an amine-reactive linker reagent. In certain embodiments, an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
- the loading (drug/antibody ratio) of an ADC may be controlled in different ways, e.g., by: (i) limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, (iii) partial or limiting reductive conditions for cysteine thiol modification, (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/or position of linker-drug attachments.
- Cytotoxins suitable for use with the compositions and methods described herein include DNA- intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein
- biosynthesis e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain
- agents that exhibit rRNA N-glycosidase activity such as saporin and ricin A-chain
- the cytotoxin is a microtubule-binding agent (for instance, maytansine or a maytansinoid), an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an indolinobenzodiazepine dimer, an a microtubule-binding agent (for instance, maytansine or a maytansinoid), an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinote
- indolinobenzodiazepine pseudodimer or a variant thereof, or another cytotoxic compound described herein or known in the art.
- the cytotoxin of the antibody-drug conjugate is an RNA polymerase inhibitor. In some embodiments, the RNA polymerase inhibitor is an amatoxin or derivative thereof. In some embodiments, the cytotoxin of the antibody-drug conjugate as disclosed herein is an amatoxin or derivative thereof, such as an a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, proamanullin or a derivative thereof.
- cytotoxins that can be used in the anti-HC ADCs (e.g., anti-CD1 17 ADC, anti-CD45 ADC, anti-CD2 ADC, anti-CD5 ADC, anti-CD137 ADC, or anti-CD252 ADC) useful in the methods of the invention are described below.
- the methods and compositions disclosed herein include ADCs comprising an RNA polymerase inhibitor, e.g., an amatoxin, as the cytotoxin conjugated to an anti-HC antibody (e.g., an anti-CD1 17 antibody).
- an RNA polymerase inhibitor e.g., an amatoxin
- the cytotoxin of the antibody-drug conjugate is an RNA polymerase inhibitor.
- the RNA polymerase inhibitor is an amatoxin or derivative thereof.
- the cytotoxin of the antibody-drug conjugate as disclosed herein is an amatoxin or derivative thereof such as an a-amanitin, b-amanitin, g-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, proamanullin or a derivative thereof.
- amatoxin or derivative thereof such as an a-amanitin, b-amanitin, g-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, proamanullin or a derivative thereof.
- Suitable amatoxins are disclosed in, e.g., Zanotti et al., Int. J. Peptide Protein Res. 30, 1987, 450-459.
- Amatoxins useful in conjunction with the compositions and methods described herein include compounds according to, but are not limited to, formula (III), including a-amanitin, b-amanitin, g-amanitin, e- amanitin, amanin, amaninamide, amanullin, amanullinic acid, or proamanullin.
- formula (III) is as follows:
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H or RD
- R4 is H, OH, ORD, or RD
- R5 is H, OH, ORD, or RD
- R6 is H, OH, ORD, or RD
- R7 is H, OH, ORD, or RD
- R8 is OH, NH2, or ORD
- R9 is H, OH, or ORD
- X is -S-, -S(O)-, or -SO2-;
- RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2- Ce heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C1-C6 alkyl
- heteroalkyl e.g., C1-C6 heteroalkyl
- alkenyl e.g., C2-C6 alkenyl
- heteroalkenyl
- amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (IMA)
- amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (NIB), below:
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H or RD
- R4 is H, OH, ORD, or RD
- Rs is H, OH, ORD, or RD;
- R6 is H, OH, ORD, or RD
- R7 is H, OH, ORD, or RD
- Rs is OH, NH2, or ORD
- R9 is H, OH, or ORD
- X is -S-, -S(O)-, or -SO2-; and RD is optionally substituted alkyl (e.g., C1 -C6 alkyl), optionally substituted heteroalkyl (e.g., C1 -C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2- C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C1 -C6 alkyl
- heteroalkyl e.g., C1 -C6 heteroalky
- amatoxins useful in conjunction with the compositions and methods described herein also include compounds according to formula (MIC), below:
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H or RD
- R4 is H, OH, ORD, or RD
- R5 is H, OH, ORD, or RD
- R6 is H, OH, ORD, or RD
- R7 is H, OH, ORD, or RD
- R8 is OH, NH2, or ORD
- R9 is H, OH, or ORD
- X is -S-, -S(O)-, or -SO2-;
- RD is optionally substituted alkyl (e.g., C1 -C6 alkyl), optionally substituted heteroalkyl (e.g., C1 -C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2- Ce heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C1 -C6 alkyl
- heteroalkyl e.g., C1 -C6 heteroalkyl
- alkenyl e.g., C2-C6 alkenyl
- the cytotoxin is an amanitin.
- the antibodies, and antigen-binding fragments, described herein may be bound to an amatoxin so as to form a conjugate represented by the formula Ab-Z-L-Am, wherein Ab is the antibody, or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety and Am is an amatoxin.
- Ab is the antibody, or antigen-binding fragment thereof
- L is a linker
- Z is a chemical moiety
- Am is an amatoxin.
- Many positions on amatoxins or derivatives thereof can serve as the position to covalently bond the linking moiety L, and, hence the antibodies or antigen-binding fragments thereof. Exemplary methods of amatoxin conjugation and linkers useful for such processes are described below.
- linker-containing amatoxins useful for conjugation to an antibody, or antigen-binding fragment in accordance with the compositions and methods described herein are shown in structural formulas (I), (IA), (IB), (II), (IIA), and (MB), recited herein.
- amatoxin-linker conjugate Am-L-Z is represented by formula (I)
- Ri is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H, Rc, or RD
- R4 is H, OH, ORc, ORD, RC, or RD;
- R5 is H, OH, ORc, ORD, RC, or RD;
- R6 is H, OH, ORc, ORD, RC, or RD;
- R7 is H, OH, ORc, ORD, RC, or RD;
- RS is OH, NH2, ORc, ORD, NHRC, or NRCRD;
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-;
- Rc is -L-Z
- RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2- Ce heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C1-C6 alkyl
- heteroalkyl e.g., C1-C6 heteroalkyl
- alkenyl e.g., C2-C6 alkenyl
- heteroalkenyl
- optionally substituted alkylene e.g., C1-C6 alkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds a target antigen (e.g., CD1 17).
- Am contains exactly one Rc substituent.
- S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen binding fragment thereof, that binds a target antigen (e.g., from the -SH group of a cysteine residue).
- the conjugate Am-L-Z-Ab is represented by one of formulas IV, IVA, or IVB:
- Am-L-Z-Ab is
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- the Am-L-Z-Ab precursor, Am-L-Z' is N-(2-aminoethyl)-2-aminoethyl
- the Am-L-Z-Ab precursor, Am-L-Z' is
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- Am-L-Z is represented by formula (IA)
- R1 is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H, Rc, or RD
- R4 is H, OH, ORc, ORD, RC, or RD
- R5 is H, OH, ORc, ORD, RC, or RD;
- R6 is H, OH, ORc, ORD, RC, or RD;
- R7 is H, OH, ORc, ORD, RC, or RD;
- Re is OH, NH2, ORc, ORD, NHRC, or N RCRD;
- R9 is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-;
- Rc is -L-Z
- RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2-C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C1-C6 alkyl
- heteroalkyl e.g., C1-C6 heteroalkyl
- optionally substituted alkenyl e.g., C2-C6 alkenyl
- optionally substituted alkylene e.g., C1-C6 alkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds an HC antigen (i.e., an anti-HC antibody, e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody); and
- an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- Am-L-Z is represented by formula (IB)
- R1 is H, OH, ORA, or ORc
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R3 is H, Rc, or RD
- R4 is H, OH, ORc, ORD, RC, or RD;
- R5 is H, OH, ORc, ORD, RC, or RD;
- R6 is H, OH, ORc, ORD, RC, or RD;
- R7 is H, OH, ORc, ORD, RC, or RD;
- RS is OH, NH2, ORc, ORD, NHRC, or N RCRD;
- Rg is H, OH, ORc, or ORD
- X is -S-, -S(O)-, or -SO2-;
- Rc is -L-Z
- RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2-C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2-C6 alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C1-C6 alkyl
- heteroalkyl e.g., C1-C6 heteroalkyl
- optionally substituted alkenyl e.g., C2-C6 alkenyl
- optionally substituted alkylene e.g., C1-C6 alkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds an HC antigen (i.e., an anti-HC antibody, e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody); and
- an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- RE and RE ⁇ are each independently optionally substituted C1-C6 alkylene-Rc, optionally substituted C1-C6 heteroalkylene-Rc, optionally substituted C2-C6 alkenylene-Rc, optionally substituted C2-C6 heteroalkenylene-Rc, optionally substituted C2-C6 alkynylene-Rc, optionally substituted C2-C6 heteroalkynylene-Rc, optionally substituted cycloalkylene-Rc, optionally substituted heterocycloalkylene-Rc, optionally substituted arylene-Rc, or optionally substituted heteroarylene-Rc.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R1 is H, OH, ORA, or ORc;
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form:
- Fh is H or Rc
- R4 is H, OH, ORc, ORD, RC, or RD;
- R5 is H, OH, ORc, ORD, RC, or RD;
- R6 is H, OH, ORc, ORD, RC, or RD;
- R7 is H, OH, ORc, ORD, RC, or RD;
- Re is OH, NH2, ORc, or NHRc
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Rc and RD are each as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R1 is H, OH, ORA, or ORc;
- R2 is H, OH, ORB, or ORc
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form:
- R3 is H or Rc
- R4 and R5 are each independently H, OH, ORc, Rc, or ORD;
- R6 and R7 are each H
- Re is OH, NH2, ORc, or NHRc
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Rc is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB),
- R1 is H, OH, or ORA
- R2 is H, OH, or ORB
- RA and RB when present, together with the oxygen atoms to which they are bound, combine to form:
- Am-L-Z is represented by formula (IA) or formula (IB),
- R1 and R ⁇ are each independently H or OH;
- R3 is Rc
- R4, R6, and R7 are each H;
- R5 is H, OH, or OC1-C6 alkyl
- R8 is OH or NH2
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Am-L-Z is represented by formula (IA) or formula (IB),
- R1 and R2 are each independently H or OH;
- R3, R6, and R7 are each H;
- R4 and R5 are each independently H, OH, ORc, or Rc;
- R8 is OH or NH2
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Am-L-Z is represented by formula (IA) or formula (IB),
- R1 and R2 are each independently H or OH;
- R3, R6, and R7 are each H;
- R4 and R5 are each independently H or OH
- Rs is OH, NH2, ORc, or NHRc
- R9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- amatoxins that may be used for conjugation to an antibody, or antigen-binding fragment thereof, in accordance with the compositions and methods described herein are described, for example, in WO 2016/142049; WO 2016/071856; WO 2017/149077; WO
- Am-L-Z is represented by formula (II), formula (IIA), or formula (MB)
- R1 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent Z' present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; and R2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent Z' present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; wherein when R1 is H, R2 is the linker, and when R2 is H, R1 is the linker.
- R1 is the linker and R2 is H, and the linker and chemical moiety, together as L-Z, is
- Am-L-Z-Ab is:
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- the Am-L-Z-Ab precursor (i.e., Am-L-Z’) is one of:
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- the cytotoxin is an a-amanitin.
- the a- amanitin is a compound of formula III.
- the a-amanitin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the a-amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an a-amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val- Cit.
- PAB para-aminobenzyl group
- the linker includes a -(CH2)n - unit, where n is an integer from 2-6.
- the cytotoxin is a b-amanitin.
- the a- amanitin is a compound of formula III.
- the b -amanitin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the b -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an b -amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val- Cit.
- PAB para-aminobenzyl group
- the cytotoxin is a g-amanitin.
- the g - amanitin is a compound of formula III.
- the g -amanitin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the g -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an g -amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val- Cit.
- PAB para-aminobenzyl group
- the cytotoxin is a e-amanitin.
- the e - amanitin is a compound of formula III.
- the e-amanitin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the e -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an e -amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val- Cit.
- PAB para-aminobenzyl group
- the cytotoxin is an amanin.
- the amanin. is a compound of formula III.
- the amanin of formula III is attached to an anti- HC antibody via a linker L.
- the linker L may be attached to the amanin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanin-linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 .
- the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB).
- PAB para-aminobenzyl group
- the cytotoxin is an amaninamide.
- the amaninamide is a compound of formula III.
- the amaninamide of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 .
- the linker is attached at position R 4 .
- the linker is attached at position R 5 .
- the linker is attached at position R 6 .
- the linker is attached at position R 7 .
- the linker is attached at position R 8 .
- the linker is attached at position R 9 .
- the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
- the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- the linker includes a para-aminobenzyl group (PAB).
- PAB para-aminobenzyl group
- the linker includes the moiety PAB-Cit-Val.
- the linker includes the moiety PAB-Ala-Val.
- the cytotoxin is an amanullin.
- the amanullin is a compound of formula III.
- the amanullin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the amanullin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 .
- the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val- Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB).
- PAB para-aminobenzyl group
- the cytotoxin is an amanullinic acid.
- the amanullinic acid is a compound of formula III.
- the amanullinic acid of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the amanullinic acid of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullinic acid -linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para- aminobenzyl group
- the cytotoxin is a proamanullin.
- the proamanullin is a compound of formula III.
- the proamanullin of formula III is attached to an anti-HC antibody via a linker L.
- the linker L may be attached to the proamanullin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an proamanullin -linker conjugate of formula I, IA, IB, II, IIA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val- Ala and Val-Cit.
- PAB para-aminobenzyl group
- Antibodies, or antigen-binding fragments, for use with the compositions and methods described herein can be conjugated to an amatoxin, such as a-amanitin or a variant thereof, using conjugation techniques known in the art or described herein.
- an anti-HC antibody e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- an amatoxin such as a-amanitin or a variant thereof, as described in US 201 5/0218220, the disclosure of which is incorporated herein by reference as it pertains, for example, to amatoxins, such as a-amanitin and variants thereof, as well as covalent linkers that can be used for covalent conjugation.
- Anti-HC antibodies e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti- CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- a cytotoxin that is an auristatin
- Auristatins are anti-mitotic agents that interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001 ) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No.
- the auristatin drug moiety may be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
- Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in Senter et al, Proceedings of the American Association for Cancer Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004, the disclosure of which is expressly incorporated by reference in its entirety.
- An exemplary auristatin embodiment is MMAE, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab or -L-Z', as described herein).
- MMAF Another exemplary auristatin embodiment is MMAF, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab or -L-Z', as described herein), as disclosed in US 2005/0238649:
- Auristatins may be prepared according to the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc. 1 1 1 :5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G. R., et al. Synthesis, 1996, 719-725; Pettit et al (1996) J. Chem. Soc. Perkin Trans. 15:859-863; and Doronina (2003) Nat. Biotechnol. 21 (7):778-784.
- Antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a microtubule binding agent.
- the microtubule binding agent is a maytansine, a maytansinoid or a maytansinoid analog.
- Maytansinoids are mitototic inhibitors which bind microtubules and act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,1 1 1 ). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat.
- Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
- Suitable maytansinoids include esters of maytansinol, synthetic maytansinol, and maytansinol analogs and derivatives. Included herein are any cytotoxins that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinoids, maytansinol, and maytansinol analogs, and derivatives.
- Suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions. Such suitable maytansinoids are disclosed in U.S.
- the antibody-drug conjugates (ADCs) of the present disclosure utilize the thiol-containing maytansinoid (DM1 ), formally termed N 2 '-deacetyl-N 2 '-(3-mercapto-1 -oxopropyl)- maytansine, as the cytotoxic agent.
- DM1 is represented by the following structural formula V:
- conjugates of the present disclosure utilize the thiol-containing maytansinoid N 2, -deacetyl-N 2 '(4-methyl-4-mercapto-1 -oxopentyl)-maytansine (e.g., DM4) as the cytotoxic agent.
- DM4 is represented by the following structural formula VI :
- N 2 -deacetyl-N- 2 '(4-mercapto-1 -oxopentyl)-maytansine (termed DM3), represented by the following structural formula VII :
- positions on maytansinoids can serve as the position to covalently bond the linking moiety and, hence the antibodies or antigen-binding fragments thereof (-L-Z-Ab or -L-Z', as described herein).
- the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with hydroxy and the C-20 position having a hydroxy group are all expected to be useful.
- the C-3 position serves as the position to covalently bond the linker moiety
- the C-3 position of maytansinol serves as the position to covalently bond the linking moiety.
- linking groups known in the art for making antibody-maytansinoid conjugates, including, for example, those disclosed in U.S. Pat. Nos. 5,208,020, 6,441 ,163, and EP Patent No. 0425235 B1 ; Chari et al., Cancer Research 52:127-131 (1992); and U.S. 2005/0169933 A1 , the disclosures of which are hereby expressly incorporated by reference. Additional linking groups are described and exemplified herein.
- the present disclosure also includes various isomers and mixtures of maytansinoids and conjugates. Certain compounds and conjugates of the present disclosure may exist in various stereoisomeric, enantiomeric, and diastereomeric forms. Several descriptions for producing such antibody-maytansinoid conjugates are provided in U.S. Pat. Nos. 5,208,020; 5,41 6,064; 6,333,410; 6,441 ,163; 6,716,821 ; and 7,368,565, each of which is incorporated herein in its entirety.
- the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an anthracycline molecule.
- Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. Studies have indicated that anthracyclines may operate to kill cells by a number of different mechanisms including: 1 ) intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; 2) production by the drug of free radicals which then react with cellular macromolecules to cause damage to the cells or 3) interactions of the drug molecules with the cell membrane [see, e.g., C.
- anthracyclines have been used in the treatment of numerous cancers such as leukemia, breast carcinoma, lung carcinoma, ovarian adenocarcinoma and sarcomas [see e.g., P.H- Wiernik, in Anthracvcline: Current Status And New Developments p 1 1 ].
- Commonly used anthracyclines include doxorubicin, epirubicin, idarubicin and daunomycin.
- doxorubicin The anthracycline analog, doxorubicin (ADRIAMYCINO) is thought to interact with DNA by intercalation and inhibition of the progression of the enzyme topoisomerase II, which unwinds DNA for transcription.
- Doxorubicin stabilizes the topoisomerase II complex after it has broken the DNA chain for replication, preventing the DNA double helix from being resealed and thereby stopping the process of replication.
- Doxorubicin and daunorubicin (DAUNOMYCIN) are prototype cytotoxic natural product anthracycline chemotherapeutics (Sessa et al., (2007) Cardiovasc. Toxicol. 7:75-79).
- anthracyclines include doxorubicin, epirubicin, idarubicin and
- the cytotoxin is an anthracycline selected from the group consisting of daunorubicin, doxorubicin, epirubicin, and idarubicin
- anthracyclines include, but are not limited to daunorubicin (Cerubidine; Bedford Laboratories), doxorubicin (Adriamycin; Bedford Laboratories; also referred to as doxorubicin hydrochloride, hydroxy-daunorubicin, and Rubex), epirubicin (Ellence; Pfizer), and idarubicin (Idamycin; Pfizer Inc.)
- the anthracycline analog, doxorubicin ADRIAMYCINO
- ADRIAMYCINO is thought to interact with DNA by intercalation and inhibition of the progression of the enzyme topoisomerase II, which unwinds DNA for transcription.
- Doxorubicin stabilizes the topoisomerase II complex after it has broken the DNA chain for replication, preventing the DNA double helix from being resealed and thereby stopping the process of replication.
- Doxorubicin and daunorubicin are prototype cytotoxic natural product anthracycline chemotherapeutics (Sessa et al., (2007)
- PNU-159682 PNU-159682
- PNU exhibits greater than 3000-fold cytotoxicity relative to the parent nemorubicin (Quintieri et al., Clinical Cancer Research 2005, 1 1 , 1608-1617).
- PNU is represented by the structural formula:
- linkers may be introduced through modifications to the hydroxymethyl ketone side chain.
- the cytotoxin is a PNU derivative represented by the structural formula:
- the cytotoxin is a PNU derivative represented by the structural formula:
- PBDs Pyrrolobenzodiazepines
- the anti-HC antibodies e.g., anti-CD1 17 antibody, anti-CD45 antibody, anti-CD2 antibody, anti-CD5 antibody, anti-CD137 antibody, or anti-CD252 antibody
- antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a pyrrolobenzodiazepine (PBD) or a cytotoxin that comprises a PBD.
- PBDs are natural products produced by certain actinomycetes and have been shown to be sequence selective DNA alkylating compounds.
- PBD cytotoxins include, but are not limited to, anthramycin, dimeric PBDs, and those disclosed in, for example, Hartley, JA (201 1 ) The development of pyrrolobenzodiazepines as antitumour agents. Expert Opin Inv Drug, 20(6), 733-744 and Antonow D, Thurston DE (201 1 ) Synthesis of DNA-interactive pyrrolo[2,1 -c][1 ,4]benzodiazepines (PBDs). Chem Rev 1 1 1 : 2815- 2864.
- the cytotoxin is a pyrrolobenzodiazepine dimer represented by the structural formula:
- the cytotoxin is conjugated to the antibody, or the antigen-binding fragment thereof, by way of a maleimidocaproyl linker.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2021518969A JP7709376B2 (ja) | 2018-10-23 | 2019-10-23 | Fcサイレンス化抗体薬物コンジュゲート(ADC)及びその使用 |
| SG11202103568PA SG11202103568PA (en) | 2018-10-23 | 2019-10-23 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| CA3115680A CA3115680A1 (en) | 2018-10-23 | 2019-10-23 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| KR1020217015206A KR20210081393A (ko) | 2018-10-23 | 2019-10-23 | Fc 침묵 항체 약물 컨쥬게이트(ADC) 및 이의 용도 |
| BR112021007555-0A BR112021007555A2 (pt) | 2018-10-23 | 2019-10-23 | conjugados anticorpo-fármaco (adcs) silenciados em fc e usos dos mesmos |
| AU2019366960A AU2019366960A1 (en) | 2018-10-23 | 2019-10-23 | Fc silenced antibody drug conjugates (ADCs) and uses thereof |
| MX2021004231A MX2021004231A (es) | 2018-10-23 | 2019-10-23 | Conjugados de anticuerpos y fármacos (caf) con silenciamiento de fc y usos de los mismos. |
| EP19875208.1A EP3873930A4 (en) | 2018-10-23 | 2019-10-23 | FC-ALIMINATED ANTIBODY DRUG CONJUGATES (ADCS) AND THEIR USES |
| EA202190710A EA202190710A1 (ru) | 2019-02-19 | 2019-10-23 | Fc ВЫКЛЮЧЕННЫЕ КОНЪЮГАТЫ АНТИТЕЛО-ЛЕКАРСТВЕННОЕ СРЕДСТВО (ADC) И ИХ ПРИМЕНЕНИЕ |
| CN201980081477.8A CN113330026A (zh) | 2018-10-23 | 2019-10-23 | Fc沉默的抗体药物缀合物(ADC)及其用途 |
| US16/858,481 US20200376135A1 (en) | 2018-10-23 | 2020-04-24 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| US16/863,948 US20200255523A1 (en) | 2018-10-23 | 2020-04-30 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| IL282292A IL282292A (en) | 2018-10-23 | 2021-04-13 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| CONC2021/0006259A CO2021006259A2 (es) | 2018-10-23 | 2021-05-13 | Conjugados de anticuerpos y fármacos (caf) con silenciamiento de fc y usos de los mismos |
| US18/156,305 US20240075157A1 (en) | 2018-10-23 | 2023-01-18 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| JP2025113503A JP2025160215A (ja) | 2018-10-23 | 2025-07-04 | Fcサイレンス化抗体薬物コンジュゲート(ADC)及びその使用 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862749662P | 2018-10-23 | 2018-10-23 | |
| US62/749,662 | 2018-10-23 | ||
| US201862773839P | 2018-11-30 | 2018-11-30 | |
| US62/773,839 | 2018-11-30 | ||
| US201962807363P | 2019-02-19 | 2019-02-19 | |
| US62/807,363 | 2019-02-19 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/858,481 Continuation-In-Part US20200376135A1 (en) | 2018-10-23 | 2020-04-24 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| US16/863,948 Continuation US20200255523A1 (en) | 2018-10-23 | 2020-04-30 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020086776A1 true WO2020086776A1 (en) | 2020-04-30 |
Family
ID=70331253
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/057741 Ceased WO2020086776A1 (en) | 2018-10-23 | 2019-10-23 | Fc silenced antibody drug conjugates (adcs) and uses thereof |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20200255523A1 (enExample) |
| EP (1) | EP3873930A4 (enExample) |
| JP (2) | JP7709376B2 (enExample) |
| KR (1) | KR20210081393A (enExample) |
| CN (1) | CN113330026A (enExample) |
| AU (1) | AU2019366960A1 (enExample) |
| BR (1) | BR112021007555A2 (enExample) |
| CA (1) | CA3115680A1 (enExample) |
| CO (1) | CO2021006259A2 (enExample) |
| IL (1) | IL282292A (enExample) |
| MX (1) | MX2021004231A (enExample) |
| SG (1) | SG11202103568PA (enExample) |
| WO (1) | WO2020086776A1 (enExample) |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020219774A1 (en) * | 2019-04-24 | 2020-10-29 | Magenta Therapeutics, Inc. | Anthracycline antibody-drug conjugates and uses thereof |
| WO2021250059A1 (en) | 2020-06-09 | 2021-12-16 | Heidelberg Pharma Research Gmbh | Method for synthesis of thioether-containing peptides |
| WO2021255217A1 (en) | 2020-06-19 | 2021-12-23 | Heidelberg Pharma Research Gmbh | Amatoxin and amatoxin conjugates for use in inhibition of rna virus replication |
| EP3958878A4 (en) * | 2019-04-24 | 2022-12-28 | Magenta Therapeutics, Inc. | CONDITIONING METHODS FOR GENE THERAPY |
| KR20230012072A (ko) * | 2020-07-07 | 2023-01-25 | 칸큐어 엘엘씨 | Mic 항체 및 결합제 및 이의 사용 방법 |
| EP3958899A4 (en) * | 2019-04-24 | 2023-08-02 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| WO2024048490A1 (ja) | 2022-08-29 | 2024-03-07 | 第一三共株式会社 | 変異Fc領域を含む抗体薬物コンジュゲート |
| EP4121462A4 (en) * | 2020-03-16 | 2024-04-24 | Magenta Therapeutics, Inc. | BISPECIFIC T CELL BINDING PROTEINS |
| WO2024121632A1 (en) * | 2022-12-09 | 2024-06-13 | Crispr Therapeutics Ag | Use of anti-cd117 antibody drug conjugate (adc) |
| US12037380B2 (en) | 2020-05-21 | 2024-07-16 | Mabsol Ve Limited | Modified immunoglobulin Fc regions |
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| WO2024258967A1 (en) * | 2023-06-13 | 2024-12-19 | Synthis Therapeutics, Inc. | Anti-cd5 antibodies and their uses |
| US12291576B2 (en) | 2018-10-30 | 2025-05-06 | Vor Biopharma Inc. | Anti-CD45 antibodies and conjugates thereof |
| WO2025099280A1 (en) * | 2023-11-08 | 2025-05-15 | Oxion Biologics Ab | Improved anti-ox40l antibodies |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200376135A1 (en) * | 2018-10-23 | 2020-12-03 | Magenta Therapeutics, Inc. | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| IL292628A (en) | 2019-11-01 | 2022-07-01 | Magenta Therapeutics Inc | Anti-cd45 antibody and conjugates accordingly |
| KR20250065477A (ko) * | 2023-11-03 | 2025-05-13 | 고려대학교 산학협력단 | 작용기 기능이 제거된 Fab-arm 교환 방지 Fc 변이체들 |
| WO2026014615A1 (ko) * | 2024-07-10 | 2026-01-15 | 고려대학교 산학협력단 | 작용기 기능이 제거된 신규 당화 fc 변이체 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014108483A1 (en) * | 2013-01-10 | 2014-07-17 | Genmab B.V. | Inert format |
| US20160367697A1 (en) * | 2006-12-01 | 2016-12-22 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2017157948A1 (en) * | 2016-03-14 | 2017-09-21 | Innate Pharma | Anti-cd39 antibodies |
| US20180043033A1 (en) * | 2015-03-09 | 2018-02-15 | Heidelberg Pharma Gmbh | Amatoxin-antibody conjugates |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1996040875A1 (en) * | 1995-06-07 | 1996-12-19 | Novartis Ag | Methods for obtaining compositions enriched for hematopoietic stem cells and antibodies for use therein |
| US7435596B2 (en) * | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
| EP2625203A1 (en) * | 2010-10-05 | 2013-08-14 | Novartis AG | Anti-il12rbeta1 antibodies and their use in treating autoimmune and inflammatory disorders |
| PT3434767T (pt) * | 2010-11-30 | 2026-01-23 | Chugai Pharmaceutical Co Ltd | Agente terapêutico indutor de citotoxicidade |
| CN103649125A (zh) * | 2011-06-22 | 2014-03-19 | 霍夫曼-拉罗奇有限公司 | 利用包含mhc i类的复合物通过循环中的病毒特异性细胞毒性t细胞清除靶细胞 |
| AU2013289883B2 (en) | 2012-07-13 | 2018-11-01 | Zymeworks Bc Inc. | Bispecific asymmetric heterodimers comprising anti-CD3 constructs |
| PL2880170T3 (pl) * | 2012-08-02 | 2017-02-28 | F.Hoffmann-La Roche Ag | SPOSÓB WYTWARZANIA ROZPUSZCZALNEGO FcR JAKO FUZJI Fc Z OBOJĘTNYM REGIONEM Fc IMMUNOGLOBULINY I JEGO ZASTOSOWANIA |
| KR102332303B1 (ko) * | 2013-05-31 | 2021-11-26 | 자임워크스 인코포레이티드 | 감소되거나 침묵화된 효과기 기능을 갖는 이종다량체 |
| JP6668345B2 (ja) * | 2014-11-21 | 2020-03-18 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 修飾された重鎖定常領域を含む抗体 |
| US20190330335A1 (en) * | 2015-10-06 | 2019-10-31 | Alector Llc | Anti-trem2 antibodies and methods of use thereof |
| MA43389A (fr) * | 2015-12-02 | 2021-05-12 | Agenus Inc | Anticorps anti-ox40 et leurs procédés d'utilisation |
| WO2017106684A2 (en) | 2015-12-17 | 2017-06-22 | Janssen Biotech, Inc. | Antibodies specifically binding hla-dr and their uses |
| KR102692708B1 (ko) * | 2016-12-20 | 2024-08-07 | 에프. 호프만-라 로슈 아게 | 항-cd20/항-cd3 이중특이성 항체 및 4-1bb(cd137) 작용물질의 병용 요법 |
| KR20240093751A (ko) | 2016-12-21 | 2024-06-24 | 노파르티스 아게 | 조혈줄기세포를 제거하기 위한 항체 약물 접합체 |
| RU2755728C2 (ru) | 2016-12-23 | 2021-09-20 | Хайдельберг Фарма Ресёрч Гмбх | Новый конъюгат аманитина |
| CN111095521B (zh) * | 2017-10-24 | 2023-03-28 | 日本碍子株式会社 | 晶片载置台及其制法 |
| WO2019084057A2 (en) * | 2017-10-24 | 2019-05-02 | Magenta Therapeutics, Inc. | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS |
| NZ781538A (en) * | 2019-04-24 | 2025-12-19 | Heidelberg Pharma Res Gmbh | Amatoxin antibody-drug conjugates and uses thereof |
| EP3958909A4 (en) * | 2019-04-24 | 2024-01-10 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY DRUG CONJUGATES AND USES THEREOF |
| EP3959242A4 (en) * | 2019-04-24 | 2023-09-13 | Magenta Therapeutics, Inc. | ANTRACYCLINE ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| JP2022531141A (ja) * | 2019-04-24 | 2022-07-06 | マジェンタ セラピューティクス インコーポレイテッド | 遺伝子治療のコンディショニング方法 |
| JP2022530443A (ja) * | 2019-04-24 | 2022-06-29 | マジェンタ セラピューティクス インコーポレイテッド | 抗cd117抗体薬物複合体およびその使用 |
| CN118131538A (zh) * | 2022-12-02 | 2024-06-04 | 群创光电股份有限公司 | 电子装置 |
-
2019
- 2019-10-23 AU AU2019366960A patent/AU2019366960A1/en active Pending
- 2019-10-23 CN CN201980081477.8A patent/CN113330026A/zh active Pending
- 2019-10-23 BR BR112021007555-0A patent/BR112021007555A2/pt not_active IP Right Cessation
- 2019-10-23 SG SG11202103568PA patent/SG11202103568PA/en unknown
- 2019-10-23 KR KR1020217015206A patent/KR20210081393A/ko active Pending
- 2019-10-23 EP EP19875208.1A patent/EP3873930A4/en active Pending
- 2019-10-23 JP JP2021518969A patent/JP7709376B2/ja active Active
- 2019-10-23 WO PCT/US2019/057741 patent/WO2020086776A1/en not_active Ceased
- 2019-10-23 CA CA3115680A patent/CA3115680A1/en active Pending
- 2019-10-23 MX MX2021004231A patent/MX2021004231A/es unknown
-
2020
- 2020-04-30 US US16/863,948 patent/US20200255523A1/en active Pending
-
2021
- 2021-04-13 IL IL282292A patent/IL282292A/en unknown
- 2021-05-13 CO CONC2021/0006259A patent/CO2021006259A2/es unknown
-
2025
- 2025-07-04 JP JP2025113503A patent/JP2025160215A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160367697A1 (en) * | 2006-12-01 | 2016-12-22 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2014108483A1 (en) * | 2013-01-10 | 2014-07-17 | Genmab B.V. | Inert format |
| US20180043033A1 (en) * | 2015-03-09 | 2018-02-15 | Heidelberg Pharma Gmbh | Amatoxin-antibody conjugates |
| WO2017157948A1 (en) * | 2016-03-14 | 2017-09-21 | Innate Pharma | Anti-cd39 antibodies |
Non-Patent Citations (2)
| Title |
|---|
| LO, M ET AL.: "Effector Attenuating Substitutions that Maintain Antibody Stability and Reduce Toxicity in Mice", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 292, no. 9, 11 January 2017 (2017-01-11), pages 3900 - 3908, XP055558867, ISSN: 0021-9258 * |
| See also references of EP3873930A4 * |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US12291576B2 (en) | 2018-10-30 | 2025-05-06 | Vor Biopharma Inc. | Anti-CD45 antibodies and conjugates thereof |
| EP3958878A4 (en) * | 2019-04-24 | 2022-12-28 | Magenta Therapeutics, Inc. | CONDITIONING METHODS FOR GENE THERAPY |
| WO2020219774A1 (en) * | 2019-04-24 | 2020-10-29 | Magenta Therapeutics, Inc. | Anthracycline antibody-drug conjugates and uses thereof |
| EP3958899A4 (en) * | 2019-04-24 | 2023-08-02 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| EP3959242A4 (en) * | 2019-04-24 | 2023-09-13 | Magenta Therapeutics, Inc. | ANTRACYCLINE ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| EP4121462A4 (en) * | 2020-03-16 | 2024-04-24 | Magenta Therapeutics, Inc. | BISPECIFIC T CELL BINDING PROTEINS |
| US12037380B2 (en) | 2020-05-21 | 2024-07-16 | Mabsol Ve Limited | Modified immunoglobulin Fc regions |
| US12497442B2 (en) | 2020-05-21 | 2025-12-16 | Mabsolve Limited | Nucleic acids encoding modified immunoglobulin Fc regions |
| WO2021250059A1 (en) | 2020-06-09 | 2021-12-16 | Heidelberg Pharma Research Gmbh | Method for synthesis of thioether-containing peptides |
| WO2021255217A1 (en) | 2020-06-19 | 2021-12-23 | Heidelberg Pharma Research Gmbh | Amatoxin and amatoxin conjugates for use in inhibition of rna virus replication |
| KR20230012072A (ko) * | 2020-07-07 | 2023-01-25 | 칸큐어 엘엘씨 | Mic 항체 및 결합제 및 이의 사용 방법 |
| US12139539B2 (en) | 2020-07-07 | 2024-11-12 | Cancure, Llc | MIC antibodies and binding agents and methods of using the same |
| KR102594083B1 (ko) * | 2020-07-07 | 2023-10-25 | 칸큐어 엘엘씨 | Mic 항체 및 결합제 및 이의 사용 방법 |
| KR20250054799A (ko) | 2022-08-29 | 2025-04-23 | 다이이찌 산쿄 가부시키가이샤 | 변이 Fc 영역을 포함하는 항체 약물 콘쥬게이트 |
| WO2024048490A1 (ja) | 2022-08-29 | 2024-03-07 | 第一三共株式会社 | 変異Fc領域を含む抗体薬物コンジュゲート |
| WO2024121632A1 (en) * | 2022-12-09 | 2024-06-13 | Crispr Therapeutics Ag | Use of anti-cd117 antibody drug conjugate (adc) |
| WO2024258967A1 (en) * | 2023-06-13 | 2024-12-19 | Synthis Therapeutics, Inc. | Anti-cd5 antibodies and their uses |
| WO2025099280A1 (en) * | 2023-11-08 | 2025-05-15 | Oxion Biologics Ab | Improved anti-ox40l antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2019366960A1 (en) | 2021-05-27 |
| US20200255523A1 (en) | 2020-08-13 |
| EP3873930A4 (en) | 2022-12-07 |
| CO2021006259A2 (es) | 2021-09-09 |
| KR20210081393A (ko) | 2021-07-01 |
| MX2021004231A (es) | 2021-06-15 |
| IL282292A (en) | 2021-05-31 |
| JP7709376B2 (ja) | 2025-07-16 |
| CN113330026A (zh) | 2021-08-31 |
| JP2022512629A (ja) | 2022-02-07 |
| JP2025160215A (ja) | 2025-10-22 |
| SG11202103568PA (en) | 2021-05-28 |
| EP3873930A1 (en) | 2021-09-08 |
| CA3115680A1 (en) | 2020-04-30 |
| BR112021007555A2 (pt) | 2021-08-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7709376B2 (ja) | Fcサイレンス化抗体薬物コンジュゲート(ADC)及びその使用 | |
| US12291576B2 (en) | Anti-CD45 antibodies and conjugates thereof | |
| US11572411B2 (en) | Anti-CD117 antibodies and conjugates | |
| US20210379195A1 (en) | Methods for allogeneic hematopoietic stem cell transplantation | |
| US12209135B2 (en) | Anti-CD45 antibodies and conjugates thereof | |
| US20240075157A1 (en) | Fc silenced antibody drug conjugates (adcs) and uses thereof | |
| US20260069706A1 (en) | Methods for treating autoimmune diseases | |
| IL295653A (en) | Compositions and methods for allogeneic transplantation | |
| AU2020286508A1 (en) | T-cell depleting therapies | |
| WO2019173780A2 (en) | Anti-cd252 antibodies, conjugates, and methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19875208 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021518969 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3115680 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021007555 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2021/0006259 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 20217015206 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019366960 Country of ref document: AU Date of ref document: 20191023 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019875208 Country of ref document: EP Effective date: 20210525 |
|
| ENP | Entry into the national phase |
Ref document number: 112021007555 Country of ref document: BR Kind code of ref document: A2 Effective date: 20210420 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2021/0006259 Country of ref document: CO |