WO2020084307A1 - Methods and compositions - Google Patents

Methods and compositions Download PDF

Info

Publication number
WO2020084307A1
WO2020084307A1 PCT/GB2019/053023 GB2019053023W WO2020084307A1 WO 2020084307 A1 WO2020084307 A1 WO 2020084307A1 GB 2019053023 W GB2019053023 W GB 2019053023W WO 2020084307 A1 WO2020084307 A1 WO 2020084307A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
unnatural amino
dap
polypeptide
alkyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2019/053023
Other languages
English (en)
French (fr)
Inventor
Jason Chin
Nicolas HUGUENIN-DEZOT
Mohan MAHESH
Shan Tang
Duy P Nguyen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
United Kingdom Research and Innovation
Original Assignee
United Kingdom Research and Innovation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202510576255.0A priority Critical patent/CN120607506A/zh
Priority to US17/288,798 priority patent/US12286657B2/en
Priority to JP2021521504A priority patent/JP7633156B2/ja
Priority to AU2019369192A priority patent/AU2019369192B2/en
Priority to EP19806312.5A priority patent/EP3870224A1/en
Priority to CA3116567A priority patent/CA3116567A1/en
Application filed by United Kingdom Research and Innovation filed Critical United Kingdom Research and Innovation
Priority to CN201980086289.4A priority patent/CN113226375B/zh
Publication of WO2020084307A1 publication Critical patent/WO2020084307A1/en
Anticipated expiration legal-status Critical
Priority to JP2024186312A priority patent/JP2025023942A/ja
Priority to US19/086,998 priority patent/US20250283066A1/en
Priority to AU2025205622A priority patent/AU2025205622A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D317/00Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms
    • C07D317/08Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3
    • C07D317/44Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems
    • C07D317/46Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems condensed with one six-membered ring
    • C07D317/48Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring
    • C07D317/62Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to atoms of the carbocyclic ring
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K11/00Depsipeptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K11/02Depsipeptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof cyclic, e.g. valinomycins ; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/104Aminoacyltransferases (2.3.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/503Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses
    • C12N9/506Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses derived from RNA viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93Ligases (6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/34Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
    • C12Q1/37Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22Cysteine endopeptidases (3.4.22)
    • C12Y304/22069SARS coronavirus main proteinase (3.4.22.69)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y601/00Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01026Pyrrolysine-tRNAPyl ligase (6.1.1.26)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/60Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to genetic incorporation of 2,3-diamino propionic acid (DAP) into polypeptides, to unnatural amino acids comprising DAP, to a tRNA synthetase for charging tRNA with unnatural amino acids comprising DAP, and to methods of using the resulting polypeptides, for example in capturing substrates and/or intermediates in enzymatic reactions.
  • DAP 2,3-diamino propionic acid
  • substrate analogues bearing electrophilic replacements for the carbonyl group, can be used to capture analogues of acyl-enzyme
  • a polypeptide comprising 2,3-diamino propionic acid (DAP) has been disclosed in the prior art. Specifically, one or more polypeptides bearing DAP have been produced by solid phase synthesis/conjugation techniques in the prior art (see Virdee, S.,
  • a key technical advance provided by the invention is a new way to produce
  • polypeptides comprising 2,3-diamino propionic acid (DAP). This is especially useful in incorporating the DAP into locations which are difficult or impossible to modify in the prior art, such as incorporation into enzyme active site(s).
  • DAP 2,3-diamino propionic acid
  • incorporation into polypeptide via naturally occurring translational machineiy e.g. the cell’s own ribosomes.
  • the methods also involve a new tRNA synthetase capable of charging an orthogonal tRNA with the new unnatural amino acid(s).
  • the new unnatural amino acid(s) Once the new unnatural amino acid(s) are incorporated into polypeptide they can be easily deprotected to leave DAP in the polypeptide backbone.
  • the invention enables incorporation of DAP into a range of proteins, and/or into a range of locations within proteins, which are currently not possible using prior art techniques.
  • the invention provides an unnatural amino acid of formula (I) or (II):
  • R is H, an amino acid residue or a peptide
  • R 2 is H, C - 6 alkyl, C - 6 haloalkyl or C 5-20 aryl
  • q 1, 2 or 3;
  • each R 3 or R 4 is independently selected from H, halo, C - 6 alkyl, C - 6 haloalkyl, C 5-20 aryl, C 3-20 heteroaryl, OC 1-6 alkyl, SC 1-6 alkyl, NH(C I-6 alkyl) and N(C I-6 alkyl) 2 ;
  • X is X -Y, S-S-Rg, Se-Se-R 5 , 0-NH-R 5 , S-NH-R 5 , Se-NH-R 5 , X 2 -Y , X 3 -Y 2 , N 3 or NH-
  • X is S, Se, O, NH or N(C I-6 alkyl);
  • X 2 is S, Se or O
  • X 3 is NH-C(0)-0;
  • X 4 is NH-C(0)-0, O, S or NH;
  • R 5 is selected from H, halo, C - 6 alkyl, C - 6 haloalkyl, C 5-20 aryl, C 3-20 heteroaryl, OC 1-6 alkyl, NH(C I-6 alkyl), N(C I-6 alkyl) 2 , peptides, sugars, C 3-20 heterocyclyl and nucleic acids;
  • Y is a protecting group selected from:
  • Re is selected from H, C -6 alkyl, C -6 haloalkyl, C0 2 H, C0 2 R’, S0 2 H, S0 2 R’, C 5-20 aryl, C 3- 20 heteroaryl, NHC(0)R’ and NHR’;
  • R 7 and Rg are independently selected from H, OH, 0(C - 6 alkyl), 0(C 5-20 aryl) and 0(C 3- heteroaryl); or R 7 and Rg are linked together to form an 0-CH 2 -0 group;
  • each R’ is independently selected from C -6 alkyl, C -6 haloalkyl and C 5-20 aryl;
  • R g is selected from H, C -6 alkyl, C -6 haloalkyl, C0 2 H, C0 2 R’, S0 2 H, S0 2 R’ and C 5-20 aryl;
  • R o is selected from H, C -6 alkyl and C -6 haloalkyl;
  • R is selected from H, C -6 alkyl and C -6 haloalkyl
  • X 5 is S, O, NH, N-C(0)-0-R’, N-S(0) 2 H, N-S(0) 2 R’ or NR’;
  • Y is a protecting group selected from
  • Y 2 is a protecting group selected from
  • R 12 is C - 6 alkyl or C(0)-(C 5-20 aryl);
  • R I3 is H, C - 6 alkyl, allyl or C 5-20 aryl;
  • Y 3 is a protecting group
  • the invention provides a polypeptide comprising an unnatural amino acid as described above wherein said unnatural amino acid is attached to said polypeptide via a peptide bond.
  • the invention relates to a method of preparing a polypeptide comprising DAP, the method comprising deprotecting a polypeptide as described above.
  • said deprotecting comprises illumination at 365 nm, 35 mWcnr 2 , for 1 minute.
  • the invention relates to a PylRS tRNA synthetase comprising the mutations Y271C, N311Q, Y349F and V366C.
  • said PylRS tRNA synthetase is a Methanosarcina barkerii PylRS (Mb PylRS) tRNA synthetase comprising said mutations.
  • the invention relates to a method of producing a polypeptide comprising 2,3-diamino propionic acid (DAP), said method comprising genetically incorporating an unnatural amino acid as described above into a polypeptide, and optionally deprotecting said unnatural amino acid to 2,3-diamino propionic acid (DAP).
  • DAP 2,3-diamino propionic acid
  • nucleic acid encoding the polypeptide which nucleic acid comprises an orthogonal codon encoding the unnatural amino acid according to any of claims 1 to 10;
  • said orthogonal codon comprises an amber codon (TAG)
  • said tRNA comprises MbtRNAcu A
  • said tRNA synthetase comprises a Mb PylRS synthetase having the mutations Y271C, N311Q, Y349F and V366C.
  • said unnatural amino acid comprises
  • the invention relates to a polypeptide as described above, or a method as described above, wherein said polypeptide is an enzyme, and wherein said unnatural amino acid is incorporated at a position corresponding to an amino acid residue within the active site of said enzyme.
  • the invention relates to a polypeptide as described above wherein said polypeptide is an enzyme, and wherein said enzyme is an EC 3.4 peptidase, an EC 3.4.22.44 peptidase, or an EC 2.3.2.23 E2 ubiquitin-conjugating enzyme, according to the International Nomenclature and Classification of Enzymes.
  • the invention relates to a polypeptide as described above which comprises one to twenty 2,3-diamino propionic acid (DAP) groups.
  • said polypeptide comprises a single 2,3-diamino propionic acid (DAP) group.
  • the invention relates to a polypeptide as described above, or a method as described above, wherein said unnatural amino acid is incorporated at a position corresponding to a cysteine, serine or threonine residue in the wild type polypeptide, optionally at a position corresponding to a cysteine or serine residue in the wild type polypeptide.
  • the invention relates to use of an unnatural amino acid as described above in the production of a polypeptide comprising 2,3-diamino propionic acid (DAP).
  • DAP 2,3-diamino propionic acid
  • production of the polypeptide comprises performing a method as described above.
  • the invention relates to a method of capturing a substrate for an enzyme, the method comprising
  • said enzyme b) contacting said enzyme with candidate substrate(s) for said enzyme, and c) incubating to allow reaction of said DAP group with said candidate substrate(s).
  • said substrate is a metabolite.
  • said enzyme is a peptidase or a ubiquitin-conjugating enzyme or a hydrolase or an enzyme forming carbon-sulphur bonds.
  • the invention enables a strategy for genetically directing the efficient incorporation of 2,3-diaminopropionic acid (DAP) into recombinant proteins produced in (for example) E. coli.
  • DAP 2,3-diaminopropionic acid
  • the invention is demonstrated for example by elucidating the biosynthetic pathway by which the thioesterase domain of valinomycin synthetase (Vlm TE) facilitates both the sequential trimerisation of linear tetradepsipeptides to a dodecadepsipeptide and the subsequent cyclization of the dodecadepsipeptide to valinomycin.
  • Vlm TE valinomycin synthetase
  • DAP conjugates By trapping the first and last acyl-TE intermediates in the catalytic cycle of Vlm TE as DAP conjugates, using the invention provides structural insight into how conformational changes in the TE domains of NRPSs control the switch from oligomerisation to cyclisation of linear substrates.
  • Strategies such as this enabled by the invention find application in facilitating the characterisation of diverse acyl-enzyme intermediates.
  • the invention finds application in enabling capture and identification of the native substrates for enzymes of unknown function.
  • the invention relates to a homogenous recombinant polypeptide as described above.
  • said polypeptide is made by a method as described above.
  • the invention relates to a polypeptide produced according to the method(s) described herein. As well as being the product of those new methods, such a polypeptide has the technical feature of comprising an unnatural amino acid as described above, or comprising DAP.
  • Mutating has it normal meaning in the art and may refer to the substitution or truncation or deletion of the residue, motif or domain referred to. Mutation may be effected at the polypeptide level e.g. by synthesis of a polypeptide having the mutated sequence, or maybe effected at the nucleotide level e.g. by making a nucleic acid encoding the mutated sequence, which nucleic acid may be subsequently translated to produce the mutated polypeptide. Where no amino acid is specified as the replacement amino acid for a given mutation site, suitably a randomisation of said site is used. As a default mutation, alanine (A) may be used. Suitably the mutations used at particular site(s) are as set out herein.
  • a fragment is suitably at least 10 amino acids in length, suitably at least 25 amino acids, suitably at least 50 amino acids, suitably at least 100 amino acids, suitably at least 200 amino acids, suitably at least 250 amino acids, suitably at least 300 amino acids, suitably at least 313 amino acids, or suitably the majority of the polypeptide of interest.
  • the methods of the invention may be practiced in vivo or in vitro.
  • the methods of the invention are not applied to the human or animal body.
  • the methods of the invention are in vitro methods.
  • the methods do not require the presence of the human or animal body.
  • the methods are not methods of diagnosis or of surgery or of therapy of the human or animal body.
  • NRPSs nonribosomal peptide synthetases
  • PKSs polyketide synthases
  • TE thioesterase domains from NRPS pathways that oligomerise and cyclise linear peptidyl or depsipeptidyl substrates.
  • These TE domains are involved in biosynthesis of the antibiotic gramicidin S l8 , the emetic toxin cereulide 19 20 , the siderophores enterobactin and bacillibactin 21 22 , the anticancer conglobatin the DNA bis-intercalator thiocoraline 24 and valinomycin, a potassium ionophore depsipeptide with antimicrobial, antitumoral and cytotoxic properties 20 ’ 25 .
  • acyl-TE intermediates would provide mechanistic insight into how TEs control substrate fate and represent a substantial advance. A handful of high-resolution acyl-TE structures have been obtained, most notably with the polyketide pikromycin-forming T ⁇ and non-native substrate analogues 26 .
  • acyl-TE intermediates as provided by the invention is a significant benefit enabling the skilled worker to characterize the mechanism of TE domain selectivity in nonribosomal peptide biosynthesis as well as in polyketide and fatty acid biosynthesis.
  • Valinomycin synthetase (Vlm), a 2-protein, 4-module NRPS, is proposed to alternatively link hydroxy acids (from in situ reduction of alpha-keto acids) and amino acids into a tetradepsipeptide intermediate, which the TE domain (Vlm TE) progressively trimerizes to a dodecadepsipeptide and then cyclizes to yield valinomycin 27 25 ( Figure 2).
  • the polypeptide comprises a single DAP group and/or residue of unnatural amino acid as described above. This has the advantage of maintaining specificity for any further chemical modifications which might be directed at the DAP
  • the polypeptide comprises two DAP groups; suitably the polypeptide comprises three DAP groups; suitably the polypeptide comprises four DAP groups; suitably the polypeptide comprises five DAP groups; suitably the polypeptide comprises ten DAP groups or even more, such as 15-20 DAP groups. Most suitably the polypeptide comprises one to five DAP groups. More suitably the polypeptide comprises one DAP group.
  • multiple unnatural amino acid(s) as described above could be incorporated by the same or by different orthogonal codons/orthogonal tRNA pairs.
  • multiple unnatural amino acid(s) are incorporated by insertion/translation of multiple amber codons (together with a suitable orthogonal tRNA synthetase as described herein).
  • NCE Novel chemical entities
  • R is H, an amino acid residue or a peptide
  • R 2 is H, C -6 alkyl, C -6 haloalkyl or C 5-20 aryl.
  • q is l, 2 or 3;
  • each R 3 or R 4 is independently selected from H, halo, C -6 alkyl, C -6 haloalkyl, C 5-20 aryl, C 3-20 heteroaryl, OC 1 -6 alkyl, SC -6 alkyl, NH(C I-6 alkyl) and N(C I-6 alkyl) 2 ;
  • X is X -Y, S-S-Rg, Se-Se-R 5 , 0-NH-R 5 , S-NH-R 5 , Se-NH-R 5 , X 2 -Y , X 3 -Y 2 , N 3 or NH- S(0) 2 -Y 3 ;
  • X is S, Se, O, NH or N(C I-6 alkyl);
  • X 2 is S, Se or O
  • X 3 is NH-C(0)-0;
  • X 4 is NH-C(0)-0, O, S or NH;
  • R 5 is selected from H, halo, C -6 alkyl, C -6 haloalkyl, C 5-20 aryl, C 3-20 heteroaryl, OC 1 -6 alkyl, NH(C I-6 alkyl), N(C I-6 alkyl) 2 , peptides, sugars, C 3-20 heterocyclyl and nucleic acids;
  • Y is a protecting group selected from:
  • R 6 is selected from H, C -6 alkyl, C -6 haloalkyl, C0 2 H, C0 2 R’, S0 2 H, S0 2 R’, C 5-20 aryl, C 3- 20 heteroaryl, NHC(0)R’ and NHR’;
  • R 7 and Rs are independently selected from H, OH, 0(C -6 alkyl), 0(C 5-20 aryl) and 0(C 3- heteroaryl); or R 7 and Rs are linked together to form an 0-CH 2 -0 group; each R’ is independently selected from C -6 alkyl, C -6 haloalkyl and C 5-20 aryl;
  • R g is selected from H, C -6 alkyl, C -6 haloalkyl, C0 2 H, C0 2 R’ S0 2 H, S0 2 R’ and C 5-20 aryl;
  • R o is selected from H, C -6 alkyl and C -6 haloalkyl;
  • R is selected from H, C -6 alkyl and C -6 haloalkyl
  • X 5 is S, O, NH, N-C(0)-0-R’, N-S(0) 2 H, N-S(0) 2 R’ or NR’;
  • Y is a protecting group selected from
  • Y 2 is a protecting group selected from
  • R 12 is C - 6 alkyl or C(0)-(C 5-20 aryl)
  • R I3 is H, C - 6 alkyl, allyl or C 5-20 aryl
  • Y 3 is a protecting group
  • salts, solvates, tautomers, isomers or mixtures thereof means that salt, solvate, tautomeric, isomeric forms of the shown structure are also included. Mixtures thereof means that mixture of these forms may be present, for example, the compounds of the invention may comprise a salt of a tautomeric form.
  • “Pharmaceutically acceptable” substances refers to those substances which are within the scope of sound medical judgment suitable for use in contact with the tissues of subjects without undue toxicity, irritation, allergic response, and the like, commensurate with a reasonable benefit-to-risk ratio, and effective for their intended use.
  • “Pharmaceutical composition” refers to the combination of one or more drug substances and one or more excipients.
  • solvate refers to a complex of variable stoichiometry formed by a solute (e.g. formulas (I)-(II), or any other compound herein or a salt thereof) and a solvent.
  • Pharmaceutically acceptable solvates may be formed for crystalline compounds wherein solvent molecules are incorporated into the crystalline lattice during crystallization.
  • the incorporated solvent molecules can be water molecules or non- aqueous molecules, such as but not limited to, ethanol, isopropanol, dimethyl sulfoxide, acetic acid, ethanolamine, and ethyl acetate molecules.
  • C -6 alkyl refers to straight chain and branched saturated hydrocarbon groups, generally having from 1 to 6 carbon atoms; more suitably a C -5 alkyl; more suitably a C -4 alkyl; more suitably a C -3 alkyl.
  • alkyl groups include methyl, ethyl, n-propyl, i-propyl, n-butyl, s-butyl, i-butyl, t-butyl, pent-i-yl, pent-2-yl, pent-3-yl, 3-methylbut-i-yl, 3-methylbut-2-yl, 2-methylbut-2-yl, 2,2,2- trimethyleth-i-yl, n-hexyl, n-heptyl, and the like.
  • an amino acid residue refers to an amino acid where either the amine or the carboxylic acid end of an amino acid has been replaced with a peptide bond.
  • C 5-20 aryl refers to fully unsaturated monocyclic, bicyclic and polycyclic aromatic hydrocarbons having at least one aromatic ring and having a specified number of carbon atoms that comprise their ring members (e.g., C 6-i4 aryl refers to an aryl group having 6 to 14 carbon atoms as ring members).
  • the aryl group may be attached to a parent group or to a substrate at any ring atom and may include one or more non- hydrogen substituents unless such attachment or substitution would violate valence requirements.
  • aryl groups include phenyl, biphenyl, cyclobutabenzenyl, naphthalenyl, benzocycloheptenyl, azulenyl, biphenylenyl, anthracenyl, phenanthrenyl, naphthacenyl, pyrenyl, groups derived from cycloheptatriene cation, and the like.
  • aryl groups which comprise fused rings include, but are not limited to, groups derived from indanyl, indenyl, isoindenyl, tetralinyl, acenaphthenyl, fluorenyl, phenalenyl, acephenanthrenyl and aceanthrenyl.
  • Halo or“halogen” refers to -F, -Cl, -Br or -I.
  • C 1-6 haloalkyl refers to a group derived from a C - 6 alkyl group where 1 or more of the hydrogen atoms have been replaced with halo atoms.
  • the C - 6 haloalkyl is CH 2 F, CHF 2 , CF 3 , CH 2 Cl, CHCl 2 or CCl 3 .
  • C 3-20 Heteroaryl refers to unsaturated monocyclic, bicyclic or polycylic aromatic groups comprising from 3 to 20 ring atoms, whether carbon or heteroatoms, of which from 1 to 10 are ring heteroatoms.
  • each ring has from 3 to 7 ring atoms and from 1 to 4 ring heteroatoms.
  • each ring heteroatom is independently selected from nitrogen, oxygen, and sulfur.
  • the bicyclic and polycyclic may include any bicyclic or polycyclic group in which any of the above-listed monocyclic heterocycles are fused to a benzene ring.
  • the heteroaryl group maybe attached to a parent group or to a substrate at any ring atom and may include one or more non-hydrogen substituents unless such attachment or substitution would violate valence requirements or result in a chemically unstable compound.
  • monocyclic heteroaryl groups include, but are not limited to, those derived from:
  • N 1 O 1 oxazole, isoxazole, isoxazine
  • N 2 0 I oxadiazole (e.g. i-oxa-2,3-diazolyl, i-oxa-2,4-diazolyl, i-oxa-2,5-diazolyl, l-oxa- 3,4-diazolyl);
  • N 3 O I oxatriazole
  • N S thiazole, isothiazole
  • N 2 imidazole, pyrazole, pyridazine, pyrimidine (e.g., cytosine, thymine, uracil), pyrazine;
  • N 3 triazole, triazine
  • heteroaryl which comprise fused rings, include, but are not limited to, those derived from:
  • indole isoindole, indolizine, isoindoline, quinoline, isoquinoline, quinolizine, carbazole, acridine, phenanthridine;
  • N 2 benzimidazole, indazole, benzodiazine, pyridopyridine, quinoxaline, quinazoline, cinnoline, phthalazine, naphthyridine, benzodiazepine, carboline, perimidine, pyridoindole, phenazine, phenanthroline, phenazine;
  • N 4 purine (e.g., adenine, guanine), pteridine;
  • C 3-20 heterocyclyl refers to saturated or partially unsaturated monocyclic, bicyclic or polycyclic groups having ring atoms composed of 3 to 20 ring atoms, whether carbon atoms or heteroatoms, of which from 1 to 10 are ring heteroatoms.
  • each ring has from 3 to 7 ring atoms and from 1 to 4 ring heteroatoms (e.g., suitably C 3-5 heterocyclyl refers to a heterocyclyl group having 3 to 5 ring atoms and 1 to 4 heteroatoms as ring members).
  • the ring heteroatoms are independently selected from nitrogen, oxygen, and sulphur.
  • bicyclic heterocyclyl groups may include isolated rings, spiro rings, fused rings, and bridged rings.
  • the heterocyclyl group may be attached to a parent group or to a substrate at any ring atom and may include one or more non-hydrogen substituents unless such attachment or substitution would violate valence requirements or result in a chemically unstable compound.
  • monocyclic heterocyclyl groups include, but are not limited to, those derived from:
  • N aziridine, azetidine, pyrrolidine, pyrroline, 2H-pyrrole or 3H-pyrrole, piperidine, dihydropyridine, tetrahydropyridine, azepine;
  • N 2 imidazoiidine, pyrazolidine, imidazoline, pyrazoline, piperazine:
  • N 1 O 1 tetrahydrooxazole, dihydrooxazole, tetrahydroisoxazole, dihydroisoxazole, morpholine, tetrahydrooxazine, dihydrooxazine, oxazine;
  • N 1 S 1 thiazoline, thiazolidine, thiomorpholine;
  • O 1 S 1 oxathiole and oxathiane (thioxane);
  • N 1 O 1 S 1 oxathiazine.
  • substituted monocyclic heterocyclyl groups include those derived from saccharides, in cyclic form, for example, furanoses, such as arabinofuranose, lyxofuranose, ribofuranose, and xylofuranse, and pyranoses, such as aliopyranose, altropyranose, glucopyranose, mannopyranose, gulopyranose, idopyranose, galactopyranose, and talopyranose.
  • furanoses such as arabinofuranose, lyxofuranose, ribofuranose, and xylofuranse
  • pyranoses such as aliopyranose, altropyranose, glucopyranose, mannopyranose, gulopyranose, idopyranose, galactopyranose, and talopyranose.
  • peptide refers to a linear molecule comprising multiple amino acid residues that are combined with each other by peptide bonds.
  • Protecting groups are groups that are introduced into a molecule by chemical modification of a functional group to temporarily mask the characteristic chemistry of a functional group to prevent it from interfering with another reaction.
  • a protecting group that can be removed by a photolytic reaction i.e. is capable of being removed/is removable/ can be deprotected by a photolytic reaction
  • a protecting group that can be removed by radiant energy such as light is a group that can be removed by radiant energy such as light.
  • Protecting groups are described in Wuts, P.G.M. and Greene, T.W., Protective Groups in Organic Synthesis, 4 th Edition, Wiley-lnterscience, 2007, and in P. Kocienski, Protective Groups, 3rd Edition (2005).
  • A“sugar” substituent represents a monosaccharide or polysaccharide where a H from a hydroxyl group of the sugar has been replaced with a bond attaching the sugar substituent to the rest of the compound of formula (I) or (II).
  • the sugar is a monosacchride.
  • the sugar is glucose, mannose or galactose.
  • the protecting group is photolabile and so can be deprotected at wavelengths m ax greater than 300 nm. These are wavelengths that are non-detrimental to biological systems.
  • the unnatural amino acid of formula (I) or (II) is:
  • the unnatural amino acid of formula (I) or (II) is in the D-form. More suitably, the unnatural amino acid of formula (I) or (II) is:
  • the unnatural amino acid of formula (I) or (II) is in the L-form.
  • the unnatural amino acid of formula (I) or (II) is: or salts, solvates, tautomers, isomers or mixtures thereof.
  • the above unnatural amino acids formula (I) or (II) are in the D-form. More suitably, the above unnatural amino acids formula (I) or (II) are in the L-form. More suitably, the unnatural amino acid of formula (I) or (II) is:
  • the unnatural amino acid is an unnatural amino acid of formula (I) or salts, solvates, tautomers, isomers or mixtures thereof.
  • the unnatural amino acid of formula (I) has the following formula:
  • the unnatural amino acid of formula (I) has the following formula:
  • the unnatural amino acid of formula (I) has the following formula:
  • X is Xi-Y, S-S-R 5 , 0-NH-R 5 , S-NH-R 5 , X 2 -Yêt X 3 -Y 2 , N 3 or NH-S(0) 2 -Y 3 .
  • X is Xi-Y, X 2 -Y transit X 3 -Y 2 , N 3 or NH-S(0) 2 -Y 3 . More suitably, X is X,-Y.
  • Xi is S, Se, O, NH, N(CH 3 ) or N(CH 2 CH 3 ). More suitably, Xi is S or O. More suitably, Xi is S.
  • X 2 is S or O.
  • X 2 is S
  • X 4 is NH-C(0)-0, O, S or NH.
  • X 4 is NH-C(0)-0.
  • X 5 is S, O, NH, N-C(0)-0-CH 3 , N-C(0)-0-CH 2 CH 3 , N-C(0)-0-Ph, N- S(0) 2 CH 3 , N-S(0) 2 CH 2 CH 3 , N-CH 3 , N-CH 2 CH 3 or N-Ph. More suitably, X 5 is S, O, NH or N-CH 3 .
  • Ri is H, an amino acid residue or a peptide.
  • Ri is H or a proteinogenic amino acid residue.
  • Ri is H.
  • R 2 is H, CXc, alkyl, Ci- 6 haloalkyl or phenyl. More suitably, R 2 is H, CH 3 , CH 2 CH 3 , CF 3 or phenyl. More suitably, R 2 is H.
  • each R 3 and 3 ⁇ 4 is independently selected from H, F, Cl, Br, CH 3 , CH 2 CH 3 , CF 3 , Ph, pyridyl, pyrrolyl, imidazolyl, OCH 3 , OCH 2 CH 3 , SCH 3 , SCH 2 CH 3 , NH(CH 3 ),
  • each R 3 is H, CH 3 , CH 2 CH 3 , CF 3 , Ph, OCH 3 or OCH 2 CH 3 . More suitably, each R 3 is H.
  • each R 4 is H, CH 3 , CH 2 CH 3 , CF 3 , Ph, OCH 3 or OCH 2 CH 3 . More suitably, each R4 is H.
  • R 5 is selected from H, halo, C -6 alkyl, C -6 haloalkyl, C 5-20 aryl, C 3-20 heteroaryl, OC - 6 alkyl, NH(C I-6 alkyl) and N(C I-6 alkyl) 2 .
  • R 5 is H,F, Cl, Br, CH 3 , CH 2 CH 3 , CF 3 , Ph, pyridyl, pyrrolyl, imidazolyl, OCH 3 , OCH 2 CH 3 , SCH 3 , SCH 2 CH 3 , NH(CH 3 ), NH(CH 2 CH 3 ), N(CH 3 ) 2 or N(CH 2 CH 3 ) 2 .
  • protecting group Y comprises a stereocenter at the carbon to which the R 6 or R g is attached.
  • Y is a racemic mixture, or has (R)-configuration or (S)-configuration for the stereocenter at the carbon to which R 6 or R g is attached.
  • Y has (R)-configuration for the stereocenter at the carbon to which R 6 or R g is attached.
  • Y has (S)-configuration for the stereocenter at the carbon to which R 6 or R g is attached.
  • the compound of formula (I) or (II) or salts, solvates, tautomers, isomers or mixtures thereof comprises a group Y.
  • Y is:
  • the unnatural amino acid comprises a group Y that is:
  • the unnatural amino acid comprises a group Y that is:
  • R 6 is selected from H, CH 3 , CH 2 CH 3 , CF 3 , C0 2 H, C0 2 CH 3 , C0 2 CH 2 CH 3 and Ph.
  • R 6 is CH 3 .
  • R 7 and Rs are independently selected from H, OH, OCH 3 , OCH 2 CH 3 and O-Ph; or R 7 and Rs are linked together to form an 0-CH 2 -0 group.
  • R 7 and Rs are the same.
  • R 7 and Rs are H, OH, OCH 3 or OCH 2 CH 3 ; or R 7 and Rs are linked together to form an 0-CH 2 -0 group. More suitably, R 7 and Rs are linked together to form an 0-CH 2 -0 group.
  • each R’ is independently selected from H, CH 3 , CH 2 CH 3 , CF 3 and Ph.
  • R g is selected from H, CH 3 , CH 2 CH 3 , CF 3 , C0 2 H, C0 2 CH 3 , C0 2 CH 2 CH 3 and Ph.
  • R g is selected from H, CH 3 , CH 2 CH 3 and CF 3 .
  • R 10 is selected from H, CH 3 , CH 2 CH 3 and CF 3 .
  • R n is selected from H, CH 3 , CH 2 CH 3 and CF 3 .
  • M + is Li + , Na + or K + .
  • M + is Li + . In an alternative aspect, M + is Na + . In an alternative aspect,
  • M + is N(R I3 ) 4 + .
  • M + is K + .
  • Z is Si.
  • Z is Ge
  • R i2 is CH 3 , CH 2 CH 3 or C(0)-(Ph).
  • R 13 is C -6 alkyl, allyl or C 5-20 aryl.
  • R 13 is H, CH 3 or CH 2 CH 3 or allyl.
  • R 13 is CH 3 or CH 2 CH 3 .
  • Y is:
  • Y is:
  • the unnatural amino acid is:
  • the unnatural amino acid is a compound of formula (III) or (IV) or salts, solvates, tautomers, isomers or mixtures thereof.
  • the unnatural amino acid is a compound of formula (III) or salts, solvates, tautomers, isomers or mixtures thereof.
  • the unnatural amino acid is a compound of formula (IV) or salts, solvates, tautomers, isomers or mixtures thereof.
  • one or more of the compounds 2, 3, 4 or 5 of Figure 3 may be used in an in vitro translation system using, the synthetase as described above, or for example the synthetase described in Nguyen, D. P. et al. (2014) [J. Am. Chem. Soc., 2014, 136 (6), pp 2240-2243] i.e. synthetase“PCCiRS” which is Mb Pyl RS with the mutations N311M, C313Q, V366G, W382N, R85H.
  • a reference to carboxylic acid (- COOH) also includes the anionic (carboxylate) form (-COO ), a salt or solvate thereof.
  • a reference to an amino group includes the protonated form (-N + H ⁇ R 2 ), a salt or solvate of the amino group, for example, a hydrochloride salt.
  • a reference to a hydroxyl group also includes the anionic form (-0 ), a salt or solvate thereof.
  • Certain compounds may exist in one or more particular geometric, optical,
  • enantiomeric, diasteriomeric, epimeric, atropic, stereoisomeric, tautomeric, conformational, or anomeric forms including but not limited to, cis- and trans-forms; E- and Z-forms; c-, t-, and r- forms; endo- and exo-forms; R-, S-, and meso-forms; D- and L-forms; d- and 1- forms; (+) and (-) forms; keto-, enol-, and enolate-forms; syn- and anti-forms; synclinal- and anticlinal-forms; alpha- and beta-forms; axial and equatorial forms; boat-, chair-, twist-, envelope-, and halfchair-forms; and
  • a reference to a methoxy group, -OCH 3 is not to be construed as a reference to its structural isomer, a hydroxymethyl group, - CH 2 0H.
  • a reference to a class of structures may well include structurally isomeric forms falling within that class (e.g. C -7 alkyl includes n-propyl and iso-propyl; butyl includes n-, iso-, sec-, and tert-butyl; methoxyphenyl includes ortho-, meta-, and para-methoxyphenyl).
  • C -7 alkyl includes n-propyl and iso-propyl
  • butyl includes n-, iso-, sec-, and tert-butyl
  • methoxyphenyl includes ortho-, meta-, and para-methoxyphenyl
  • H may be in any isotopic form, including ⁇ , 2 H (D), and 3 H (T); C may be in any isotopic form, including n C, 12 C, 13 C, and 14 C; O may be in any isotopic form, including l6 0 and l8 0; and the like.
  • compound 6 may be the 13 C and 15 N isotopically labelled or the l8 0 isotopically labelled compound as shown below:
  • a reference to a particular compound includes all such isomeric forms, including (wholly or partially) racemic and other mixtures thereof.
  • An example of otherwise specified bond is the CH group in DAP which is shown below with a specified stereochemistry:
  • a reference to a particular compound also includes ionic, salt, solvate, and protected forms of thereof, for example, as discussed below.
  • the compound of formula (I) or (II) or salts, solvates, tautomers, isomers or mixtures thereof comprises pharmaceutically acceptable salts of the compounds of formula (I) or (II).
  • Compounds of formula (I) or (II), which include compounds specifically named above, may form pharmaceutically acceptable complexes, salts, solvates and hydrates. These salts include nontoxic acid addition salts (including di-acids) and base salts. If the compound is cationic, or has a functional group which may be cationic (e.g. -NH 2 may be -NH 3 + ), then an acid addition salt may be formed with a suitable anion.
  • suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids hydrochloric acid, nitric acid, nitrous acid, phosphoric acid, sulfuric acid, sulphurous acid, hydrobromic acid, hydroiodic acid, hydrofluoric acid, phosphoric acid and phosphorous acids.
  • Suitable organic anions include, but are not limited to, those derived from the following organic acids: 2-acetyoxybenzoic, acetic, ascorbic, aspartic, benzoic, camphorsulfonic, cinnamic, citric, edetic, ethanedisulfonic, ethanesulfonic, fumaric, glucheptonic, gluconic, glutamic, glycolic, hydroxymaleic, hydroxynaphthalene carboxylic, isethionic, lactic, lactobionic, lauric, maleic, malic, methanesulfonic, mucic, oleic, oxalic, palmitic, pamoic, pantothenic, phenylacetic, phenylsulfonic, propionic, pyruvic, salicylic, stearic, succinic, sulfanilic, tartaric, toluenesulfonic, and valeric.
  • Suitable polymeric organic anions include, but are not limited to, those derived from the following polymeric acids: tannic acid, carboxymethyl cellulose.
  • Such salts include acetate, adipate, aspartate, benzoate, besylate, bicarbonate, carbonate, bisulfate, sulfate, borate, camsylate, citrate, cyclamate, edisylate, esylate, formate, fumarate, gluceptate, gluconate, glucuronate, hexafluorophosphate, hibenzate,
  • a base salt may be formed with a suitable cation.
  • suitable inorganic cations include, but are not limited to, metal cations, such as an alkali or alkaline earth metal cation, ammonium and substituted ammonium cations, as well as amines.
  • suitable metal cations include sodium (Na + ) potassium (K + ), magnesium (Mg 2+ ), calcium (Ca 2+ ), zinc (Zn 2+ ), and aluminum (Al3 + ).
  • suitable organic cations include, but are not limited to, ammonium ion (i.e.
  • substituted ammonium ions e.g. NH 3 R + , NH 2 R 2 + , NHR 3 + , NR ⁇ .
  • substituted ammonium ions are those derived from: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine,
  • phenylbenzylamine, choline, meglumine, and tromethamine as well as amino acids, such as lysine and arginine.
  • amino acids such as lysine and arginine.
  • An example of a common quaternary ammonium ion is N(CH 3 ) 4 + .
  • suitable amines include arginine, N,N'-dibenzyl ethylene- diamine, chloroprocaine, choline, diethylamine, diethanolamine, dicyclohexylamine, ethylenediamine, glycine, lysine, N-methylglucamine, olamine, 2-amino-2- hydroxymethyl-propane-i,3-diol, and procaine.
  • Pharmaceutically acceptable salts maybe prepared using various methods. For example, one may react a compound of formula (I) or (II) with an appropriate acid or base to give the desired salt. One may also react a precursor of the compound of formula (I) or (II) with an acid or base to remove an acid- or base-labile protecting group or to open a lactone or lactam group of the precursor. Additionally, one may convert a salt of the compound of formula (I) or (II) to another salt through treatment with an appropriate acid or base or through contact with an ion exchange resin.
  • the salt may then isolate the salt by filtration if it precipitates from solution, or by evaporation to recover the salt.
  • the degree of ionization of the salt may vary from completely ionized to almost non-ionized.
  • solvate describes a molecular complex comprising the compound and one or more pharmaceutically acceptable solvent molecules (e.g., EtOH).
  • solvent molecules e.g., EtOH
  • hydrate is a solvate in which the solvent is water.
  • Pharmaceutically acceptable solvates include those in which the solvent may be isotopically substituted (e.g., D 2 0, acetone-d6, DMSO-d6).
  • a currently accepted classification system for solvates and hydrates of organic compounds is one that distinguishes between isolated site, channel, and metal-ion coordinated solvates and hydrates. See, e.g., K. R. Morris (H. G. Brittain ed.)
  • Isolated site solvates and hydrates are ones in which the solvent (e.g., water) molecules are isolated from direct contact with each other by intervening molecules of the organic compound.
  • the solvent molecules lie in lattice channels where they are next to other solvent molecules.
  • metal-ion coordinated solvates the solvent molecules are bonded to the metal ion.
  • the complex When the solvent or water is tightly bound, the complex will have a well-defined stoichiometry independent of humidity. When, however, the solvent or water is weakly bound, as in channel solvates and in hygroscopic compounds, the water or solvent content will depend on humidity and drying conditions. In such cases, non- stoichiometry will typically be observed.
  • said genetic incorporation preferably uses an orthogonal or expanded genetic code, in which one or more specific orthogonal codons have been allocated to encode the unnatural amino acid of interest so that it can be genetically incorporated by using an orthogonal tRNA synthetase/tRNA pair.
  • the orthogonal tRNA synthetase/tRNA pair can in principle be any such pair capable of charging the tRNA with the unnatural amino acid of interest and capable of incorporating that unnatural amino acid of interest into the polypeptide chain in response to the orthogonal codon.
  • the orthogonal codon may be the orthogonal codon amber, ochre, opal or a quadruplet codon.
  • the codon simply has to correspond to the orthogonal tRNA which will be used to carry the unnatural amino acid of interest. Most suitably the orthogonal codon is amber.
  • the anticodon region of the tRNA may simply be swapped for the desired anticodon region for the codon of choice.
  • the anticodon region is not involved in the charging or incorporation functions of the tRNA nor recognition by the tRNA synthetase so such swaps are entirely within the ambit of the skilled operator.
  • the anticodon region of the tRNA used in the invention such as M RNACUA or MmtRNAcu A may be exchanged i.e. a chimeric tRNAcu A may be used such that the anticodon region is swapped to recognise an alternate codon so that the unnatural amino acid of interest may be incorporated in response to a different orthogonal codon as discussed herein including ochre, opal or a quadruplet codon, and the nucleic acid encoding the polypeptide into which the unnatural amino acid of interest is to be incorporated is correspondingly mutated to introduce the cognate codon at the point of incorporation of the unnatural amino acid of interest.
  • the orthogonal codon is amber.
  • alternative orthogonal tRNA synthetase/tRNA pairs maybe used if desired, provided the desired charging activity is retained.
  • the Methanosarcina barkeri PylT gene encodes the RNA CUA tRNA (i.e.
  • tRNAcu A sequence is as below:
  • MbPylT (strain MS, from Genbank accession number AY064401) gggaacctgatcatgtagatcgaatggactctaaatccgttcagccgggt
  • MbPylT (strain MS, from Genbank accession number AY064401) ggaaacctgatcatgtagatcgaatggactctaaatccgttcagccgggt
  • the Methanosarcina barkeri PylS gene encodes the Mb Pyl RS tRNA synthetase protein.
  • tRNA Synthetases If required, the person skilled in the art may adapt bPylRS tRNA synthetase protein by mutating it so as to optimise for the particular unnatural amino acid to be used. The need for mutation (if any) depends on the particular unnatural amino acid used. An example where the Mb Pyl RS tRNA synthetase may need to be mutated is when the particular unnatural amino acid used is not processed by the bPylRS tRNA
  • the synthetase of the invention comprises C at 271, Q at 311, F at 349 and C at 366 (i.e. Y271C, N311Q, Y349F and V366C with reference to bPylRS) or the equivalent positions if using a different starting synthetase sequence / backbone synthetase sequence from another species.
  • DAPRS (mutated residues are underlined): MDKKPLDVLISATGLWMSRTGTLHKIKHHEVSRSKIYIEMACGDHLWNNSRSCRTA
  • the orthogonal synthetase/tRNA pair are Methanosarcina barkeri MS pyrrolysine tRNA synthetase ( bPylRS) and its cognate amber suppressor tRNA (RNA CUA ) (i.e. RNA ⁇ CUA ), wherein said MhPylRS comprises the mutations explained herein which are important to its activity i.e. that the Mb Pyl RS comprises C at 271, Q at 311, F at 349 and C at 366 (i.e. Y271C, N311Q, Y349F and V366C).
  • tRNA synthetase of the invention may be varied. Although specific tRNA synthetase sequences may have been used in the examples, the invention is not intended to be confined only to those examples.
  • aminoacylation function
  • aminoacylation function
  • tRNA synthetase may be from any suitable species such as from archea, for example from Methanosarcina barkeri MS; Methanosarcina barkeri str. Fusaro; Methanosarcina mazei G01; Methanosarcina acetivorans C2A;
  • Methanosarcina thermophila or Methanococcoides burtonii may be from bacteria, for example from Desulfitobacterium hafniense DCB-2; Desulfitobacterium hafniense Y51; Desulfitobacterium hafniense PCPi;
  • Desulfotomaculum acetoxidans DSM 771 Desulfotomaculum acetoxidans DSM 771.
  • Exemplary sequences from these organisms are the publically available sequences.
  • the following examples are provided as exemplary sequences for pyrrolysine tRNA synthetases:
  • VERSION NP_615128.2 161484944 MDKKPLDTLISATGLWMSRTGMIHKIKHHEVSRSKIYIEMACGERLWNNSRSSRTAR ALRHHKYRKTCRHCRVSDEDINNFLTKTSEEKTTVKVKWSAPRVRKAMPKSVARAP KPLEATAQVPLSGSKPAPATPVSAPAQAPAPSTGSASATSASAQRMANSAAAPAAPVPT SAPALTKGQLDRLEGLLSPKDEISLDSEKPFRELESELLSRRKKDLKRIYAEERENYLG KLEREITKFFVDRGFLEIKSPILIPAEYVERMGINSDTELSKQVFRIDKNFCLRPMLAPN LYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLEAII TEFLNHLGIDFEIIGDSCMVYGNTLDVMHDDLELSSAWGPVPLDREWGIDKPWIGA GFGLERLLKVMHGFKNIKRAARSESYYN
  • thermophila Methanosarcina thermophila, VERSION DQ017250.1 GI: 67773308
  • tRNA charging (aminoacylation) function When the particular tRNA charging (aminoacylation) function has been provided by mutating the tRNA synthetase, then it may not be appropriate to simply use another wild-type tRNA synthetase sequence, for example one selected from the above. In this scenario, it will be important to preserve the same tRNA charging (aminoacylation) function. This is accomplished by transferring the mutation(s) in the exemplary tRNA synthetase into an alternate tRNA synthetase backbone, such as one selected from the above.
  • Target tRNA synthetase proteins/backbones may be selected by alignment to known tRNA synthetases such as exemplary M.barkeri and/ or M.mazei sequences.
  • an alignment of all PylS sequences maybe prepared. These can have a low overall % sequence identity. Thus it is important to study the sequence such as by aligning the sequence to known tRNA synthetases (rather than simply to use a low sequence identity score) to ensure that the sequence being used is indeed a tRNA synthetase.
  • sequence identity when sequence identity is being considered, suitably it is considered across the sequences of the examples of tRNA synthetases as above.
  • % identity may be as defined from an alignment of the above sequences.
  • the aim of this is to provide a tRNA catalytic region from which a high % identity can be defined to capture/identify backbone scaffolds suitable for accepting mutations transplanted in order to produce the same tRNA charging (aminoacylation) function, for example new or unnatural amino acid recognition.
  • sequence identity when sequence identity is being considered, suitably it is considered across the catalytic region.
  • % identity may be as defined from the catalytic region.
  • ‘Transferring’ or‘transplanting’ mutations onto an alternate tRNA synthetase backbone can be accomplished by site directed mutagenesis of a nucleotide sequence encoding the tRNA synthetase backbone. This technique is well known in the art. Essentially the backbone pylS sequence is selected (for example using the active site alignment discussed above) and the selected mutations are transferred to (i.e. made in) the corresponding/homologous positions.
  • MbPylRS Methanosarcina barkeri pyrrolysyl-tRNA synthetase amino acid sequence as the reference sequence (i.e. as encoded by the publicly available wild type Methanosarcina barkeri PylS gene
  • L266M means that the amino acid corresponding to L at position 266 of the wild type sequence is replaced with M.
  • the amino acid which is introduced is the most important information in this notation.
  • this alternate starting sequence may not have‘L’ at position 266 (or at the position corresponding to L266 of the reference sequence as explained above).
  • this residue is changed to M.
  • ‘L266M’ maybe understood as‘X266M’ when transplanting onto alternate backbone/starting sequences.
  • the mutations would be noted as Y271C, N311Q, Y349F and V366C compared to the M.b. reference sequence (see above), or could be understood as X271C, X311Q, X349F and X366C if transplanting onto a backbone having different amino acid(s) at those positions in the starting sequence.
  • transplantation of mutations between alternate tRNA backbones is now illustrated with reference to exemplary M.barkeri and M.mazei sequences, but the same principles apply equally to transplantation onto or from other backbones.
  • Mb AcKRS is an engineered synthetase for the incorporation of AcK Parental protein/backbone: M. barkeri PylS
  • PCKRS engineered synthetase for the incorporation of PCK
  • Synthetases with the same substrate specificities can be obtained by transplanting these mutations into M. mazei PylS.
  • the following synthetases may be generated by transplantation of the mutations from the Mb backbone onto the Mm tRNA backbone: Mm AcKRS introducing mutations L301V, L305I, Y306F, L309A, C348F into M. mazei PylS, and
  • Mm PCKRS introducing mutations M276F, A302S, Y306C, L309M into M. mazei PylS.
  • Transplanted polypeptides produced in this manner should advantageously be tested to ensure that the desired function/substrate specificities have been preserved.
  • the tRNA may be from one species such as Methanosarcina barkeri, and the tRNA synthetase may be from another species such as Methanosarcina mazei.
  • tRNA may be from a first species such as Methanosarcina mazei and the tRNA synthetase may from a second species such as Methanosarcina barkeri.
  • orthogonal pairs comprise the tRNA and a tRNA synthetase from the same species.
  • Chimeric tRNA synthetases may be produced provided that the charging/ acylation part of the tRNA synthetase molecule is based on or derived from Pyl tRNA synthetase.
  • the anti-codon part of the tRNA molecule may be varied according to operator choice, for example to direct tRNA in recognising an alternate codon such as a sense codon, a quadruplet codon, an amber codon or another“stop” codon.
  • the functional acylation/charging part of the tRNA molecule should be conserved in order to preserve the charging activity useful with the unnatural amino acids as described above.
  • Methanosarcina barkeri and Methanosarcina mazei tRNAs are suitable. In any case these tRNAs differ by only one nucleotide. This one nucleotide difference has no impact on their activity. Therefore, either tRNA is equally applicable in the present invention.
  • tRNA SYNTHETASE The tRNA used may be varied such as mutated. In all cases, any such variants or mutants of the Pyl tRNA should always retain the capacity to interact productively with the tRNA synthetase used to charge the tRNA with the unnatural amino acid(s) as described above.
  • Methanosarcina barkeri and Methanosarcina mazei species pyrrolysine tRNA synthetases are suitable, provided they comprise mutations as described herein helpful for charging tRNA with the unnatural amino acid(s) as described above.
  • the direct product of incorporating an unnatural amino acid as described herein into a polypeptide will be a polypeptide comprising a residue of said unnatural amino acid joined into the polypeptide backbone by a peptide bond.
  • the polypeptide will not comprise exactly the unnatural amino acid referred to, but will rather comprise a residue of it having undergone a condensation reaction as the amino acid group of the unnatural amino acid referred to reacts with its adjacent amino acid residue in the polypeptide chain, resulting in peptide bond based incorporation of a residue of the unnatural amino acid referred to plus one molecule of H 2 0 which is liberated.
  • references to“incorporation of unnatural amino acid X into the polypeptide chain” or“polypeptide comprising unnatural amino acid X” should be interpreted accordingly.
  • This is entirely conventional nomenclature in the art, for example when an amino acid such as valine is incorporated into a polypeptide chain, the polypeptide chain is described as comprising valine whereas in fact it comprises an amino acid residue of valine which has been joined into the polypeptide chain by reaction its amino acid group and formation of a peptide bond and liberation of one H 2 0 molecule as noted above.
  • the invention relates to a polypeptide comprising an unnatural amino acid as described above.
  • the invention relates to a polypeptide comprising an unnatural amino acid as described above wherein said unnatural amino acid is attached to said polypeptide via a peptide bond.
  • the invention relates to a polypeptide comprising an unnatural amino acid as described above wherein said unnatural amino acid is joined to said polypeptide via a peptide bond.
  • the invention relates to a polypeptide comprising an unnatural amino acid as described above incorporated by or via a peptide bond.
  • the invention relates to a polypeptide comprising a residue of an unnatural amino acid as described above incorporated by or via a peptide bond.
  • unnatural amino acids refers to amino acids that are not naturally encoded or found in the genetic code of any organism.
  • unnatural amino acids are compounds containing amine and carboxylic acid functional groups and a side chain but which are not any of the proteinogenic amino acids used by translational machinery to assemble proteins.
  • exemplary unnatural amino acids disclosed herein may be referred to as ‘unnatural amino acids comprising DAP’ or‘amino acids comprising DAP’ or similar.
  • DAP has two NH2 groups whereas the unnatural amino acids discussed have a single NH2 group, the other NH2 group having lost a H atom and being instead bonded via the corresponding N atom to the rest of the amino acid side chain.
  • references to ‘unnatural amino acid comprising DAP’ or‘amino acid comprising DAP’ are used herein as is common in the art and may refer to one or any of compounds 2, 3, 4, 5 and 6, each of which has the H2N-C-(C00H)-C-N(H)-R moiety (i.e.‘comprising DAP’).
  • Polynucleotides encoding the polypeptide of interest for the method described above can be incorporated into a recombinant replicable vector.
  • the vector may be used to replicate the nucleic acid in a compatible host cell.
  • the invention provides a method of making polynucleotides of the invention by introducing a polynucleotide of the invention into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
  • the vector may be recovered from the host cell. Suitable host cells include bacteria such as E. coli.
  • a polynucleotide of the invention in a vector is operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector.
  • the term“operably linked” means that the components described are in a relationship permitting them to function in their intended manner.
  • a regulatory sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences.
  • Vectors of the invention may be transformed or transfected into a suitable host cell as described to provide for expression of a protein of the invention. This process may comprise culturing a host cell transformed with an expression vector as described above under conditions to provide for expression by the vector of a coding sequence encoding the protein, and optionally recovering the expressed protein.
  • the vectors may be for example, plasmid or virus vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and optionally a regulator of the promoter.
  • the vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid.
  • Vectors may be used, for example, to transfect or transform a host cell.
  • Control sequences operably linked to sequences encoding the protein of the invention include promoters/enhancers and other expression regulation signals. These control sequences may be selected to be compatible with the host cell for which the expression vector is designed to be used in.
  • promoter is well-known in the art and encompasses nucleic acid regions ranging in size and complexity from minimal promoters to promoters including upstream elements and enhancers.
  • Another aspect of the invention is a method, such as an in vitro method, of
  • incorporating the unnatural amino acid(s) comprising DAP genetically and site- specifically into the protein of choice suitably in a host cell.
  • One advantage of incorporating genetically by said method is that it obviates the need to deliver the proteins comprising DAP into a cell once formed, since in this embodiment they may be synthesised directly in the target cell.
  • the method comprises the following steps:
  • Step (i) entails or replacing a specific codon with an orthogonal codon such as an amber codon at the desired site in the genetic sequence of the protein.
  • This can be achieved by simply introducing a construct, such as a plasmid, with the nucleotide sequence encoding the protein, wherein the site where the unnatural amino acid(s) comprising DAP is desired to be introduced/replaced is altered to comprise an orthogonal codon such as an amber codon.
  • a construct such as a plasmid
  • Step (ii) requires an orthogonal expression system to specifically incorporate the unnatural amino acid(s) comprising DAP at the desired location (e.g. the amber codon).
  • a specific orthogonal tRNA synthetase such as an orthogonal DAPRS- tRNA synthetase and a specific corresponding orthogonal tRNA pair which are together capable of charging said tRNA with the unnatural amino acid(s) comprising DAP are required. Examples of these are provided herein.
  • Host cells comprising polynucleotides of the invention maybe used to express proteins of the invention.
  • Suitable host cells include bacteria such as E. coli, or certain eukaryotic cells.
  • bacteria such as E. coli
  • eukaryotic cells many UAAs using the PylS/PylT system have been shown to work in eukaryotic cells (the closest example is Nguyen, D. P. et al. (2014) [J. Am. Chem.
  • the eukaryotic cell may be any suitable eukaryotic cell such as an insect cell (e.g. Sf9 insect cells), a mammalian cell such as a mouse cell or a human cell.
  • an insect cell e.g. Sf9 insect cells
  • a mammalian cell such as a mouse cell or a human cell.
  • the eukaryotic cell is a mammalian cell.
  • the mammalian cell is a HEK293 cell such as a HEK293T cell.
  • the eukaryotic cell, mammalian cell, HEK293 cell or HEK293T cell is in vitro.
  • the cell is not an in vivo cell.
  • the host cell is a bacterial cell.
  • the host cell is E.coli.
  • the host cell is an E. coli cell.
  • the E. coli cell is a BL21 DE3 E.coli cell.
  • the invention relates to a method of producing a polypeptide comprising 2,3-diamino propionic acid (DAP) as described above, wherein said method is carried out inside a live cell.
  • DAP 2,3-diamino propionic acid
  • said method comprises genetically incorporating an unnatural amino acid as described above into a polypeptide, and optionally deprotecting said unnatural amino acid to 2,3-diamino propionic acid (DAP).
  • DAP 2,3-diamino propionic acid
  • said live cell comprises an E.coli cell such as a BL21 DE3 E.coli cell.
  • said live cell comprises a mammalian cell such as a HEK293T cell.
  • Host cells may be cultured under suitable conditions which allow expression of the proteins of the invention.
  • Expression of the proteins of the invention may be constitutive such that they are continually produced, or inducible, requiring a stimulus to initiate expression.
  • protein production can be initiated when required by, for example, addition of an inducer substance to the culture medium, for example dexamethasone or IPTG.
  • HEK293T Human Embryonic Kidney with large T antigen
  • ATCC® CRL-3216 from LGC Standards, Queens Road, Teddington, Middlesex, TW11 oLY, UK.
  • HEK293T cells maybe cultured as is known in the art, for example in Dulbecco’s modified eagle medium (DMEM) with appropriate supplementation as required.
  • BL21 DE3 E.coli cells are widely available such as C2527I or C2527H from New
  • Proteins of the invention can be extracted from host cells by a variety of techniques known in the art, including enzymatic, chemical and/ or osmotic lysis and physical disruption.
  • Proteins of the invention can be purified by standard techniques known in the art such as preparative chromatography, affinity purification or any other suitable technique.
  • the DAP and/ or unnatural amino acid as described above is incorporated at a position corresponding to a cysteine, serine or threonine residue in the wild type polypeptide, optionally at a position corresponding to a cysteine or serine residue in the wild type polypeptide, most suitably at a position corresponding to a cysteine residue in the wild type polypeptide.
  • the DAP and/or unnatural amino acid as described above is incorporated at a position corresponding to a catalytic cysteine, catalytic serine or catalytic threonine residue in the wild type polypeptide, optionally at a position corresponding to a catalytic cysteine or catalytic serine residue in the wild type polypeptide, most suitably at a position corresponding to a catalytic cysteine residue in the wild type polypeptide.
  • the invention finds particular application in modification of active site(s) of enzymes by incorporation of DAP.
  • DAP or unnatural amino acid described herein is incorporated at a position corresponding to an amino acid within the active site of the wild-type enzyme.
  • DAP or unnatural amino acid described herein is incorporated at a position corresponding to a catalytic amino acid within the active site of the wild-type enzyme.
  • the polypeptide is an enzyme.
  • the polypeptide of the invention is an enzyme which follows this general mechanism; more suitably the polypeptide may be a serine hydrolase (which are coded for by 1% of the genes in the human genome); suitably the enzyme may be a protease, peptidase, amidase, deubiquitinase, lipase, cholinesterase, thioesterase, phospholipase, glycan hydrolase 2-4 , cysteine protease (such as a caspase), or an enzyme involved in ubiquitination and/or SUMOylation (such as El’s, E2’s or certain families of E3’s) 5-7 . More suitably the DAP or unnatural amino acid described herein is incorporated into an enzyme such as a protease.
  • the invention provides, among other things, a new way to produce polypeptides comprising 2,3-diamino propionic acid (DAP).
  • DAP 2,3-diamino propionic acid
  • This has a range of industrial applications, for example exploiting its reactive properties to covalently trap molecules of interest such as substrates for enzymes being studied. This also enables dissection of metabolic pathways through similar approaches enabled by incorporating the DAP into the heart of the enzyme active site.
  • Applications also include study/capture of small molecule drugs so as to identify how they are modified/ metabolised by enzymes, and/or to identify their protein target(s).
  • DAP can be used in any protein catalysing reactions that proceed through covalent intermediates bound to serine or cysteine sidechains in the enzyme active site, it has a wide application potential. DAP can be used to structurally characterise these covalent intermediate. In addition to that, DAP also allows the identification of new substrates for these enzymes, which again may represent the starting point to new drug development strategies FURTHER APPLICATIONS
  • DAP can be used in any protein catalysing reaction that proceeds through covalent intermediates bound to serine or cysteine sidechains in the enzyme active site. DAP can be used to structurally characterise these covalent intermediates but also allows to identify new substrates for these enzymes.
  • the invention provides an amino acid (DAP5), which gets incorporated in protein with the use of a mutant of the pyrrolysine tRNA synthetase, which has been evolved to load its cognate tRNA with DAP5 (DAPRS).
  • DAP5 amino acid
  • DAP5 a mutant of the pyrrolysine tRNA synthetase, which has been evolved to load its cognate tRNA with DAP5
  • illumination to deprotect is for less than one minute, suitably for about one minute, suitably for one minute, suitably for at least one minute.
  • illumination to deprotect is for 1 millisecond to 120 seconds, more suitably for 1 millisecond to 60 seconds. Most suitably illumination to deprotect is for one minute.
  • the protein is subsequently incubated after illumination, at any temperature above freezing. Incubation is the second stage of deprotection. The time it takes to go to completion depends on the protein in which DAP is incorporated. In the examples the sample was incubated for 1 to 2h after illumination. In one aspect the invention relates to a method of capturing a substrate for an enzyme.
  • Suitable substrates are those for which thioester or ester intermediate bonds are created by action of the enzyme on said substrate (N.B. the substrate does not contain an ester or a thioester - suitably the substrate comprises a chemical structure such that these moieties are created during catalysis). Suitably these bonds are created after, or as a result of, nucleophilic attack of the enzyme on its substrate.
  • the created bond is an amide bond (discussed in more detail below).
  • said substrate is captured as a stable amide analogue.
  • said substrate may be an analogue of the naturally occurring substrate,
  • said enzyme is a cysteine protease or a thioesterase.
  • said enzyme acts through one or more acyl-enzyme intermediates, more suitably through one or more cysteine- or serine-bound acyl-enzyme intermediates.
  • the invention may be used to look at the intermediate enzyme- substrate complexes that are formed with the addition of a small molecule (drug).
  • a small molecule drug
  • This enables to elucidate how the drug disrupts this enzyme-substrate interaction during different complex formations.
  • the small molecule is a substrate for the enzyme, this is a useful application of the invention.
  • DAP replaces any nucleophilic (catalytic) residue, suitably cysteine and/ or serine, it will trap any substrate.
  • the invention finds application in researching insights into biosynthetic acyl-enzyme intermediates via encoded 2,3-diaminopropionic acid.
  • Figure 1 shows general mechanism of enzymes with cysteine and serine nucleophiles in the active site that proceed through acyl-enzyme intermediates
  • FIG. 2 shows valinomycin synthetase and the proposed biosynthesis of valinomycin.
  • Valinomycin synthetase subunits Vlmi and Vlm2 condense D-a-hydroxyisovaleric acid (D-a-hiv), D-valine (D-val), L-lactic acid (L-lac), and L-valine (L-val) in a sequential manner to form the tetradepsipeptidyl (D-hiv-D-val-L-lac-L-val) intermediate.
  • D-a-hiv and L-lac arise from the selection and ketoreduction of their precursor ketoacids by the specialized modules 1 and 3, which include ketoreductase (KR) domains.
  • KR ketoreductase
  • the tetradepsipeptidyl intermediate is oligomerized to an octadepsipeptidyl intermediate and then dodecadepsipeptidyl intermediate, which is cyclized by the terminal thioesterase (TE) domain, producing valinomycin.
  • TE terminal thioesterase
  • Figure 3 shows genetically directing DAP incorporation in recombinant proteins a, Structure of DAP and the protected versions investigated herein.
  • DAP 2,3- diaminopropionic acid
  • 2 (S)-3-(((allyloxy)carbonyl)amino)-2-aminopropanoic acid.
  • the dark- blue trace represents a 100 mM standard for each compound.
  • the light-blue trace represents a 10 uM standard for each compound.
  • the red trace results from cells grown in the absence of the compound.
  • the brown trace results from cells grown in the absence of the compound, but spiked with the compound to 10 pM.
  • the green trace results from cells grown in the presence of 1 mM compound g, Phenotyping of the DAPRS/tRNAcu A pair. Cells containing the DAPRS/tRNAcu A pair and cat(ii2TAG) were plated in the presence or absence of 6 on the indicated concentrations of chloramphenicol h, Expression of sfGFP containing either 6 or BocK at position 150.
  • Figure 4 shows stably trapping acyl-enzyme intermediates with TEV(Ci5iDAP).
  • TEV(wt) results in cleavage of the TEV cleavage sequence.
  • TEV(Ci5iA) results in minimal cleavage.
  • DAP in the active site of TEV results in the presence of a new band in the coomassie gel, representing the isopeptide-linked TEV(Ci5iDAP)-Ub complex (left).
  • Tandem mass spectrometry of isopeptide-linked TEV(Ci5iDAP)-Ub complex unambiguously identifies the DAP modification at the desired site and the expected tev-Gly-Gly modification on the residue, consistent with Ub trapping on DAP.
  • Figure 5 shows small molecule products made by Vlm TE from tetradepsipeptidyl- SNAC delineate the oligomerization pathway.
  • tetradepsipeptidyl-SNAC 7 (1.7 mM) and Vlm TE (6.5 mM).
  • a TEwt produces valinomycin as its major product.
  • the presence of octadepsipeptidyl-SNAC 11, dodecadepsipeptidyl-SNAC 15 and 16-mer depsipeptidyl-SNAC 19 confirm the oligomerization scenario in Supplementary Figure 10b.
  • TEDAP produces a small amount of octadepsipeptidyl-SNAC 11.
  • the control reaction without enzyme shows a small amount tetradepsipeptide 9, likely from uncatalyzed hydrolysis of the thioester in solution. See Supplementary Table 2 for accurate mass analysis and deviations from calculated m/z values of each compound.
  • Figure 6 shows crystal structures of complexes of TEDAP .
  • TEwt 2mFo-DFc map contoured at 1.0 s).
  • b The structure of TEwt. The lid (grey) is nearly completely ordered but has higher B factors than the core of the protein.
  • d TEDAP incubated with deoxy-tetradepsipeptidyl-SNAC 8.
  • e TEDAP incubated with valinomycin.
  • f and g Unbiased mFo-DFc electron density map (green mesh, 2.5 s) for depsipeptide residues of tetradepsipeptidyl-TE DAP (f) and dodecadepsipeptidyl-TE DAP (g).
  • An amide bond links diaminopropionic acid (DAP, brown sticks) and depsipeptide residues (cyan sticks) h and i, The active site of tetradepsipeptidyl-TE DAP (h) and
  • dodecadepsipeptidyl-TE DAP (i) complexes.
  • the carbonyl oxygen of the amide formed by DAP and val4 (h) or vali2 (i) is positioned close to the oxyanion hole formed by the main chain amine of A2399 and L2464.
  • the catalytic triad residues H2625 and D2490 are shown in sticks j,
  • the lid of tetradepsipeptidyl-TE DAP is in a similar position to that seen in TEwt, while k, all crystallographically independent molecules of the
  • dodecadepsipeptidyl-TE DAP (from Pi and H3 space group structures) are in a set of similar conformations, distinct from that seen in TEwt. 1, An illustration of the substantial conformational change in lid helixes Lai-La4 between structures of tetradepsipeptidyl-TE DAP and dodecadepsipeptidyl-TE DAP .
  • the mobile helices are shown in colours of progressively higher wavelengths for clarity.
  • Figure 7 shows modelling of PCP domain interaction with the TE domain and putative pathway.
  • dodecadepsipeptide-TE DAP structures could help curl the dodecadepsipeptide back towards Ser2403 for cyclization.
  • Figure 8 shows supplementary figure 1.
  • Figure 9 shows supplementary figure 2.
  • Figure 10 shows supplementary figure 3.
  • Figure 11 shows supplementary figure 4.
  • Figure 12 shows supplementary figure 5.
  • Figure 13 shows supplementary figure 6.
  • Figure 14 shows supplementary figure 7.
  • Figure 15 shows supplementary figure 8.
  • Figure 16 shows supplementary figure 9.
  • Figure 17 shows supplementary figure 10.
  • Figure 18 shows supplementary figure 11.
  • Figure 19 shows supplementary figure 12.
  • Figure 20 shows supplementary figure 13.
  • Figure 21 shows supplementary figure 14.
  • Figure 22 shows supplementary figure 15.
  • Figure 23 shows photographs. Ubiquitination test with UBE2L3(C86DAP).
  • the complex formed between UBE2L3(C86DAP) and Ub is not sensitive to the presence of B- mercaptoethanol, unlike the complex between UBE2L3(wt) and Ub, with is reduced in the presence of B-mercaptoethanol
  • Example 2 Preferred unnatural amino acid comprising DAP
  • amino acid has a more favourable predicted logP value than amino acids 1-5, and we found that the addition of 1 mM 6 to cell media led to an intracellular concentration of approximately 2 mM (Figure 3f). Thus, in contrast to amino acids 2-5, amino acid
  • DAP tRNA synthetase (‘DAPRS’)
  • DAPRSlib a completely new library, in which positions to be randomised were carefully chosen based on a model of 6 in the active site of PylRS (Supplementary Figure 3 and Supplementary Table 1).
  • the selected synthetase contains four active-site mutations (Y271C, N311Q, Y349F and V366C) with respect to b PylRS.
  • the library contained randomised 5 positions but only 4 mutations are present in DAPRS - the 5th position is wild-type (i.e. W382) in DAPRS.)
  • Example 4 Incorporation of unnatural amino acid comprising DAP into a polypeptide.
  • sfGFP superfolder green fluorescent protein
  • TAG amber stop codon
  • Electrospray ionization mass spectrometiy confirms that the
  • Example 6 Stably trapping a cysteine protease acyl-enzyme intermediate
  • Cysteine proteases like the tobacco etch virus (TEV) protease commonly contain a Cys- His-Asp catalytic triad and generate a thioester intermediate upon treatment with their cognate substrates 5 ’ 3g .
  • TEV tobacco etch virus
  • E. coli provided with 0.1 mM 6 and expressing His6-Lipoyl-TEV(i5iTAG)-Strep, and the DAPRS/tRNA P l ajA pair were used to produce TEVc ySi5i6 protease, in which 6 replaces the catalytic cysteine in the active site.
  • the protein was purified by tandem affinity chromatography with a yield of ⁇ o.i mg per litre of culture, and ESI-MS confirmed the incorporation of 6 at the genetically encoded site. Photodeprotection quantitatively converted encoded 6 to the sulfhydryl intermediate, and approximately 70% of the protein was subsequently completely deprotected to reveal amino acid 1 at position 151 of TEV (TEVDAP), as judged by ESI-MS (Supplementary Figure 5).
  • the substitution of the catalytic cysteine in TEV with DAP enables the creation of a protease that goes through the first step of the protease cycle: nucleophilic attack on the substrate carbonyl to form the first tetrahedral intermediate. This intermediate collapses, releasing the C-terminal fragment of the substrate and leaving the N-terminal fragment of the substrate covalently attached to the protease, through a stable amide bond that is not subject to hydrolysis.
  • Example 7 Activity and synthetic pathway of Vim TE
  • Vlm TE TE wt , wild type protein
  • the native substrate of TE domains is the peptide intermediate linked by thioester to the phosphopantetheine-PCP (peptidyl-PCP).
  • the PCP-linked substrates can be mimicked by a small molecule in which the peptide intermediate is linked by a thioester to N-acetyl cysteine (peptidyl-SNAC).
  • peptidyl-SNAC N-acetyl cysteine
  • Vlm TE wt can use tetradepsipeptidyl-SNAC 7 to complete all stages of its catalytic cycle: oligomerization of the tetradepsipeptide intermediate to octadepsipeptide, oligomerization of octadepsipeptide to dodecadepsipeptide, and cyclization of dodecadepsipeptide to release valinomycin.
  • Vlm TE wt oligomerization pathway catalyzed by Vlm TE wt , differentiating between two possible pathways (Supplementary Figure 10) l8 40 .
  • Vlm TE wt could potentially oligomerize
  • Example 8 Visualizing key intermediates in TE domain-mediated valinomycin synthesis
  • Vlm TE adopts the a/b hydrolase fold typical of type I TE domains, with a canonical Ser-His-Asp catalytic triad of Ser2403, H1S2625 and ASP2490 42 covered by the TE“lid”.
  • the lid is a structural element known to be mobile, suggested to play roles in TE domain function which vary from substrate positioning to exclusion of solvent 27 43 44 . Although composition can vary substantially, a typical lid is composed of ⁇ 50 residues and ⁇ 2-4 helices.
  • the Vlm TE lid region is ⁇ 88 residues ⁇ 2494-2582), and is composed of an extended loop, three helices (Lai-3) which are seen here as a bundle, a short, 5-residue helix (La4), a long helix (Las) and another short helix (La6) (Figure 6b).
  • Lai-3 three helices
  • La4 5-residue helix
  • Las long helix
  • La6 another short helix
  • valinomycin rapidly hydrolyse, and thus, as expected, it will be exceptionally challenging to use wild type Vlm TE to visualize biosynthetic intermediates through crystallography.
  • Vlm TE in which the active site serine 2463 was replaced by DAP (TEDAP).
  • TEDAP DAP-derived neuropeptide
  • Expression of Vlm2TE(2463TAG) in E. coli containing a DAPRS/tRNAcu A pair and supplemented with o.imM 6 enabled the purification of Vlm TE in which serine 2463 is replaced by 6, with a yield of ⁇ o.i-o.5 mg per litre of culture. Deprotection of 6 led to quantitative production of TEDAP ( Figure 6c and Supplementary Figure 13).
  • the octadepsipeptidyl-SNAC 11 is likely formed by TE DAP -catalyzed attack of the hydroxyl group of the tetradepsipeptidyl-SNAC 7 on tet rad ep s i pepti dyl -N-TE DA P, indicating that TEDAP has the power to successfully catalyze the attack of a hydroxyl on an amide. This reaction is evidently much slower than the more isoenergetic ester-for-ester reaction, as only a small amount of octadepsipeptidyl-SNAC 11 was formed.
  • each depsipeptide makes different contacts with the lid.
  • the lid forms a semi-sphere-like pocket / steric barrier made up of helices Lai, 3, 4 and 5, and the strand N-terminal to Lai. The lid of each
  • Animation 1, 2 This dramatic re-arrangement means the lid helices of Vlm TE pack together in a markedly different manner in the apo/tetradepsipeptidyl-bound structure and in dodecadepsipeptidyl-bound conformations.
  • the loop adjacent to Lai blocks the location occupied by the tetradepsipeptide in the tetradepsipeptide-bound structure.
  • the N-terminus of Lai forms part of the semi- sphere-like pocket, which likely helps curl the dodecadepsipeptide back towards Ser/DAP2403 during the cyclization step.
  • the models and structure factors for the crystal structures are deposited in at the Protein Data Bank with accession numbers 6ECB, 6ECC, 6ECD, 6ECE and 6ECF.
  • Boc-Dap(Alloc)-OH 2a (4.325 g, 15.0 mmol, 1.0 eq., procured from Bachem Ltd.) was loaded onto a dry 250 mL single-necked round-bottomed flask and dissolved in HC1 (4M in 1,4-dioxane, 60.0 mL, 240.0 mmol, 16.0 eq.). Dry Et 3 SiH (10.0 mL, 62.6075 mmol, 4.174 eq.) was added to the solution at r.t. and a faint white precipitate appeared immediately, which intensified with time upon stirring at r.t. under a nitrogen atmosphere.
  • Boc-L-Dap-OBu-HCl lb (5.0 g, 19.206 mmol, 1.0 eq.) was loaded into a dry 500 mL 2- neck round-bottomed flask and dry THF (75 mL) was added to it, followed by dry DIPEA (6.69 mL, 38.412 mmol, 2.0 eq.). The contents were left stirring under an argon atmosphere at o°C.
  • 2-nitrobenzyl bromide (4.979 g, 23.048 mmol, 1.2 eq.) was loaded on to a separate 250 mL dry single-neck round bottomed flask, dissolved in dry THF (125 mL), and the resulting solution then transferred to the main flask containing Boc- L-Dap-CkBu by cannula under a positive pressure of argon over 5 min at o°C. The mixture was then warmed to r.t. and left stirring at r.t. for 10 h. The reaction mixture was then concentrated under reduced pressure and the crude mixture extracted with EtOAc (200 mL) and washed with brine solution (3 x 250 mL).
  • 4',5’-Methylenedioxy-2'-nitroacetophenone 4b (43.714 g, 0.209 mol, 1.0 eq.) was suspended in CH 2 Cl 2 (400 mL), CH 3 OH (650 mL) and absolute CH 3 CH 2 OH (425 mL) in a 2 litre, single-necked, round-bottomed flask. The mixture was sonicated for 10 min at r.t. to dissolve the majority of the yellow solid.
  • reaction mixture was evaporated to dryness under reduced pressure using a rotary evaporator.
  • the resulting yellow gum was dissolved in CH 2 Cl 2 (300 mL) and saturated aq. NaHC0 3 solution (300 mL).
  • the contents were loaded into a separating funnel, the aqueous phase was discarded and the organic phase was washed sequentially with further saturated aq. NaHC0 3 solution (1 x 300 mL) and saturated aq. NaCl solution (3 x 300 mL).
  • the organic layer was separated, dried over anhydrous Na 2 S0 4 , filtered and evaporated to dryness to obtain a yellow solid.
  • the crude product was purified by flash chromatography on Si0 2 [eluent: CH 2 Cl 2 /n-hexane (1:1), then ioo%CH 2 Cl 2 ] to obtain a pure sample of (i?,S , )-i-bromo-i-[4',5'-(methylenedioxy)-2'-nitrophenyl]ethane 32 4d (18.330 g, 89%) as shining yellow crystals.
  • Boc-L-Dap-OBu-HCl lb (6.233 g, 21.0 mmol, 1.1 eq.) was suspended in dry THF (275 mL) in a dry 1 litre 3-neck round-bottomed flask and dry DIPEA (9.98 mL, 57.273 mmol, 3.0 eq.) was added. The contents were stirred for 10 min at r.t. under a nitrogen atmosphere. The flask was wrapped with aluminium foil and the contents were kept in the dark.
  • (2S)-2- Amino-3- ⁇ [i-(6-nitrobenzo[d][i,3]dioxol-5-yl)ethyl]amino ⁇ propanoic acid 4 was obtained as a free-flowing pale yellow powder (3.646 g, 73%).
  • the product is a salt of CF 3 COOH and a ⁇ i:i mixture of epimers.
  • Boc-L-Dap-OH la (2.553 g, 12.5 mmol, 1.25 eq.) was suspended in dry THF (180 mL) and dry CH 3 CN (20 mL) in a dry 1 litre single-necked round-bottomed flask wrapped with aluminium foil to exclude light. Dry DIPEA (5.23 mL, 30.0 mmol, 3.0 eq.) was added to the mixture and the contents were stirred for 20 min at r.t.
  • a freshly prepared solution of NaOH (0.5 M, 8 g in 40 mL of deionized H 2 0, 20.0 mmol, 1 eq.) was loaded onto a 500 mL round 3-necked round-bottomed flask and the solution was degassed by bubbling through a stream of argon gas at r.t. After 30 min, mercaptoethanol (1.47 mL, 21.0 mmol, 1.05 eq.) was added to the flask and degassing was continued for a further 15 min.
  • Boc-L-Dap-OH (13.479 g , 66.0 mmol, 1.082 eq.) was added in one portion to a solution of 6b (26.70 g, prepared as described above) in dry CH 3 CN (305 mL) under argon and stirred for 12 h at r.t. After this time the reaction was judged to be complete by LC-MS (C18 reverse phase column, H 2 0-CH 3 CN as mobile phase) and the contents were adsorbed on to Biotage® Isolute HM-N sorbent and dried under reduced pressure.
  • the reaction mixture was concentrated under reduced pressure in the dark to obtain a yellow-brown gum. This was dissolved in anhydrous CH 3 OH (20 mL) and evaporated to dryness under reduced pressure; this was repeated three times and dried in high vacuum ( ⁇ 0.1 mbar) to remove any residual CF 3 COOH, Et 3 SiH and H 2 0. The yellow-brown gum was then dissolved in dry CH 3 OH (40 mL) and transferred to a dry 2 L round-bottomed flask under an argon atmosphere and cooled to o°C. Dry Et 2 0 (2 L) was added to the solution via cannula under a positive pressure of argon gas in the dark and the contents were vigorously stirred.
  • the dry sample of DAP amino acid 6-TFA was stored in air-tight dark glass vials in a cold, dry and dark environment and was stable for over 3 years without decomposition.
  • DAP amino acid 6-TFA is light sensitive and slightly hygroscopic upon exposure to moist air, hence the sample of it in a vial was always handled in a dark and dry atmosphere. It is noteworthy that the vial containing 6-TFA taken out from the fridge or freezer was always allowed to warm to r.t. prior to opening and handling.
  • the yellow-brown gum was dissolved in dry CH 3 OH (40 mL), transferred to a dry 3 L round-bottomed flask under an argon atmosphere and cooled to o °C. Dry Et 2 0 (2.5 L) was added to the flask via cannula under a positive pressure of argon gas while the contents were vigorously stirred. A pale yellow precipitate was formed and the contents stirred vigorously at o°C for 15 min and then at r.t. for 2 h.
  • Boc-L-Valine (7.29 g, 33.56 mmol, 1.0 equiv.) was dissolved in CH 2 Cl 2 .
  • Acetyl - cysteamine (4.00 g, 33.56 mmol, 1.0 equiv.).
  • ethyl L-lactate (5.08 g, 43.0 mmol, 1.0 equiv.) was dissolved in CH 2 Cl 2 (55 mL) and the solution was cooled to o°C using an ice bath tert- Butyldimethylsilyl chloride (6.48 g, 45.15 mmol, 1.05 equiv.) and imidazole (3.51 g, 51.6 mmol, 1.2 equiv.) was added to this mixture, after which the reaction was allowed to proceed at ambient temperature for 2 h. The reaction mixture was then diluted with H 2 0 and extracted 3 x with CH 2 Cl 2 .
  • the reaction was quenched with NH 4 Cl(aq), extracted 3 x with CH 2 CI 2 , washed with NaHC0 3 (aq), then with brine, dried over Na 2 S0 4 , and concentrated.
  • the title compound (350 mg, 94 % over 2 steps) was purified by silica column chromatography (40 % acetone in hexanes).
  • D-valine methyl ester hydrochloride 250 mg, 1.5 mmol, 1.0 equiv.
  • CH 2 Cl 2 15 mL
  • Isovaleric acid 230 mg, 2.25 mmol, 1.5 equiv.
  • EDC 430 mg, 2.25 mmol, 1.5 equiv.
  • DMAP 276 mg, 2.25 mmol, 1.5 equiv.
  • Et 3 N 420 pL, 3.00 mmol, 2.0 equiv.
  • DAP system allows use of both widely- used, reaction competent, substrates (e.g. native proteins containing protease sites), substrate analogues (in this case SNACs), and commercially available natural products (here valinomycin, and likely other cyclic products 28 ) to form near-native acyl-enzyme complexes.
  • substrates e.g. native proteins containing protease sites
  • substrate analogues in this case SNACs
  • commercially available natural products here valinomycin, and likely other cyclic products 28
  • the PCP domain a key player in the TE domain catalytic cycle, is absent from these structures, but its binding site can be inferred from the informative dead-end inhibitor trapped PCP-TE structure of EntF 46 ( Figure 7).
  • the PCP domain docks at aE of the TE, and the PPE extends the -15 A to position the thiol near Ser/DAP2463 ( Figure 7a, c-iii).
  • the position of the PPE in the EntF structure is compatible with the
  • Ser/DAP2463 for the oligomerization step. To do so, another -15 A of length of tetradepsipeptide (between terminal hydroxyl and PPE sulphur) must be
  • the lid conformation and the semi-sphere-like pocket seen in the structures of dodecadepsipeptide-TE DAP are likely to be very important during the cyclization step in the thioesterase cycle.
  • This pocket is mainly made up of hydrophobic residues, and it provides a steric barrier that prevents a dodecadepsipeptide attached to Ser/DAP2403 from extending out in a linear fashion ( Figure 7b). Rather, this lid conformation favours curling back of the substrate’s free end towards the acyl linkage between TE and the substrate.
  • cyclization of the dodecadepsipeptide to valinomycin may be thought of as entropically controlled by the pocket, with the dodecapeptide
  • a novel inhibitor to a Mycobacterium tuberculosis polyketide synthase TE domain binds between the cluster of lid helices 48 . It is proposed to compete with substrate binding, but such an inhibitor could also act by preventing structural rearrangements in the lid similar to those we observe here.
  • DAP5 deprotection of DAP5 occurs in two distinct steps. First, the photocaging group is removed under the action of UV-light, leading to a semi-deprotected intermediate. A second intramolecular reaction finally results in the completely deprotected DAP. After the purification of UBE2L3(C86DAP5), it was found that most of the protein contained the semi-deprotected intermediate (UBE2L3IO86INT]), although some of it was present in the complete photocaged form. After UV light irradiation, the protein mass was assessed again by LC-ESI-MS:
  • UBE2L3(C86DAP5)-Strep could not be detected anymore after UV light irradiation. Indeed, only UBE2L3(C86INT)-Strep could be detected.
  • the protein was subsequently incubated at 37°C for 3 h and its mass assessed by LC-ESI-MS. As expected, UBE2L3(C86DAP)-Strep was detected together with UBE2L3(C86INT)- Strep.
  • Tandem mass spectrometry unambiguously identifies the DAP modification at the desired site and the expected Gly-Gly modification on the residue which is consistent with Ub loading on DAP.
  • TEV-GFP WB data provided in Figures 24 and 25.
  • FIG. 24 shows Dap-mediated substrate trapping in live E.coli cells.
  • GFPs GFP bearing a TEV cleavage site at C-terminus
  • WT/Ala/TAG C-terminal Strep-tagged TEV protease
  • WT/Ala/TAG with or without Dappc; (in this example compound‘DAP5’ is referred to as‘Dappc’)
  • WT/Ala/TAG with or without Dappc; (in this example compound‘DAP5’ is referred to as‘Dappc’)
  • Equal volumes of cells were collected at the indicated time points and analysed by western blot (anti-Strep for TEV and anti-GFP). OnlyTEV(Dap) showed UV dependent generation of TEV-GFP conjugate. The conjugate can be detected within 10 min after UV irradiation and the reaction went to completion within 2 h inside E.coli BL21 cells.
  • FIG. 25 shows Dap-mediated substrate trapping in mammalian HEK293T cells.
  • GFPs GFP bearing a TEV cleavage site at C-terminus
  • WT/Ala/TAG C-terminal Strep-tagged TEV protease
  • WT/Ala/TAG C-terminal Strep-tagged TEV protease
  • TEV(Dap) showed UV dependent generation of TEV-GFP conjugate.
  • the conjugate started to form within 30 min after UV irradiation and enriched with increasing incubation time in HEK293T cells.
  • BL21 (DE3) cells co-transformed with GFPs containing plasmid and TEV containing plasmid were induced to express proteins at 20 °C.
  • 0.1 mM Dappc (DAP5) was added to media to incorporated Dappc (DAP5).
  • DAP5 Dappc
  • HEK293T Cells were co-transfected with GFPs containing plasmid, TEV containing plasmid. 1 mM Dappc (DAP5) was added 30 min after transfection for amber suppression. 48 h after transfection, cells in 6-well plate were irradiated by UV light (365 nm, 10 mW/cm 2 ) for 2 min. Then, the media was replaced with fresh media and incubated at 37 °C. At each indicated time point, cells were collected and lysed in NP lysis buffer (Cat. No. 87787, Thermo). The total lysate was used for StrepTactinXT pulldown. Elutes from beads were analyzed by WB (anti-Strep (ab70949, abeam) and anti-GFP (abi3970, abeam)).
  • Vlm2_TE_Amb_Rev atatggccacccagCTAgtgaccaccgatatacac
  • the library (DAPRSlib) for amino acid 6 was generated by five consecutive rounds of inverse PCR reactions using the PrimeSTAR HS DNA
  • MfiPylRS libraries in pBK vectors were subjected to five rounds of alternating positive and negative selection. The positive selections were performed in the presence of the desired ncAA (1 mM) using a chloramphenicol acetyl transferase reporter with an amber codon at a permissive position (codon 112) and expressing the cognate tRNA.
  • Cells that survived the positive selection on chloramphenicol (typically 50 ig/mL) LB agar are predicted to use either a natural amino acid that is constitutively present in the cell or the ncAA added to the cell.
  • the negative selection used a barnase reporter containing amber codons and providing the cognate tRNA, in the absence of ncAA, to remove synthetase variants that use natural amino acids.
  • Superfolder green fluorescent protein with 6 incorporated at position 150 was expressed from pSF-sfGFPtsoTAG in MegaX DH10B TtR cells containing pBK_DAPRS or pBK_PylRS vector.
  • LB broth supplemented with 12.5 pg/mL tetracycline, 25 pg/mL kanamycin and 1 mM of 6 or iV e -ferf-butyloxycarbonyl-lysine (BocK) was inoculated with the transformed cells.
  • Expression was induced with 0.2% (w/v) L-(+)-arabinose (Sigma) for 16 h at 37°C whilst shaking at 220 rpm. Bacteria were then harvested and the protein purified by polyhistidine affinity chromatography.
  • BL21 (DE3) cells were transformed with pNHD-His6-lipoyl-TEVu,t-Strep ; pNHD-His6-lipoyl- TEVx /a -Strep (gene is a gift from Mark Allen) 4 or co-transformed with pSF-DAPRS-PylT-r pNHD-His6-lipoyl-TE ⁇ G m/K-r -Strep and grown on TB-agar plates containing 25 pg/mL tetracycline and (and 50 pg/mL kanamycin for co-transformed cells) overnight at 37° C (TB media containing 25 pg/mL tetracycline (and 50 pg/mL kanamycin for co-transformed cells) was inoculated with some transformed colonies.
  • the cultures were diluted 1:100 into TB media containing 12.5 pg/mL tetracycline (and 25 pg/mL kanamycin and 100 pM of 6 for co transformed cells) and incubated at 37°C; once the OD6 00 reached 0.5-0.7, the cultures were moved to 20 a C. After 30 min of further incubation, the cultures were induced using 250 pM isopropyl b-D-i-thiogalactopyranoside (IPTG) and protein expression was carried out at 20°C for 16 h.
  • IPTG isopropyl b-D-i-thiogalactopyranoside
  • Cells were harvested by centrifugation and resuspended in 50 mM tris-HCl pH 7.5, 150 mM NaCl, 2 mM b-Mercaptoethanol, 1 Roche Inhibitor Cocktail tablet / 50 mL, 0.5 mg/mL lysozyme (Sigma), 50 pg/mL DNase (Sigma) and lysed by sonication.
  • the lysate was clarified by centrifugation at 39’ooo c g for 30 min and filtered through a 0.4 pm polyethersulfone (PES) membrane.
  • PES polyethersulfone
  • His6-lipoyl-TEV-Strep was purified using nickel affinity chromatography (HisTrap HP column, GE Healthcare) with a linear gradient of imidazole (o mM to 500 mM). Fractions containing the protein were further purified by Strep-tag affinity purification using a 5 mL StrepTrap HP column (GE Healthcare). After sample loading, the column was washed with strep binding buffer (50 mM 4-(2-hydroxyethyl)-i-piperazineethanesulfonic acid [HEPES] pH 8.0, 150 mM NaCl, 1 mM ethylenediaminetetraacetic acid [EDTA], 5 mM dithiothreitol [DTT]).
  • strep binding buffer 50 mM 4-(2-hydroxyethyl)-i-piperazineethanesulfonic acid [HEPES] pH 8.0, 150 mM NaCl, 1 mM ethylenediaminet
  • the protein was eluted using a linear gradient of desthiobiotin (o mM to 1.25 mM).
  • desthiobiotin o mM to 1.25 mM.
  • the protein was irradiated with UV light (365 nm, 35 mWcrir 2 , 1 min) at the end of the purification.
  • BL21 (DE3) cells were transformed with pNHD-Ub-tev-His6 and grown on LB-agar plates containing 25 pg/mL tetracycline overnight at 37° C.
  • LB media containing 25 pg/mL tetracycline was inoculated with the some colonies resulting from the transformation.
  • the culture was diluted 1:100 into fresh LB media containing 12.5 pg/mL tetracycline; once the OD6 00 reached 0.5, the cultures were induced using 1 mM IPTG and protein expression was carried out at 37°C for 6 h.
  • Cells were harvested by centrifugation and resuspended 50 mM tris-HCl pH 7.5, 150 mM NaCl, 2 mM b-Mercaptoethanol, 1 Roche Inhibitor Cocktail tablet / 50 mL, 0.5 mg/mL lysozyme (Sigma), 50 pg/mL DNase (Sigma) and lysed by sonication.
  • the lysate was clarified by centrifugation at 39’ooo c g for 30 min and filtration through a 0.4 pm PES membrane.
  • Ub was purified using nickel affinity chromatography (HisTrap HP column, GE Healthcare) with a linear gradient of imidazole (30 mM to 500 mM).
  • the protein was dialysed overnight against 10 mM tris-HCl at 4°C and Ub was further purified by ion exchange chromatography (HiTrapS 5mL column, GE Healthcare) using a NaCl gradient (0-1 M mM) in 50 mM ammonium acetate, pH 4.5. Pure fractions were pooled before overnight dialysis against 20 mM tris-HCl pH 7.4. The sample was then concentrated to -15 mg/mL using an Amicon Ultra- 15 (3 kDa MWCO) centrifugal filter device (Millipore).
  • Protein was transferred on a polyvinylidene fluoride (PVSF) membrane (Roche) using 25 mM Tris pH 8.2, 192 mM glycine, 10% (v/v) methanol. Membranes were subsequently blocked for lh in TBST buffer (25 mM Tris pH pH 7.4, 150 mM NaCl, 0.05% [v/v] Tween 20) containing 5% (w/v) milk powder at room temperature.
  • Antibodies Strep-Tactin-HRP conjugate (a Strep) [IBA Lifesciences] or P4D1 antibody (a Ub) [Enzo Life Sciences] were added in 5% TBST-Milk and incubated at 4°C overnight.
  • DAP derivatives were added to a 5 mL solution of LB media to a final concentration of 1 mM.
  • a control sample was also prepared with 5 mL of unsupplemented LB media.
  • Each solution was inoculated with DH10B cells. The cultures were agitated at 220 rpm in the dark at 37°C for 12 h. The ODc,oo of each sample was determined, and the cells from each culture were harvested. The cell pellets were washed three times with 1 mL of fresh ice-cold LB media by cycles of resuspension and centrifugation.
  • the washed cell pellets were resuspended in a methanol: water solution (60:40). Zirconium beads (0.1 mm) were added to each suspension. The suspensions were vortexed for 12 min to lyse the cells. The lysate was centrifuged at 21000 x g for 30 min at 4°C. The supernatant was carefully removed, and placed into a fresh 1.5 mL Eppendorf tube. The solutions were centrifuged again at 21000 x g for 2 h at 4°C. A 100 m ⁇ aliquot of the supernatant from the resulting sample was analyzed by LC-ESI-MS.
  • a gradient of 0.5% to 95% acetonitrile in water was applied to elute the clarified lysates from a Zorbax C18 (4.6 x 150 mm) column.
  • the concentrations were estimated using an estimate of 8 x 10 8 cells per 1 O ⁇ boo unit and a cell volume of 0.6 x io ⁇ L.
  • a codon-optimized construct containing vlm2pcP 4 -TE ⁇ ncoding residues 2290-2655 of Vlm2 from Streptomyces tsusimaensis, GenBank: ABA59548.1) was synthesized by ATUM (formerly DNA 2.0) in a pJExpress4ii vector, with an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage recognition sequence ( pJExpress4ii-vlm2-PCP4-TE wt ).
  • the TEwt coding sequence was PCR-amplified from pJExpress4ii- vlm2-TEwt with primers TE_for_pNHD_fw and TE_for_pNHD_rev.
  • the PCR product was digested with Ndel and Xhol and ligated into similarly digested pNHD plasmid using T4 DNA ligase, generating plasmid pNHD-vlm2-TE w u
  • an amber stop codon was introduced in place of the codon for serine 2463 by site-directed mutagenesis using primers Vlm2_TE_Amb_Fw and Vlm2_TE_Amb_Rev, generating pNHD-vlm2-TE amber2 463 .
  • TE domains were heterologously expressed in E.
  • Cultures expressing TEwt were grown in LB media supplemented with 17 mg L 1 of kanamycin.
  • Those expressing TEDAP were grown in TB media supplemented with 25 mg L 1 of kanamycin, 12.5 mg L 1 of tetracycline, 0.1 mM of 6 (a too mM stock solution of 6 was prepared in 0.4 M NaOH, added to the culture and neutralised using 5 M HC1).
  • cell pellets of TEwt were resuspended in 5 mL of buffer wt-A (50 mM TRIS pH 7.4, 150 mM NaCl, 50 mM imidazole, 2 mM b-mercaptoethanol [bME]) plus DNAsel (Bioshop) per g of wet cells, and lysed by sonication. Lysate was clarified by centrifugation at 40 000 g for 20 min. Clarified lysate was applied to two 5 mL HiTrap IMAC FF (GE Healthcare Life Sciences) columns connected in series on an AKTA Prime system (GE Healthcare Life Sciences).
  • buffer wt-A 50 mM TRIS pH 7.4, 150 mM NaCl, 50 mM imidazole, 2 mM b-mercaptoethanol [bME]
  • DNAsel Bioshop
  • Bound protein was eluted with buffer wt-B (buffer wt-A plus 150 mM imidazole). Fractions containing TEwt (as determined by SDS-PAGE analysis) were pooled and incubated with TEV protease in a 1:100 (Te:TEV) mass/mass ratio and dialyzed against buffer wt-C (50 mM TRIS pH 7.4, 10 mM NaCl, 2 mM bME) for 16 hours at 4°C. The dialyzed sample was applied to two 5 mL HiTrap IMAC FF columns connected in series, pre-equilibrated in buffer wt-A.
  • buffer wt-B buffer wt-A plus 150 mM imidazole.
  • Cleaved protein was recovered from the flow through and applied to two 5 mL HiTrap Q HP columns connected in series, pre-equilibrated in buffer Q-A (50 mM TRIS pH 7.4, 10 mM NaCl, 2 mM bME). Protein was eluted by a gradient of o to 100% buffer Q-B (50 mM TRIS pH 7.4, 500 mM NaCl, 2 mM bME) over 240 mL.
  • buffer Q-A 50 mM TRIS pH 7.4, 10 mM NaCl, 2 mM bME
  • TEwt-containing fractions were concentrated in a 10 kDa molecular weight cut off Amicon® Ultra centrifugal filter (Millipore) and injected onto a Superdex S-200 16/60 PG column (GE-Healthcare) pre-equilibrated in SEC buffer (25 mM HEPES pH 7.4 or pH 8.0, 100 mM NaCl, 0.2 mM tris(2-carboxyethyl)phosphine [TCEP]). Fractions containing purified TEwt were pooled, concentrated and flash frozen.
  • SEC buffer 25 mM HEPES pH 7.4 or pH 8.0, 100 mM NaCl, 0.2 mM tris(2-carboxyethyl)phosphine [TCEP]
  • Crystallization conditions for TEwt structure 1 were found in vapour diffusion crystallization trials using commercially available screens (Qiagen) and a protein concentration of 10 mg mL 1 . Optimization of an initial crystallization hit in 24-well plates led to a final crystallization condition where 3.2 pL of 10 mg mL ⁇ 1 TEwt, 4.0 pL 1.65 M DL-malic acid pH 9.5, and 0.8 pL of 17 % m/v IPTG were incubated against a reservoir solution of 500 pL of 1.65 M DL-malic acid pH 9.5.
  • TEwt structure 2 crystals were grown in similar conditions, where 0.5 pL of purified TEwt at 22.4 mg mL ⁇ 1 and 0.5 pL of 1.65 M DL-malic acid pH 8.1 were incubated against a reservoir solution of 500 pL of DL-malic acid pH 8.1. Crystals appeared between 24 and 48 hours and reached their maximum size in approximately one week. Crystals of unliganded TEDAP were grown in similar conditions to TEwt, with a reservoir solution of 1.65 M DL-malic acid pH 8.0. In order to obtain the tetradepsipeptidyl-TEDAP complex structure, TEDAP crystals were incubated with deoxytetradepsipeptidyl-SNAC 8 once they achieved their maximum size.
  • the reservoir solution was exchanged to 2.66 M DL-malic acid, pH 9.5, and 32 pL of a solution of 1 mM deoxytetradepsipeptidyl-SNAC, 2.66 M DL-malic acid pH 9.5, 100 mM NaCl, 25 mM HEPES pH 9.2, 10% DMSO was added to the drop. Crystals were incubated in this condition for 9 days at room temperature.
  • TEDAP 0.1 mg mL 1
  • a 1.1 mg mL ⁇ 1 suspension of valinomycin in buffer T for 16 hours at room temperature.
  • the sample was centrifuged at 20 000 g and applied to a Superdex S-75 10/300 column preequilibrated in buffer T to remove excess valinomycin.
  • Relevant fractions were pooled and complex formation was evaluated by LC-ESI-MS (see below).
  • the sample was concentrated to 13.4 mg mL ⁇ 1 and diffraction-quality crystals, with a different morphology from the TEwt crystals, were obtained in sitting drops consisting of 1 pL of dodecadepsipeptidyl-TEDAP complex plus 1 pL reservoir solution (1.30 to 1.45 M DL-malic acid pH 8.1) equilibrated against 500 pL reservoir solution.
  • TEwt and dodecadepsipeptidyl-TEDAP crystals were cryo-protected by addition of 10 pL (TEwt structure 1 and dodecadepsipeptidyl-TEDAp) or 20 pL (TEwt structure 2) 3.6 M DL-malic acid pH 8.1 to the crystallization drop.
  • TEwt structure 1 and dodecadepsipeptidyl-TEDAp 10 pL
  • TEwt structure 2 20 pL
  • TEwt structure 2 3.6 M DL-malic acid pH 8.1
  • the drop solution was removed and replaced by 10 pL of 3.6 M DL-malic acid. Crystals were equilibrated for at least two minutes and then flash cooled in liquid nitrogen. Tetradepsipeptidyl-TEDAP complex crystals were looped and flash cooled directly from the incubating solution.
  • TEwt data were first collected at the Centre for Structural Biology at McGill University, Montreal, Canada, on a Rigaku RUH3R generator and a R-AXIS IV++ detector. Higher resolution data for TEwt and depsipeptidyl-TEDAP complexes were collected at the Canadian Light Source (CLS) 08ID-1 beamline or at the Advanced Photon Source (APS) NE- CAT 24-ID-C beamline using a Pilatus detector (Extended Data Table 1).
  • CLS Canadian Light Source
  • APS Advanced Photon Source
  • NE- CAT 24-ID-C beamline using a Pilatus detector
  • Diffraction data from TEwt structure 1 crystals were indexed and integrated in the space group P432 using iMosflm 47 or DIALS 48. Further space group determination and scaling were performed using the programs POINTLESS and SCALA 49.
  • the structure was solved by molecular replacement using PHASER 20 , with a SCULPTOR 31 modified version of the TE domain of srfA-C (PDB ID 2VSQ) 22 as a search model.
  • the structure was iteratively refined and built with the programs Phenix 53 and AUTOBUILD 54. Coot 22 was used for iterative model building.
  • Topology diagrams were generated using TopDraw 56 based on results from PDBsum generate fhttp:,'7www ⁇ ebi.ac-iik/thornton-srv/databases/pdbsiim/ Generate, html) using the TE wt structure as input.
  • TEDAP or TEwt at a final concentration of 0.2 mg mL 1 was incubated with tetradepsipeptidyl- SNAC 7 (1.7 mM), or valinomycin (50 mM) in buffer T containing 1.7% or 1% v/v DMSO for 16 hours. Reactions were concentrated in a 10 kDa molecular weight cut off Amicon® Ultra centrifugal filter (Millipore), clarified by centrifugation at 20 000 g and applied to a Superdex S- 75 10/300 column pre-equilibrated in buffer T to remove excess depsipeptidyl-SNACs or valinomycin before final LC-ESI-MS analysis.
  • TEDAP To form the deoxytetradepsipeptidyl-TEDAP complex, TEDAP at a final concentration of 8.7 mg mL ⁇ 1 was incubated with deoxytetradepsipeptidyl-SNAC 8 (2.6 mM) in 25 mM HEPES pH 8.6, 100 mM NaCl, 3.8% v/v DMSO for 40 hours. The sample was diluted in 100 mM ammonium bicarbonate pH 8.0 before final LC-ESI-MS analysis. All incubations were performed at room temperature.
  • MS data was collected with ExtremeScan mass range mode in positive ion polarity, scan range from 50 to 3000 m/z, accumulation time of 1586 ps, RF level of 96%, trap drive 69.8, PSP target Mass 922 m/z, and averaging over 5 spectra.
  • External instrument calibration was performed using the Agilent ESI tune mix.
  • the column compartment temperature was set up at 8o°C throughout the run. After injection, the column was washed for 5 minutes in initial HPLC conditions with the sample compartment diversion valve in the waste position. Next, a 5-minute gradient from 5% to 100% mobile phase B was performed, followed by an isocratic step of 100% mobile phase B for 8 minutes. Proteins were detected by monitoring UV absorbance at 280 nm. Data was analyzed using the Bruker DataAnalysis software (Bruker). Mass spectra were integrated from 10.5 to 13 minutes, and deconvoluted using a window between 10 000 to 40 000 m/z.
  • Proteins were run on 4-12% NuPAGE Bis-Tris gel (Invitrogen) with MES buffer and briefly stained using InstantBlue (Expedeon). The bands were excised and stored in 20 mM Tris pH 7.4. Tryptic digestion and tandem MS/MS analyses were performed by Kate Heesom (Proteomics Facility, University of Bristol).
  • LC-ESI-MS analysis of Vim TE reaction products Purified TEwt or TEDAP at 0.2 mg mL 1 (6.5 mM) was incubated with tetradepsipeptidyl-SNAC 7 (1.7 mM), or a mix of tetradepsipeptidyl-SNAC 7 and deoxytetradepsipeptidyl-SNAC 8 (1.7 mM each) in buffer T. Samples were incubated at room temperature for 24 hours, and then quenched with one volume of 0.1% formic acid in acetonitrile. Next, samples were centrifuged at 20,000 g, flash frozen in liquid nitrogen and stored at -80 °C before HPLC analysis.
  • the column compartment was set up at 40°C throughout the runs.
  • Starting HPLC conditions were 50% mobile phase A (0.1% formic acid in H 2 0), 50% mobile phase B (0.1% formic acid in acetonitrile).
  • After injection (lpL for HR-LC-ESI-MS and 5 pL for ion-trap LC-ESI-MS), a gradient from 50% to 98% mobile phase B in 5 minutes was performed, followed by an isocratic step of 98% mobile phase B, run for 20 minutes.
  • HR-LC-ESI-MS internal calibration was performed with an intra-run infusion at the beginning of the first analysis using Na + formate, and the resulting calibration was used as an external calibration for subsequent analysis.
  • Ion trap external calibration was performed using the Agilent ESI tune mix. Data was analyzed using the Bruker DataAnalysis software and the SmartFormula tool (Bruker).
  • Bacillus subtilis encodes the biosynthetic template for the catecholic siderophore 2,3- dihydroxybenzoate-glycine-threonine trimeric ester bacillibactin. J Biol Chem 276, 7209-7217 (2001).
  • AceDRG a stereochemical description generator for ligands.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/GB2019/053023 2018-10-26 2019-10-24 Methods and compositions Ceased WO2020084307A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CN201980086289.4A CN113226375B (zh) 2018-10-26 2019-10-24 方法和组合物
US17/288,798 US12286657B2 (en) 2018-10-26 2019-10-24 Methods and compositions
JP2021521504A JP7633156B2 (ja) 2018-10-26 2019-10-24 方法及び組成物
AU2019369192A AU2019369192B2 (en) 2018-10-26 2019-10-24 Methods and compositions
EP19806312.5A EP3870224A1 (en) 2018-10-26 2019-10-24 Methods and compositions
CN202510576255.0A CN120607506A (zh) 2018-10-26 2019-10-24 方法和组合物
CA3116567A CA3116567A1 (en) 2018-10-26 2019-10-24 Methods and compositions
JP2024186312A JP2025023942A (ja) 2018-10-26 2024-10-23 方法及び組成物
US19/086,998 US20250283066A1 (en) 2018-10-26 2025-03-21 Methods and compositions
AU2025205622A AU2025205622A1 (en) 2018-10-26 2025-07-18 Methods and Compositions

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1817444.1 2018-10-26
GBGB1817444.1A GB201817444D0 (en) 2018-10-26 2018-10-26 Methods and compositions

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/288,798 A-371-Of-International US12286657B2 (en) 2018-10-26 2019-10-24 Methods and compositions
US19/086,998 Division US20250283066A1 (en) 2018-10-26 2025-03-21 Methods and compositions

Publications (1)

Publication Number Publication Date
WO2020084307A1 true WO2020084307A1 (en) 2020-04-30

Family

ID=64560429

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2019/053023 Ceased WO2020084307A1 (en) 2018-10-26 2019-10-24 Methods and compositions

Country Status (8)

Country Link
US (2) US12286657B2 (https=)
EP (1) EP3870224A1 (https=)
JP (2) JP7633156B2 (https=)
CN (2) CN120607506A (https=)
AU (2) AU2019369192B2 (https=)
CA (1) CA3116567A1 (https=)
GB (1) GB201817444D0 (https=)
WO (1) WO2020084307A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732001B2 (en) 2012-05-18 2023-08-22 United Kingdom Research And Innovation Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase
EP4328308A1 (en) * 2022-08-22 2024-02-28 Technische Universität Berlin Modified trna-synthetase for the incorporation of non-canonical amino acids
US12286657B2 (en) 2018-10-26 2025-04-29 United Kingdom Research And Innovation Methods and compositions

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201906775D0 (en) 2019-05-14 2019-06-26 Res & Innovation Uk Synthetic genome
CN114195665A (zh) * 2021-12-14 2022-03-18 武汉世吉药业有限公司 一种高纯度ncaa的中和酸化工艺及设备

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014036492A1 (en) * 2012-08-31 2014-03-06 Sutro Biopharma, Inc. Modified amino acids comprising an azido group

Family Cites Families (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5275566B2 (ja) 2003-06-18 2013-08-28 ザ スクリプス リサーチ インスティチュート 反応性非天然アミノ酸遺伝コード付加
WO2005019415A2 (en) 2003-07-07 2005-03-03 The Scripps Research Institute Compositions of orthogonal lysyl-trna and aminoacyl-trna synthetase pairs and uses thereof
AU2004321117B2 (en) 2003-12-18 2010-09-02 The Scripps Research Institute Selective incorporation of 5-hydroxytryptophan into proteins in mammalian cells
CA2580840A1 (en) 2004-09-21 2006-03-30 The Scripps Research Institute In vivo incorporation of alkynyl amino acids into proteins in eubacteria
EP1807515A4 (en) 2004-10-27 2008-06-18 Scripps Research Inst Orthogonal translation components for the in vivo incorporation of unnatural amino acids
US8431558B2 (en) 2004-11-01 2013-04-30 The Regents Of The University Of California Compositions and methods for modification of biomolecules
JP2007037445A (ja) 2005-08-02 2007-02-15 Institute Of Physical & Chemical Research tRNA合成方法、核酸、アミノアシルtRNA合成方法及び非天然型アミノ酸組み込み蛋白質の製造方法
US20090081669A1 (en) 2006-02-01 2009-03-26 Encode Bio, Inc. Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs
US20080096819A1 (en) 2006-05-02 2008-04-24 Allozyne, Inc. Amino acid substituted molecules
US20090110662A1 (en) 2007-04-30 2009-04-30 Intezyne Technologies, Inc. Modification of biological targeting groups for the treatment of cancer
JP5590649B2 (ja) 2007-09-20 2014-09-17 独立行政法人理化学研究所 変異体ピロリジル−tRNA合成酵素及びこれを用いる非天然アミノ酸組み込みタンパク質の製造方法
GB0721291D0 (en) 2007-10-30 2007-12-12 Medical Res Council Methods and compositions
GB2470770A (en) 2009-06-04 2010-12-08 Medical Res Council Incorporation of unnatural amino acids having an orthogonal functional group into polypeptides using orthogonal tRNA/tRNA synthetase pairs
GB0917242D0 (en) 2009-10-01 2009-11-18 Medical Res Council Acetyl lysine incorporation with tRNA synthetase
GB0917240D0 (en) 2009-10-01 2009-11-18 Medical Res Council Incorporation of methyl lysine into poiypeptide
US8697688B2 (en) 2010-04-15 2014-04-15 Seattle Genetics Inc. Pyrrolobenzodiazepines used to treat proliferative diseases
DK2563753T6 (en) 2010-04-27 2016-04-04 Synaffix Bv Fused cyclooctynforbindelser and their use in metal-free click-reactions
US20120077186A1 (en) 2010-05-07 2012-03-29 Oregon Health & Science University Use of cysteine-derived suppressor trnas for non-native amino acid incorporation
WO2011156686A2 (en) 2010-06-11 2011-12-15 The Regents Of The University Of Colorado, A Body Corporate Method for synthesizing a cyclic multivalent peptide using a thiol-mediated reaction
DK2670767T3 (en) 2011-02-03 2018-03-26 European Molecular Biology Laboratory Non-naturally occurring amino acids comprising a cyclooctynyl or transcyclooctynyl analog group and uses thereof
GB201110815D0 (en) 2011-06-24 2011-08-10 Medical Res Council Incorporation of subtituted lysines into polypeptides
WO2013036748A1 (en) 2011-09-09 2013-03-14 Berry, Lana, L. Bicyclo[6.1.0]non-4-yne reagents for chemical modification of oligonucleotides
GB201201100D0 (en) 2012-01-20 2012-03-07 Medical Res Council Polypeptides and methods
IN2014DN09922A (https=) 2012-05-18 2015-08-14 Medical Res Council
SG10201702387YA (en) 2012-09-24 2017-04-27 Medimmune Ltd Cell lines
EP3087088B1 (en) * 2013-12-23 2022-05-25 University Of Rochester Methods and compositions for ribosomal synthesis of macrocyclic peptides
GB2528227A (en) 2014-03-14 2016-01-20 Medical Res Council Cyclopropene amino acids and methods
GB201419109D0 (en) 2014-10-27 2014-12-10 Medical Res Council Incorporation of unnatural amino acids into proteins
GB201613135D0 (en) 2016-07-29 2016-09-14 Medical Res Council Genome editing
WO2019028419A1 (en) * 2017-08-03 2019-02-07 Synthorx, Inc. CYTOKINE CONJUGATES FOR THE TREATMENT OF PROLIFERATIVE AND INFECTIOUS DISEASES
GB201817444D0 (en) 2018-10-26 2018-12-12 Res & Innovation Uk Methods and compositions
GB201906775D0 (en) 2019-05-14 2019-06-26 Res & Innovation Uk Synthetic genome
CN117881779A (zh) 2021-05-28 2024-04-12 英国研究与创新署 微生物及其用途

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014036492A1 (en) * 2012-08-31 2014-03-06 Sutro Biopharma, Inc. Modified amino acids comprising an azido group

Non-Patent Citations (86)

* Cited by examiner, † Cited by third party
Title
ADAMS, P. D. ET AL.: "PHENIX: a comprehensive Python-based system for macromolecular structure solution", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 66, 2010, pages 213 - 221
AGGARWAL, A. ET AL.: "Development of a Novel Lead that Targets M. tuberculosis Polyketide Synthase 13", CELL, vol. 170, 2017, pages 249 - 259 e225
AKEY, D.L. ET AL.: "Structural basis for macrolactonization by the pikromycin thioesterase", NAT CHEM BIOL, vol. 2, 2006, pages 537 - 542
ALONZO, D. A.MAGARVEY, N. A.SCHMEING, T. M.: "Characterization of cereulide synthetase, a toxin-producing macromolecular machine", PLOS ONE, vol. 10, 2015, pages e0128569
ARGYROPOULOS, P. ET AL.: "Towards a characterization of the structural determinants of specificity in the macrocyclizing thioesterase for deoxyerythronolide B biosynthesis", BIOCHIM BIOPHYS ACTA, vol. 1860, 2016, pages 486 - 497, XP029389566, DOI: 10.1016/j.bbagen.2015.11.007
BAKER, A.S.DEITERS, A.: "Optical Control of Protein Function through Unnatural Amino Acid Mutagenesis and Other Optogenetic Approaches", ACS CHEMICAL BIOLOGY, vol. 9, 2014, pages 1398 - 1407
BATTYE, T. G.KONTOGIANNIS, L.JOHNSON, O.POWELL, H. R.LESLIE, A. G.: "iMOSFLM: a new graphical interface for diffraction-image processing with MOSFLM", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 67, 2011, pages 271 - 281
BOND, C. S.: "TopDraw: a sketchpad for protein structure topology cartoons", BIOINFORMATICS, vol. 19, 2003, pages 311 - 312
BRUNER, S.D. ET AL.: "Structural basis for the cyclization of the lipopeptide antibiotic surfactin by the thioesterase domain SrfTE", STRUCTURE, vol. 10, 2002, pages 301 - 310
BUNKOCZI, G.READ, R. J.: "Improvement of molecular-replacement models with Sculptor", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 67, 2011, pages 303 - 312
CAPPADOCIA, L.LIMA, C.D.: "Ubiquitin-like Protein Conjugation: Structures, Chemistry, and Mechanism", CHEM REV, vol. 118, 2018, pages 889 - 918
CHIN, J.W.: "Expanding and Reprogramming the Genetic Code of Cells and Animals", ANNU REV BIOCHEM, vol. 83, 2014, pages 379 - 408, XP002753743, DOI: 10.1146/annurev-biochem-060713-035737
CLEARY, J.A.DOHERTY, W.EVANS, P.MALTHOUSE, J.P.G.: "Quantifying tetrahedral adduct formation and stabilization in the cysteine and the serine proteases", BBA-PROTEINS PROTEOM, vol. 1854, 2015, pages 1382 - 1391
CRAVATT, B.F.WRIGHT, A.T.KOZARICH, J.W.: "Activity-based protein profiling: from enzyme chemistry to proteomic chemistry", ANNU REV BIOCHEM, vol. 77, 2008, pages 383 - 414, XP055241366, DOI: 10.1146/annurev.biochem.75.101304.124125
D A ALONZO: "Structural and functional studies of cyclic depsipeptide biosynthesis", THESIS, 1 April 2019 (2019-04-01), pages 1 - 211, XP055662394, Retrieved from the Internet <URL:http://digitool.library.mcgill.ca/R/-?func=dbin-jump-full&current_base=GEN01&object_id=168964> [retrieved on 20200128] *
DI CERA, E.: "Serine proteases", IUBMB LIFE, vol. 61, 2009, pages 510 - 515
DRAKE, E. J. ET AL.: "Structures of two distinct conformations of holo-non-ribosomal peptide synthetases", NATURE, vol. 529, 2016, pages 235 - 238
EKICI, O.D.PAETZEL, M.DALBEY, R.E.: "Unconventional serine proteases: variations on the catalytic Ser/His/Asp triad configuration", PROTEIN SCI, vol. 17, 2008, pages 2023 - 2037
EMSLEY, P.LOHKAMP, B.SCOTT, W. G.COWTAN, K.: "Features and development of Coot", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 66, 2010, pages 486 - 501
EVANS, P.: "Scaling and assessment of data quality", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 62, 2006, pages 72 - 82
FAURE, S. ET AL.: "Asymmetric intramolecular [2+2] photocycloadditions: alpha-and beta-hydroxy acids as chiral tether groups", J ORG CHEM, vol. 67, 2002, pages 1061 - 1070
FRUEH, D.P. ET AL.: "Dynamic thiolation-thioesterase structure of a non-ribosomal peptide synthetase", NATURE, vol. 454, 2008, pages 903 - 906
GAVALDA, S. ET AL.: "The polyketide synthase Pksl3 catalyzes a novel mechanism of lipid transfer in mycobacteria", CHEMISTRY & BIOLOGY, vol. 21, 2014, pages 1660 - 1669
GEHRET, J. J. ET AL.: "Terminal alkene formation by the thioesterase of curacin A biosynthesis: structure of a decarboxylating thioesterase", J BIOL CHEM, vol. 286, 2011, pages 14445 - 14454, XP055148775, DOI: 10.1074/jbc.M110.214635
GIRALDES, J. W. ET AL.: "Structural and mechanistic insights into polyketide macrolactonization from polyketide-based affinity labels", NAT CHEM BIOL, vol. 2, 2006, pages 531 - 536
GUNTAKA, N. S.HEALY, A. R.CRAWFORD, J. M.HERZON, S. B.BRUNER, S. D.: "Structure and Functional Analysis of ClbQ, an Unusual Intermediate-Releasing Thioesterase from the Colibactin Biosynthetic Pathway", ACS CHEM BIOL, vol. 12, 2017, pages 2598 - 2608
HAY, R.W.MORRIS, P.J.: "Interaction of DI-2,3-Diaminopropionic Acid and Its Methyl Ester with Metal Ions .1. Formation Constants", J CHEM SOC A, 1971, pages 3562
HEDSTROM, L.: "Serine protease mechanism and specificity", CHEM REV, vol. 102, 2002, pages 4501 - 4523
HOLLIDAY, G.L.MITCHELL, J.B.O.THORNTON, J.M.: "Understanding the Functional Roles of Amino Acid Residues in Enzyme Catalysis", JOURNAL OF MOLECULAR BIOLOGY, vol. 390, 2009, pages 560 - 577, XP026212162, DOI: 10.1016/j.jmb.2009.05.015
HORSMAN, M.E.HARI, T.P.A.BODDY, C.N.: "Polyketide synthase and non-ribosomal peptide synthetase thioesterase selectivity: Logic gate or a victim of fate?", NATRUAL PRODUCTS REPORTS, 2015
HOYER, K.M.MAHLERT, C.MARAHIEL, M.A.: "The iterative gramicidin s thioesterase catalyzes peptide ligation and cyclization", CHEMISTRY & BIOLOGY, vol. 14, 2007, pages 13 - 22, XP005856661, DOI: 10.1016/j.chembiol.2006.10.011
HUGUENIN-DEZOT NICOLAS ET AL: "Trapping biosynthetic acyl-enzyme intermediates with encoded 2,3-diaminopropionic acid", NATURE, MACMILLAN JOURNALS LTD, LONDON, vol. 565, no. 7737, 12 December 2018 (2018-12-12), pages 112 - 117, XP036664323, ISSN: 0028-0836, [retrieved on 20181212], DOI: 10.1038/S41586-018-0781-Z *
JAITZIG, J.LI, J.SUSSMUTH, R.D.NEUBAUER, P.: "Reconstituted biosynthesis of the nonribosomal macrolactone antibiotic valinomycin in Escherichia coli", ACS SYNTH BIOL, vol. 3, 2014, pages 432 - 438
KOGLIN, A. ET AL.: "Structural basis for the selectivity of the external thioesterase of the surfactin synthetase", NATURE, vol. 454, 2008, pages 907 - 911
KORMAN, T. P. ET AL.: "Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 107, 2010, pages 6246 - 6251
LAN, Y. ET AL.: "Incorporation of 2,3-Diaminopropionic Acid into Linear Cationic Amphipathic Peptides Produces pH-Sensitive Vectors", CHEMBIOCHEM, vol. 11, 2010, pages 1266 - 1272, XP055132470, DOI: 10.1002/cbic.201000073
LI, J. ET AL.: "Palladium-triggered deprotection chemistry for protein activation in living cells", NAT CHEM, vol. 6, 2014, pages 352 - 361
LIU, B.SCHOFIELD, C.J.WILMOUTH, R.C.: "Structural analyses on intermediates in serine protease catalysis", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 281, 2006, pages 24024 - 24035
LIU, C.C.SCHULTZ, P.G.: "Adding New Chemistries to the Genetic Code", ANNUAL REVIEW OF BIOCHEMISTRY, vol. 79, no. 79, 2010, pages 413 - 444, XP055026250, DOI: 10.1146/annurev.biochem.052308.105824
LIU, Y.ZHENG, T.BRUNER, S. D.: "Structural basis for phosphopantetheinyl carrier domain interactions in the terminal module of nonribosomal peptide synthetases", CHEMISTRY & BIOLOGY, vol. 18, 2011, pages 1482 - 1488
LONG, F. ET AL.: "AceDRG: a stereochemical description generator for ligands", ACTA CRYSTALLOGRAPHICA. SECTION D, STRUCTURAL BIOLOGY, vol. 73, 2017, pages 112 - 122
LONG, J.Z.CRAVATT, B.F.: "The Metabolic Serine Hydrolases and Their Functions in Mammalian Physiology and Disease", CHEM REV, vol. 111, 2011, pages 6022 - 6063, XP055556496, DOI: 10.1021/cr200075y
MAGARVEY, N.A.EHLING-SCHULZ, M.WALSH, C.T.: "Characterization of the cereulide NRPS alpha-hydroxy acid specifying modules: activation of alpha-keto acids and chiral reduction on the assembly line", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 128, 2006, pages 10698 - 10699
MAY, J. J.WENDRICH, T. M.MARAHIEL, M. A.: "The dhb operon of Bacillus subtilis encodes the biosynthetic template for the catecholic siderophore 2,3-dihydroxybenzoate-glycine-threonine trimeric ester bacillibactin", J BIOL CHEM, vol. 276, 2001, pages 7209 - 7217
MAYER, S. C.RAMANJULU, J.VERA, M. D.PFIZENMAYER, A. J.JOULLIE, M. M.: "Synthesis of New Didemnin B Analogs for Investigations of Structure/Biological Activity Relationships", J ORG CHEM, vol. 59, 1994, pages 5192 - 5205, XP002275547, DOI: 10.1021/jo00097a022
MCCOY, A. J. ET AL.: "Phaser crystallographic software", JOURNAL OF APPLIED CRYSTALLOGRAPHY, vol. 40, 2007, pages 658 - 674
MCGALL, G. H. ET AL.: "The efficiency of light-directed synthesis of DNA arrays on glass substrates", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 119, 1997, pages 5081 - 5090, XP000775689, DOI: 10.1021/ja964427a
MORIMOTO ET AL., ACC. CHEM RES., vol. 44, 2011
MURSHUDOV, G. N. ET AL.: "REFMAC5 for the refinement of macromolecular crystal structures", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 67, 2011, pages 355 - 367
NEUMANN, H.PEAK-CHEW, S. Y.CHIN, J. W.: "Genetically encoding N(epsilon)-acetyllysine in recombinant proteins", NAT CHEM BIOL, vol. 4, 2008, pages 232 - 234, XP002518929, DOI: 10.1038/NCHEMBIO.73
NEUMANN, H.PEAK-CHEW, S.Y.CHIN, J.W.: "Genetically encoding N-epsilon-acetyllysine in recombinant proteins", NATURE CHEMICAL BIOLOGY, vol. 4, 2008, pages 232 - 234, XP002518929, DOI: 10.1038/NCHEMBIO.73
NGO, P.D.MANSOORABADI, S.O.FREY, P.A.: "Serine Protease Catalysis: A Computational Study of Tetrahedral Intermediates and Inhibitory Adducts", J PHYS CHEM B, vol. 120, 2016, pages 7353 - 7359
NGUYEN, D. P. ET AL., J. AM. CHEM. SOC., vol. 136, no. 6, 2014, pages 2240 - 2243
NGUYEN, D. P. ET AL.: "Genetic encoding of photocaged cysteine allows photoactivation of TEV protease in live mammalian cells", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 136, 2014, pages 2240 - 2243
NGUYEN, D.P. ET AL.: "Genetic Encoding of Photocaged Cysteine Allows Photoactivation of TEV Protease in Live Mammalian Cells", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 136, 2014, pages 2240 - 2243
NGUYEN, D.P.ELLIOTT, T.HOLT, M.MUIR, T.W.CHIN, J.W.: "Genetically Encoded 1,2-Aminothiols Facilitate Rapid and Site-Specific Protein Labeling via a Bio-orthogonal Cyanobenzothiazole Condensation", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 133, 2011, pages 11418 - 11421
OTTO, H.H.SCHIRMEISTER, T.: "Cysteine proteases and their inhibitors", CHEM REV, vol. 97, 1997, pages 133 - 171, XP002666640, DOI: 10.1021/cr950025u
P. KOCIENSKI: "Protective Groups", 2005
PENDRAK, I.WITTROCK, R.KINGSBURY, W. D.: "Synthesis and Anti-Hsv Activity of Methylenedioxy Mappicine Ketone Analogs", J ORG CHEM, vol. 60, 1995, pages 2912 - 2915, XP002515734, DOI: 10.1021/jo00114a050
PHAN, J. ET AL.: "Structural basis for the substrate specificity of tobacco etch virus protease", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 277, 2002, pages 50564 - 50572
PLECHANOVOVA, A.JAFFRAY, E.G.TATHAM, M.H.NAISMITH, J.H.HAY, R.T.: "Structure of a RING E3 ligase and ubiquitin-loaded E2 primed for catalysis", NATURE, vol. 489, 2012, pages 115 - U135
RADZICKA, A.WOLFENDEN, R.: "Rates of uncatalyzed peptide bond hydrolysis in neutral solution and the transition state affinities of proteases", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 118, 1996, pages 6105 - 6109
ROBBEL, L.HOYER, K. M.MARAHIEL, M. A.: "TioS T-TE--a prototypical thioesterase responsible for cyclodimerization of the quinoline- and quinoxaline-type class of chromodepsipeptides", FEBS J, vol. 276, 2009, pages 1641 - 1653
ROGERSON, D. T. ET AL.: "Efficient genetic encoding of phosphoserine and its nonhydrolyzable analog", NAT CHEM BIOL, vol. 11, 2015, pages 496 - 503
S. M. BERGE ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19
SAMEL, S.A.WAGNER, B.MARAHIEL, M.A.ESSEN, L.O.: "The thioesterase domain of the fengycin biosynthesis cluster: a structural base for the macrocyclization of a non-ribosomal lipopeptide", JOURNAL OF MOLECULAR BIOLOGY, vol. 359, 2006, pages 876 - 889, XP024951101, DOI: 10.1016/j.jmb.2006.03.062
SCAGLIONE, J.B. ET AL.: "Biochemical and structural characterization of the tautomycetin thioesterase: analysis of a stereoselective polyketide hydrolase", ANGEW CHEM INT ED ENGL, vol. 49, 2010, pages 5726 - 5730
SHAW-REID, C. A. ET AL.: "Assembly line enzymology by multimodular nonribosomal peptide synthetases: the thioesterase domain of E. coli EntF catalyzes both elongation and cyclolactonization", CHEMISTRY & BIOLOGY, vol. 6, 1999, pages 385 - 400, XP026904690, DOI: 10.1016/S1074-5521(99)80050-7
SWATEK, K.N.KOMANDER, D.: "Ubiquitin modifications", CELL RES, vol. 26, 2016, pages 399 - 422, XP055589222, DOI: 10.1038/cr.2016.39
TANOVIC, A.SAMEL, S. A.ESSEN, L. O.MARAHIEL, M. A.: "Crystal structure of the termination module of a nonribosomal peptide synthetase", SCIENCE, vol. 321, 2008, pages 659 - 663
TERWILLIGER, T. C. ET AL.: "Iterative model building, structure refinement and density modification with the PHENIX AutoBuild wizard", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 64, 2008, pages 61 - 69
TRAUGER, J. W.KOHLI, R. M.WALSH, C. T.: "Cyclization of backbone-substituted peptides catalyzed by the thioesterase domain from the tyrocidine nonribosomal peptide synthetase", BIOCHEMISTRY, vol. 40, 2001, pages 7092 - 7098, XP002406922, DOI: 10.1021/bi010035r
TRAUGER, J.W.KOHLI, R.M.MOOTZ, H.D.MARAHIEL, M.A.WALSH, C.T.: "Peptide cyclization catalysed by the thioesterase domain of tyrocidine synthetase", NATURE, vol. 407, 2000, pages 215 - 218
TSAI, S. C. ET AL.: "Crystal structure of the macrocycle-forming thioesterase domain of the erythromycin polyketide synthase: versatility from a unique substrate channel", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 98, 2001, pages 14808 - 14813
TSAI, S. C.LU, H.CANE, D. E.KHOSLA, C.STROUD, R. M.: "Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases", BIOCHEMISTRY, vol. 41, 2002, pages 12598 - 12606
TSENG, C.C. ET AL.: "Characterization of the surfactin synthetase C-terminal thioesterase domain as a cyclic depsipeptide synthase", BIOCHEMISTRY, vol. 41, 2002, pages 13350 - 13359, XP002304806, DOI: 10.1021/bi026592a
VAGIN, A. A. ET AL.: "REFMAC5 dictionary: organization of prior chemical knowledge and guidelines for its use", ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 60, 2004, pages 2184 - 2195
VERMA, S.DIXIT, R.PANDEY, K.C.: "Cysteine Proteases: Modes of Activation and Future Prospects as Pharmacological Targets", FRONT PHARMACOL, vol. 7, 2016
VIRDEE, S.MACMILLAN, D.WAKSMAN, G.: "Semisynthetic Src SH2 domains demonstrate altered phosphopeptide specificity induced by incorporation of unnatural lysine derivatives", CHEMISTRY & BIOLOGY, vol. 17, 2010, pages 274 - 284, XP026984441
VIRDEE, S.YE, Y.NGUYEN, D.P.KOMANDER, D.CHIN, J.W.: "Engineered diubiquitin synthesis reveals Lys29-isopeptide specificity of an OTU deubiquitinase", NATURE CHEMICAL BIOLOGY, vol. 6, 2010, pages 750 - 757, XP055002769, DOI: 10.1038/nchembio.426
WHICHER, J.R. ET AL.: "Structure and function of the RedJ protein, a thioesterase from the prodiginine biosynthetic pathway in Streptomyces coelicolor", J BIOL CHEM, vol. 286, 2011, pages 22558 - 22569
WINTER, G. ET AL.: "DIALS: implementation and evaluation of a new integration package", ACTA CRYSTALLOGRAPHICA. SECTION D, STRUCTURAL BIOLOGY, vol. 74, 2018, pages 85 - 97
YANG, W.DRUECKHAMMER, D.G.: "Understanding the relative acyl-transfer reactivity of oxoesters and thioesters: computational analysis of transition state delocalization effects", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 123, 2001, pages 11004 - 11009
ZHANG, M. S. ET AL.: "Biosynthesis and genetic encoding of phosphothreonine through parallel selection and deep sequencing", NAT METHODS, vol. 14, 2017, pages 729 - 736
ZHOU, Y. ET AL.: "Iterative Mechanism of Macrodiolide Formation in the Anticancer Compound Conglobatin", CHEMISTRY & BIOLOGY, vol. 22, 2015, pages 745 - 754
ZHOU, Y.PREDIGER, P.DIAS, L.C.MURPHY, A.C.LEADLAY, P.F.: "Macrodiolide formation by the thioesterase of a modular polyketide synthase", ANGEW CHEM INT ED ENGL, vol. 54, 2015, pages 5232 - 5235

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732001B2 (en) 2012-05-18 2023-08-22 United Kingdom Research And Innovation Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase
US12286657B2 (en) 2018-10-26 2025-04-29 United Kingdom Research And Innovation Methods and compositions
EP4328308A1 (en) * 2022-08-22 2024-02-28 Technische Universität Berlin Modified trna-synthetase for the incorporation of non-canonical amino acids

Also Published As

Publication number Publication date
AU2025205622A1 (en) 2025-08-07
CA3116567A1 (en) 2020-04-30
US20220010296A1 (en) 2022-01-13
CN113226375A (zh) 2021-08-06
CN120607506A (zh) 2025-09-09
JP2025023942A (ja) 2025-02-19
AU2019369192B2 (en) 2025-08-14
AU2019369192A1 (en) 2021-05-13
EP3870224A1 (en) 2021-09-01
JP2022505464A (ja) 2022-01-14
US20250283066A1 (en) 2025-09-11
US12286657B2 (en) 2025-04-29
CN113226375B (zh) 2025-05-13
JP7633156B2 (ja) 2025-02-19
GB201817444D0 (en) 2018-12-12

Similar Documents

Publication Publication Date Title
US20250283066A1 (en) Methods and compositions
US9260484B2 (en) Small molecule composite surfaces as inhibitors of protein-protein interactions
Bloudoff et al. Chemical probes allow structural insight into the condensation reaction of nonribosomal peptide synthetases
Wexselblatt et al. Design, synthesis and structure–activity relationship of novel Relacin analogs as inhibitors of Rel proteins
Sikandar et al. Total in vitro biosynthesis of the thioamitide thioholgamide and investigation of the pathway
US8119364B2 (en) Methods for generating analogs of coenzyme A
AU2023252978A1 (en) Papb as a bimoiety-dependent thioether installation tool
Hulce et al. An in vivo active carbamate-based dual inhibitor of lysophospholipase 1 (LYPLA1) and lysophospholipase 2 (LYPLA2)
Lamprecht et al. An enzyme-initiated Smiles rearrangement enables the development of an assay of MshB, the GlcNAc-Ins deacetylase of mycothiol biosynthesis
Wheadon MECHANISM OF CONDENSATION DOMAIN CATALYZED β-LACTAM FORMATION IN A NONRIBOSOMAL PEPTIDE SYNTHETASE: EVOLUTIONARY ORIGIN AND INSPIRED CHEMICAL TOOLS
Hann Chemical Probes to Trap Ubiquitin Conjugation Cascade Intermediates
Schramma et al. Investigations into the Mechanism and Substrate Scope of AgaB and the Chemo-Enzymatic Total Synthesis of Streptide Natural Products
Bag et al. Intramolecular cyclization of isothiocyanyl amino acids/peptide: arrival at unnatural thioxoimidazolidinyl/thioxooxazolidinyl amino acids
Alexander Selective Inhibition of Virulence Factors in the Human Microbiota
Sutherland Exploring biosynthetic routes to novel histidine containing cyclodipeptides
Pigula Harnessing the Translation System to Engineer Proteins and Organisms
Groff Photocontrol of biological activity
WO2025250949A1 (en) Compositions and methods for chemoproteomic interaction site mapping
Ahn Mechanistic studies of PLP-independent racemases
Beech Examining and exploiting docking domain-mediated carrier protein recognition in aeruginosin biosynthesis
von Tesmar et al. Total biosynthesis of tomaymycin comprehensively monitored on the nonribosomal peptide megasynthetase
Pham Novel inhibitors of the tRNA-dependent amidotransferase of" Helicobacter pylori": Peptides generated by phage display and dipeptide-like compounds
Xie Adding unnatural amino acids to the genetic repertoire
Suchanová Návrh a syntéza inhibitorů DDl založených na isothiazolidinonovém jádře
Hur Crosslinking studies in natural products biosynthesis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19806312

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3116567

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021521504

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019369192

Country of ref document: AU

Date of ref document: 20191024

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019806312

Country of ref document: EP

Effective date: 20210526

WWG Wipo information: grant in national office

Ref document number: 17288798

Country of ref document: US

WWG Wipo information: grant in national office

Ref document number: 201980086289.4

Country of ref document: CN