WO2020070276A1 - Bifunctional compounds comprising insulin peptides and egf(a) peptides - Google Patents
Bifunctional compounds comprising insulin peptides and egf(a) peptidesInfo
- Publication number
- WO2020070276A1 WO2020070276A1 PCT/EP2019/076889 EP2019076889W WO2020070276A1 WO 2020070276 A1 WO2020070276 A1 WO 2020070276A1 EP 2019076889 W EP2019076889 W EP 2019076889W WO 2020070276 A1 WO2020070276 A1 WO 2020070276A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- egf
- gaqp
- insulin
- gglu
- fusion protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C[C@@](CCCCNC(COCCOCCNC(COCCOCCNC(CC[C@@](C(O)=O)N)=O)=O)=O)C(O)=* Chemical compound C[C@@](CCCCNC(COCCOCCNC(COCCOCCNC(CC[C@@](C(O)=O)N)=O)=O)=O)C(O)=* 0.000 description 2
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/485—Epidermal growth factor [EGF], i.e. urogastrone
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/62—Insulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/6454—Dibasic site splicing serine proteases, e.g. kexin (3.4.21.61); furin (3.4.21.75) and other proprotein convertases
Definitions
- the present invention relates to novel bi-functional fusion peptides comprising insulin analogues or derivatives thereof and EGF(A) analogues, and their pharmaceutical use. Furthermore, the invention relates to pharmaceutical compositions comprising such bi- functional fusion peptides, and to the use of such fusion peptides for the treatment or prevention of medical conditions relating to diabetes and dyslipidaemia associated with diabetes.
- Diabetes mellitus is a metabolic disorder, in which the ability to utilise glucose is partly or completely lost. More than 5% of the global population live with diabetes, with millions more at risk of developing the disease. Insulin therapy for the treatment of diabetes has been used for decades and involves administering several injections of insulin each day. Such therapy usually involves administration of a long-acting basal injection once or twice daily, and an injection of a fast-acting insulin at mealtime (i.e. prandial insulin).
- Patients with Type 2 diabetes mellitus in addition to hyperglycemia, often suffer from various metabolic dysfunctions, such as e.g. dyslipidemia, obesity and cardiovascular complications for which current insulin therapy only has limited beneficial effect. Diabetic dyslipidaemia,
- LDL-c low density lipoprotein cholesterol
- HDL high HDL
- elevated triglycerides is a well-established driver for cardiovascular disease (CVD).
- Statins have been used for the treatment of dyslipidemia for decades and its administration shows substantial and consistent reduction of cardiovascular events with an acceptable safety profile. Despite the availability and widespread use of statins and other lipid lowering agents, many patients do not reach their target LDL-C levels and remain at high risk for developing CVD.
- PCSK9 Protein Convertase Subtilisin/Kexin type 9 promotes hepatic LDL-R (LDL receptor) degradation, thereby reducing hepatic LDL-R surface expression and consequently reducing clearance of LDL particles.
- blocking PCSK9 increases the clearance of LDL-C as well as of other atherogenic lipoproteins, such as intermediate- density lipoproteins and remnant particles. This additional clearance may have therapeutic benefits beyond that provided by LDL reduction alone.
- EGF(A) Epidermal Growth Factor-like domain A sequence (40 amino acids) of the LDL-R (LDL-R-(293-332)) is well recognized as the site for PCSK9 binding.
- the isolated wild-type EGF(A) peptide has been shown to inhibit the binding of PCSK9 to the LDL-R with an IC50 in the low mM range (Biochemical and Biophysical Research Communications 375 (2008) 69-73). This poor binding affinity prevents a practical pharmaceutical use of the EGF(A) peptide.
- WO2012177741 and J. Mol. Biol. (2012) 422, 685-696 allegedly disclose analogues of EGF(A) and Fc-Fusion thereof.
- WO 2015/127273 allegedly discloses fusion of an anti- PCSK9 and a GLP-1.
- W02017121850 allegedly discloses EGF(A) analogues with fatty acid substituents.
- evolocumab (Repatha ® , Amgen Europe BV, have recently been approved for the treatment of high LDL-C levels, being administered by subcutaneous injection every two weeks.
- Insulin therapy is well-established for regulating blood glucose levels in patients with diabetes. It is also well-known that patients with a high risk of CVD and are at risk of developing microvascular complications (like nephropathy, retinopathy and neuropathy). With current therapies, still about 50% of people with diabetes die of cardiovascular disease.
- the present invention relates to combining insulin with EGF(A).
- the compounds of the present invention comprise an insulin peptide or an analogue thereof, an EGF(A) peptide or an analogue thereof, a spacer and a substituent.
- the compounds of the present invention are fusion proteins comprising an insulin peptide or an analogue thereof, an EGF(A) peptide or an analogue thereof, a spacer and a substituent.
- the fusion proteins of the present invention comprise an insulin peptide, an EGF(A) peptide, a spacer and a substituent, wherein,
- said insulin peptide is human insulin (SEQ ID NO: 2 and 3) or an analogue of human insulin ii.
- said EGF(A) peptide is an analogue of the EGF(A) domain of LDL-R (293-332) (SEQ ID NO:1 )
- said substituent is of formula (I): Acy-AA2 m -AA3 p -, wherein
- Acy is a fatty diacid comprising from about 16 to about 20 carbon atoms
- AA2 is an acidic amino acid residue and wherein m is an integer in the range from 1 to 10 and
- AA3 is a neutral, alkyleneglycol-containing amino acid residue and p is an integer in the range from 1 to 10, and
- the bi-functional fusion proteins of the present invention lower blood glucose levels and bind PCSK9 thereby enhancing the expression of functional LDL-R in the liver.
- the present invention provides novel bi-functional fusion proteins able to both activate the insulin receptor and bind PCSK9, i.e., combine the effects of blood glucose lowering together with reduction of LDL cholesterol.
- the bi-functional fusion peptides of the present invention lower blood glucose levels and binds PCSK9 thereby enhancing the expression of functional LDL- R in the liver.
- the fusion peptides of the present invention reduce blood glucose levels.
- the fusion peptides of the present invention reduce LDL cholesterol.
- the invention relates to a pharmaceutical composition comprising a fusion peptide according to the invention.
- the invention relates to a fusion peptide according to the invention for use as a medicament.
- the invention relates to a fusion peptide according to the invention for use in the treatment of diabetes and dyslipidaemia associated with diabetes.
- the invention relates to medical use(s) of the fusion peptides according to the invention.
- the invention may also solve further problems that will be apparent from the disclosure of the exemplary embodiments.
- Figure 1 shows the blood glucose lowering effects of the compounds of examples 4, 9, and 14 of the invention, all with the octadecanedioyl-gGlu-2xOEG side chain and with different lengths of GQAP/GAQP spacers.
- Figure 2 shows the blood glucose lowering effects of the compounds of examples 2, 12, 17, 18, and 19 of the invention, all with the octadecanedioyl-gGlu-2xOEG side chain and with different lengths of GQAP/GAQP spacers.
- Figure 3 shows the blood glucose lowering effects of the compounds of examples 4 and 17 of the invention, with different lengths of GQAP/GAQP spacers, relative to the blood glucose lowering effects of the comparator compounds 1 and 2 with GQEP spacers, all with the octadecanedioyl-gGlu-2xOEG side chain and vehicle.
- Figure 4 shows the blood glucose lowering effects of the compounds of examples 3, 1 1 , and 13 of the invention, with different lengths of GQAP/GAQP spacers, relative to the blood glucose lowering effects of the comparator compounds 1 and 2 with GQEP spacers, all with the octadecanedioyl-gGlu-2xOEG side chain and vehicle.
- Figure 5 shows the blood glucose lowering effects of the compounds of examples 4 and 8 of the invention with 2xGQAP/GAQP spacers, relative to the blood glucose lowering effect of the comparator compound 1 with 2xGQEP spacer, all with the octadecanedioyl-gGlu-2xOEG side chain.
- Figure 6 shows the blood glucose lowering effects of the compounds of examples 1 1 and 12 of the invention with 4xGAQP spacer, relative to the blood glucose lowering effect of the comparator compound 4 with 4xGQEP spacers, all with the octadecanedioyl-gGlu-2xOEG side chain.
- Figure 7 shows the blood glucose lowering effects of the compounds of examples 3, 4, and 5 of the invention, with 2xGAQP spacer, relative to the blood glucose lowering effect of the comparator compound 1 with 2xGQEP spacer, all compounds with the octadecanedioyl- gGlu-2xOEG side chain.
- Figure 8 shows the blood glucose lowering effects of the compounds of examples 13, 14, and 15 of the invention, with 6xGAQP spacer, relative to the blood glucose lowering effect of the comparator compound 6 with 6xGQEP spacer, all with C18 side chain.
- Figure 9 shows the blood glucose lowering effects of the compound of example 1 of the invention, and with 2xGAQP spacer, relative to the blood glucose lowering effect of the comparator compounds 5 and 7 with 2x or 8x GQEP spacer, all with hexadecanedioyl-gGlu- 2xOEG side chain.
- Figure 10 shows the blood glucose lowering effects of the compound of example 16 of the invention, and with 6xGAQP spacer, relative to the blood glucose lowering effect of the comparator compound 3 with 6xGQEP spacer, both with eicosanedioyl-gGlu-2xOEG side chain.
- Figure 11 shows the blood glucose lowering effects of the compound of example 4 of the invention with 2xGAQP, relative to the blood glucose lowering effect of the“insulin alone” comparator compound 8, both with octadecanedioyl-gGlu-2xOEG side chain.
- the present invention relates to bi-functional compounds which activate the insulin receptor and bind to PCSK9.
- the present invention relates to a fusion protein comprising an insulin peptide and an EGF(A) peptide.
- the invention relates to a fusion protein comprising an insulin analogue and an EGF(A) analogue, wherein said insulin analogue is an analogue of human insulin (SEQ ID NOs: 2 and 3) and said EGF(A) analogue is an analogue of the EGF(A) domain of LDL-R (293-332) (SEQ ID NO: 1 ).
- the EGF(A) peptide is an analogue of the peptide of SEQ ID NO: 1
- the insulin analogue is fused with the C-terminal amino acid of the EGF(A) peptide analogue, via the N-terminal amino acid residue of the insulin analogue B-chain.
- the invention relates to a fusion protein comprising an insulin peptide, an EGF(A) peptide, a spacer and a substituent, wherein,
- said insulin peptide is human insulin (SEQ ID NOs: 2 and 3) or an analogue of human insulin
- said EGF(A) peptide is an analogue of the EGF(A) domain of LDL-R (293-332) (SEQ ID NO:1 )
- said substituent is of formula (I): Acy-AA2 m -AA3 p -, wherein
- Acy is a fatty diacid comprising from about 16 to about 20 carbon atoms
- AA2 is an acidic amino acid residue and wherein m is an integer in the range from 1 to 10 and AA3 is a neutral, alkyleneglycol-containing amino acid residue and p is an integer in the range from 1 to 10, and
- the insulin analogue is fused with the C-terminal amino acid of the EGF(A) peptide analogue, via the B1 amino acid residue of the insulin analogue N- terminal B-chain.
- the insulin analogue is fused with the C-terminal amino acid of the EGF(A) peptide analogue, via the N-terminal amino acid residue of the insulin analogue B-chain, via a spacer.
- the fusion peptides of the present invention reduce blood glucose levels.
- the fusion peptides of the present invention show superior blood glucose reductions relative to comparator fusion peptides comprising (GQEP)n.
- the fusion peptides of the present invention combine the effects of blood glucose lowering together with reduction of LDL cholesterol.
- the invention relates to a pharmaceutical composition comprising a fusion peptide according to the invention.
- the invention in another embodiment, relates to a pharmaceutical composition
- a pharmaceutical composition comprising a fusion peptide of the invention and a pharmaceutically acceptable excipient.
- the invention relates to a fusion peptide according to the invention for use as a medicament.
- the invention relates to a fusion peptide according to the invention for use in the treatment of diabetes and dyslipidaemia associated with diabetes.
- the invention relates to medical use of the fusion peptides according to the invention.
- “compound” is used herein to refer to a molecular entity, and“compounds” may thus have different structural elements besides the minimum element defined for each compound or group of compounds. It follows that a compound may be a fusion
- compound/peptide or a derivative thereof as long as the compound comprises the defined structural and/or functional elements.
- the term“compound” is also meant to cover pharmaceutically relevant forms hereof, i.e. the invention relates to a compound as defined herein or a pharmaceutically acceptable salt, amide, or ester thereof.
- peptide or“polypeptide”, as e.g. used in the context of the invention, refers to a compound which comprises a series of amino acids interconnected by amide (or peptide) bonds.
- peptide consists of amino acids
- analogue generally refers to a peptide, the sequence of which has one or more amino acid changes when compared to a reference amino acid sequence.
- Analogues“comprising” certain specified changes may comprise further changes, when compared to their reference sequence.
- an analogue “has” or “comprises” specified changes.
- the term“consists” or“consisting” is used in relation to an analogue e.g. an analogue consists or consisting of a group of specified amino acid mutations, it should be understood that the specified amino acid mutations are the only amino acid mutations in the analogue.
- an analogue“comprising” a group of specified amino acid mutations may have additional mutations.
- the term“analogue” also designates analogues of EGF(A) human insulin fusion proteins.
- derivative generally refers to a compound which may be prepared from a native peptide or an analogue thereof by chemical modification, in particular by covalent attachment of one or more substituents.
- a derivative can also be referred to as an acylated analogue.
- amino acid includes proteinogenic (or natural) amino acids (amongst those the 20 standard amino acids), as well as non-proteinogenic (or non-natural) amino acids. Proteinogenic amino acids are those which are naturally incorporated into proteins. The standard amino acids are those encoded by the genetic code. Non-proteinogenic amino acids are either not found in proteins, or not produced by standard cellular machinery (e.g., they may have been subject to post-translational modification).
- amino acid residues may be identified by their full name, their one-letter code, and/or their three-letter code. These three ways are fully equivalent and interchangeable.
- amino acid residues are molecules containing an amino group and a carboxylic acid group, and, optionally, one or more additional groups, often referred to as a side chain.
- amino acid residue is an amino acid from which, formally, a hydroxy group has been removed from a carboxy group and/or from which, formally, a hydrogen atom has been removed from an amino group.
- fusion and“fused” are used in relation to compound comprising two individually defined peptide/protein sequences which are connected by a peptide bond or by a peptide spacer (also connected by peptide bonds).
- human insulin as used herein means the human insulin hormone whose structure and properties are well-known. Human insulin has two polypeptide chains, named the A-chain and the B-chain.
- the A-chain is a 21 amino acid peptide and the B-chain is a 30 amino acid peptide, the two chains being connected by disulphide bridges: a first bridge between the cysteine in position 7 of the A-chain and the cysteine in position 7 of the B- chain, and a second bridge between the cysteine in position 20 of the A-chain and the cysteine in position 19 of the B-chain.
- a third bridge is present between the cysteines in position 6 and 11 of the A-chain.
- the human insulin A-chain has the following sequence:
- GIVEQCCTSICSLYQLENYCN SEQ ID NO: 2
- B-chain has the following sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 3).
- the hormone is synthesized as a single-chain precursor proinsulin (preproinsulin) consisting of a prepeptide of 24 amino acids followed by proinsulin containing 86 amino acids in the configuration: prepeptide-B-Arg Arg-C-Lys Arg-A, in which C is a connecting peptide of 31 amino acids.
- Arg-Arg and Lys-Arg are cleavage sites for cleavage of the connecting peptide from the A and B chains.
- An insulin according to the invention is herein to be understood as human insulin or an insulin from another species such as porcine or bovine insulin.
- insulin analogue means the modified human insulin wherein one or more amino acid residues of the insulin have been substituted by other amino acid residues and/or wherein one or more amino acid residues have been deleted from the insulin and/or wherein one or more amino acid residues have been added and/or inserted to the insulin.
- mutant means substitution or deletion of amino acids within the sequence of human insulin.
- mutation does not include additions, elongations or extensions to the sequence of human insulin. Mutations in the insulin molecule are denoted stating the chain (A or B), the position, and the one or three letter code for the amino acid residue substituting the native amino acid residue.
- Any mutation to the insulin analogue as used herein means a mutation to the insulin peptide alone and does not include any spacer peptide attached to the insulin
- connecting peptide or“C-peptide” is meant a connection moiety“C” of the B-C- A polypeptide sequence of a single chain proinsulin-molecule.
- the C-peptide connects position 30 of the B chain and position 1 of the A chain and is 35 amino acid residue long.
- the connecting peptide includes two terminal dibasic amino acid sequences, e.g., Arg-Arg and Lys-Arg which serve as cleavage sites for cleavage off of the connecting peptide from the A and B chains to form the two-chain insulin molecule.
- desB30 or“B(1-29) is meant a natural insulin B chain or an analogue thereof lacking the B30 amino acid and“A(1-21 )” means the natural insulin A chain.
- desB30 human insulin is an analogue of human insulin where the amino acid in position 30 in the B chain is deleted.
- the analogue of human insulin or derivative of the invention have the ability to reduce blood glucose levels.
- the analogue of human insulin or derivative of the invention activates the insulin receptor. In one embodiment, the analogue of human insulin or derivative of the invention lowers blood glucose.
- the fusion peptide of the present invention comprises an analogue of human insulin or a derivative thereof.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising up to 12 mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising up to 10 mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising 1-6 mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising 1-3 mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising one mutation.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising two mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising three mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising four mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising five mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising six mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising seven mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising eight mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising nine mutations.
- the fusion peptide of the present invention comprises an analogue of human insulin comprising 10 mutations.
- the fusion peptide of the present invention comprises human insulin. In one embodiment, the fusion peptide of the present invention comprises an insulin analogue comprising desB30.
- the fusion peptide of the present invention comprises an insulin analogue comprising A14E.
- the fusion peptide of the present invention comprises an insulin analogue comprising B3E.
- the fusion peptide of the present invention comprises an insulin analogue comprising A14E, desB30.
- the fusion peptide of the present invention comprises an insulin analogue comprising B3E, desB30.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 9 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 8 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 7 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 6 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 5 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 4 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 3 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further 2 mutations in said insulin analogue.
- the fusion peptide of the present invention comprises an insulin analogue comprising desB30 and further one mutation in said insulin analogue.
- EGF(A) compound or“EGF(A) peptide” is used herein to generally refer to a fusion protein comprising an EGF(A) peptide, encompassing wt-LDL-R(293-332) as defined by SEQ ID NO: 1 and analogues hereof.
- EGF(A) compound encompasses derivatives of EGF-(A) peptide and analogue thereof i.e. EGF(A) peptide analogues with an acyl moiety as described herein is a typical example of an EGF(A) compound.
- EGF(A) analogue herein refers to a modified EGF(A) domain of LDL-R (293-332) (SEQ ID NO: 1 ).
- “EGF(A) domain of the LDL-R”,“LDL-R (293-332)”,“native LDL-R (293- 332),“EGF(A) (293-332)”,“wild-type EGF(A)",“wt-EGF(A)” or“native EGF(A)” as used herein refer to a peptide consisting of the sequence SEQ ID NO: 1 , which is:
- the numbering of the amino acid residues follows the numbering for the EGF(A) domain of the LDL-R (LDL-R-(293-332)), wherein the first (N-terminal) amino acid residue is numbered or accorded position no. 293, and the subsequent amino acid residues towards the C-terminus are numbered 294, 295, 296 and so on, until the last (C- terminal) amino acid residue, which in the EGF(A) domain of the LDL-R is Glu with number 332.
- the numbering is done differently in the sequence listing, where the first amino acid residue of SEQ ID NO: 1 (Gly) is assigned no. 1 , and the last (Glu) no. 40.
- the N-terminal amino acid assigned is no. 1 irrespective of its positioning relative to 293Gly or 293 substituting amino acid residue by reference to LDL-R(293-332).
- the numbering of amino acid positions is with reference to LDL-R(293-332), as explained above.
- EGF(A) analogue generally refers to a peptide, the sequence of which has one or more amino acid changes when compared to a reference amino acid sequence.
- the terms“EGF(A) domain of LDL-R (293-332)”,“EGF(A) domain of LDL-R (293- 332) analogue of SEQ ID NO: 1”,“LDL-R(293-332) analogue”,“EGF(A) analogue” or “analogue of SEQ ID NO: 1” as used herein may be referred to as a peptide, the sequence of which comprises mutations, i.e. amino acid substitutions or deletions relative to sequence SEQ ID NO: 1.
- Any mutation to the EGF(A) analogue as used herein means a mutation to the EGF(A) peptide alone and does not include any spacer peptide attached to the EGF(A) peptide/analogue.
- the EGF(A) domain of LDL-R (293-332) according to SEQ ID NO:1 , or analogue thereof is capable of inhibiting PCSK9 binding to human Low Density Lipoprotein Receptor (LDL-R).
- LDL-R Low Density Lipoprotein Receptor
- the EGF(A) domain of LDL-R (293-332) according to SEQ ID NO:1 , or analogue thereof has the ability to inhibit PCSK9 binding to the LDL-R.
- the EGF(A) domain of LDL-R (293-332) according to SEQ ID NO:1 , or analogue thereof has the ability to inhibit PCSK9 binding to the LDL-R and reduce LDL levels in the blood.
- the EGF(A) domain of LDL-R (293-332) according to SEQ ID NO:1 , or analogue thereof reduces LDL blood levels.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 1-15 amino acid mutations compared to SEQ ID NO.: 1.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 1-10 amino acid mutations compared to SEQ ID NO.: 1.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 1-8 amino acid mutations compared to SEQ ID NO.: 1.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 1-6 amino acid mutations compared to SEQ ID NO.: 1.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 1-5 mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises one mutation.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises two mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises three mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises four mutations. In one embodiment, the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises five mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises six mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises seven mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises eight mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises nine mutations.
- the fusion peptide of the present invention comprises an EGF(A) domain of LDL-R (293-332) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 10 mutations.
- the peptide analogues may be described by reference to the native LDL-R(293-332) EGF(A) peptide, namely as an analogue thereof in which a number of amino acid residues have been changed when compared to native LDL-R(293-332) EGF(A) (SEQ ID NO: 1 ). These changes may represent, independently, one or more amino acid mutations.
- EGF(A) analogue incorporated in fusion peptides of the invention may be referred to as the following LDL-R(293-332) EGF(A) analogue: (301 Leu, 309Arg, 312Glu,
- 321 Glu LDL-R(293-332) EGF(A), or (Leu301 , Arg309, Glu312, Glu321 )-LDL-R(293-332) EGF(A) or (301 L,309R,312E,321 E) LDL-R(293-332) or (L301 ,R309,E312,E321 ) LDL-R(293- 332).
- this analogue when this analogue is aligned with native LDL-R(293-332), it has i) a Leu at the position in the analogue which corresponds, according to the alignment, to position 301 in native LDL-R(293-332) EGF(A), ii) an Arg at the position in the analogue which corresponds to position 309 in native LDL-R(293-332) EGF(A), iii) a Glu at the position in the analogue which corresponds to position 312 in native LDL-R(293-332) EGF(A), iv) a Glu at the position in the analogue which corresponds to position 321 in native LDL-R(293- 332) EGF(A).
- Analogues“comprising” certain specified changes may comprise further changes, when compared to SEQ ID NO: 1 .
- the EGF(A) peptide analogue within the fusion peptide of the invention comprises the amino acid substitution of amino acid residue 301 from Asn to Leu, also described by Asn301 Leu, 301 Leu or simply 301 L.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 301 Leu.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 309R.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 312E.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 321 E.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 301 L and 309R.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 301 L, 309R and 312E.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein said EGF (A) analogue comprises 301 L, 309R, 312E and 321 E.
- the fusion peptide of the present invention comprises an EGF(A) analogue of SEQ ID NO: 1 , wherein the EGF(A) peptide analogue comprises the amino acid mutations represented by any of the groups i-vii as listed below:
- the compounds or fusion peptides of the present invention comprise an insulin peptide, an EGF(A) peptide and a spacer, wherein,
- said insulin peptide is human insulin (SEQ ID NO:2 and 3) or an analogue of human insulin,
- said EGF(A) peptide is an analogue of the EGF(A) domain of LDL-R (293-332) (SEQ ID NO:1 ) and
- said spacer is a peptide linker connecting the N-terminal of the insulin analogue B-chain with the C-terminal of the EGF(A) analogue.
- the compounds or fusion peptides of the present invention further comprise a substituent attached to an amino acid residue of the fusion protein.
- EGF(A) insulin fusion proteins are given as analogues and derivative relative to the EGF(A) and human insulin proteins as elaborated above.
- the naming of the spacer connecting the two proteins and the substituents attached to the fusion protein is elaborated below.
- the compounds of the present invention may be called interchangeably
- fusion peptides/proteins include a spacer to ensure that any functionality residing in the ends of the two peptides/proteins is not disturbed by the proximity of the other peptides/proteins.
- the spacer is a peptide, which is herein referred to as a spacer peptide or a peptide spacer or a peptide linker.
- spacer peptides are known in the art and may be placed between the insulin analogue and the EGF(A) analogue to obtain fusion compounds.
- the order of the EGF(A) analogue and the insulin analogue starting from the N-terminal is the EGF(A) analogue followed by the insulin analogue, optionally separated by a spacer peptide.
- the C-terminal of the EGF(A) analogue is fused with the N-terminal of the insulin analogue B-chain.
- the spacer is a peptide segment consisting of 4-80 amino acids connected via peptide bonds.
- the spacer comprises one or more of the following amino acid residues: Ala (A), Gly (G), Pro (P), Gin (Q).
- the present inventors found that the amino acid composition of the spacer impacted the ability of the compounds to reduce blood glucose levels.
- Compounds of the invention comprising the uncharged spacers (GQAP)n or (GAQP)n, showed superior blood reduction relative to comparator compounds comprising the charged spacers such as (GQEP)n.
- the length of the spacer impacted the ability of the compounds to reduce blood glucose levels.
- the spacer within the EGF(A)-insulin fusion protein derivative of Example 4 is named [GAQP]2, meaning that the spacer connecting the C-terminal residue of the EGF(A) peptide with the N-terminal residue of the insulin B-chain has the sequence (GAQP)2, which also can be denoted GAQPGAQP or 2xGAQP or [GAQP]2 or 2x(GAQP).
- the amino acid residues may be identified by their full name, their one-letter code, and/or their three-letter code. These three ways are fully equivalent and interchangeable.
- the spacer within the EGF(A)-insulin fusion protein derivative of Example 2 is named [GAQP]10, meaning that the spacer connecting the C-terminal residue of the EGF(A) peptide with the N-terminal residue of the insulin B-chain has the sequence
- GQPio which also can be denoted 10xGAQP, [GAQP]10, 10x(GAQP) or
- the fusion proteins of the present invention show superior blood glucose reductions relative to comparator compounds comprising (GQEP)n.
- the fusion proteins of the present invention wherein the spacer comprises (GAQP)n or (GQAP)n show superior blood glucose reductions relative to comparator compounds comprising (GQEP)n.
- the fusion proteins of the present invention wherein the spacer comprises (GAQP)n or (GQAP)n, wherein n 1-20 show superior blood glucose reductions relative to comparator compounds comprising (GQEP)n.
- the fusion proteins of the present invention wherein the spacer comprises (GAQP)n or (GQAP)n, wherein n 2-19 show superior blood glucose reductions relative to comparator compounds comprising (GQEP)n.
- the fusion proteins of the present invention wherein the spacer comprises (GAQP)n, wherein n 2-10 show superior blood glucose reductions relative to comparator compounds comprising (GQEP)n.
- a substituent/acyl moiety is attached to the fusion protein of the present invention (i.e., bi-functional insulin EGF(A) fusion compound or bi-functional compound).
- the substituent has none or minimal effect on the functionality of the EGF(A) peptides and the expected effect on the insulin functionality, i.e., reduction of insulin receptor affinity similar to the effect of attaching an acyl moiety to an insulin without an EGF(A) peptide.
- the acyl moiety is attached via a Lys/K amino acid residue within the insulin analogue sequence.
- the substituent attached to the compound of the present invention has the general formula (I): Acy-AA2 m -AA3p-, wherein
- Acy is a fatty diacid comprising from about 16 to about 20 carbon atoms
- AA2 is an acidic amino acid residue and wherein m is an integer in the range from 1 to 10 and
- AA3 is a neutral, alkyleneglycol-containing amino acid residue and p is an integer in the range from 1 to 10, and
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said Acy comprises a fatty diacid group selected from 1 ,16-hexadecanedioic acid, 1 ,18- octadecanedioic acid, and 1 ,20-eicosanedioic acid.
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said Acy comprises a fatty diacid group1 ,16-hexadecanedioic acid.
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said Acy comprises a fatty diacid group 1 ,18-octadecanedioic acid.
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said Acy comprises a fatty diacid group 1 ,20-eicosanedioic acid.
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said AA2 m comprises gGlu, which represents a gamma glutamic acid residue represented by the following structure:
- the substituent has formula (I) Acy-AA2 m -AA3 p -, wherein said AA3 P comprises [2-(2-aminoethoxy)ethoxy]acetyl or amino acid residue 8-amino-3,6-dioxaoctanoic acid -NH(CH2)20(CH2)20CH2C0-and is represented by the following structure:
- the substituent has formula (I) Acy-AA2 m -AA3p-, and wherein AA2 m - AA3 P - is represented independently by gGlu-OEG or gGlu-OEG-OEG.
- the substituent has formula (I) Acy-AA2 m -AA3p-, and wherein AA2 m - AA3 P - is represented by gGlu-OEG.
- the substituent has formula (I) Acy-AA2 m -AA3 p -, and wherein AA2 m - AA3 P - is represented by gGlu-OEG-OEG.
- the substituent has formula (I) Acy-AA2 m -AA3p- is represented independently by:
- the substituent has formula (I) Acy-AA2 m -AA3p- is represented by C16 diacid-gGlu.
- the substituent has formula (I) Acy-AA2 m -AA3p- is represented by C18 diacid-gGlu-OEG.
- the substituent has formula (I) Acy-AA2 m -AA3p- is represented by C18 diacid-gGlu-2xOEG.
- the substituent has formula (I) Acy-AA2 m -AA3p- is represented by C20 diacid-gGlu-2xOEG.
- the acyl moiety attached to the fusion peptides of the present invention has the general formula Acy-AA2 m -AA3 p - (I), wherein AA2 is selected from L- or D-gGlu, L- or D-Glu, L- or D-Asp, L- or D-homoGlu.
- the acidic amino acid residue designated AA2 is an amino acid with a molecular weight of up to about 200 Da comprising two carboxylic acid groups and one primary or secondary amino group.
- the neutral, alkyleneglycol-containing amino acid residue designated AA3 is an alkyleneglycol moiety, optionally an oligo- or polyalkyleneglycol moiety containing a carboxylic acid functionality at one end and an amino group functionality at the other end.
- alkyleneglycol moiety covers mono-alkyleneglycol moieties as well as oligo- alkyleneglycol moieties.
- Mono- and oligoalkyleneglycols comprises mono- and
- oligobutyleneglycol based chains i.e., chains that are based on the repeating unit - CH2CH2O-, -CH2CH2CH2O- or -CH2CH2CH2CH2O-.
- the alkyleneglycol moiety is
- Monoalkyleneglycol moieties comprise -0CH 2 CH 2 0-, -OCH2CH2CH2O- or -OCH2CH2CH2CH2O- containing different groups at each end.
- the order by which AA2 and AA3 appears in the acyl moiety with the formula (I) can be interchanged independently. Consequently, the formula Acy-AA2 m -AA3p- also covers moieties like, e.g., the formula Acy-AA2 m -AA3p-, the formula Acy-AA2-AA3 n -AA2-, and the formula Acy-AA3p-AA2 m -, wherein AcyAA2, AA3, n, m and p are as defined herein.
- the connections between the moieties Acy, AA2 and/or AA3 are formally obtained by amide bond (peptide bond) formation (-CONH-) by removal of water from the parent compounds from which they formally are build.
- amide bond peptide bond
- -CONH- amide bond
- Gamma Glu, yGlu and gGlu are short hand notation for the amino acid gamma glutamic acid, H 2 N-CH(C0 2 H)-CH 2 CH 2 -C0 2 H (connected via the alpha amino group and via the gamma (side chain) carboxy group), in the L-configuration.
- OEG is short hand notation for the amino acid residue 8-amino-3,6-dioxa-octanoic acid, NH 2 (CH 2 ) 2 0(CH 2 ) 2 0CH 2 C0 2 H.
- the substituent of formula Acy-AA2 m -AA3p- is represented by:
- the substituent of formula Acy-AA2 m -AA3p- is represented by:
- the substituent of formula Acy-AA2 m -AA3 p - is represented by:
- the substituent of formula Acy-AA2 m -AA3p- is represented by: Any of the above non-limiting examples of the substituent of formula Acy-AA2 m - AA3 P - can be attached to an epsilon amino group of a lysine residue present in any of the compounds of the invention thereby giving further specific examples of acylated compounds of this invention.
- the desired group of the formula Acy-AA2 m -AA3p- can be introduced by any convenient method and many methods are disclosed in the prior art for such reactions.
- the EGF(A)-insulin fusion compound derivative of Example 1 is named“EGF(A)(301 L, 309R, 312E, 321 E)-[GAQP]2- lnsulin(B3E, B29K(hexadecanedioyl-gGlu-2xOEG), desB30)” to indicate that the EGF(A) peptide contains the substitutions 301 L, 309R, 312E, 321 E relative to native EGF(A), the insulin peptide contains the substitutions B3E and desB30, and the lysine in the insulin B29 position has been derivatised (acylated) with the hexadecanedioyl-gGlu-2xOEG moiety.
- the spacer connecting the C-terminal residue of the EGF(A) peptide with the N-terminal residue of the insulin B-chain has the sequence (GAQP)2, which also can be denoted GAQPGAQP or 2xGAQP or [GAQP]2.
- the spacer connecting the C-terminal residue of the EGF(A) peptide with the N-terminal residue of the insulin B-chain has the sequence (GAQP)-io, which also can be denoted 10xGAQP, [GAQP]10 or
- the invention relates to compounds selected from the group of fusion proteins of examples 1 to 24.
- the invention relates to compounds selected from the group of fusion proteins of example 1.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 2-5, 8-15 and 17-21.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 6, 7, 16, 22, 23 and 24.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1-4, 5-14 and 16-24.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1-18.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1 and 3-17.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1 and 3-16.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1 and 3-12.
- the invention relates to compounds selected from the group of fusion proteins of examples independently selected from 1 and 3-8.
- the invention relates to fusion peptide of example 1 :
- the invention relates to fusion peptide of example 3:
- the invention relates to fusion peptide of example 4:
- the invention relates to fusion peptide of example 5:
- the invention relates to fusion peptide of example 6:
- the invention relates to fusion peptide of example 7:
- the invention relates to fusion peptide of example 8:
- the invention relates to fusion peptide of example 9:
- the invention relates to fusion peptide of example 10:
- the invention relates to fusion peptide of example 1 1 :
- the invention relates to fusion peptide of example 12:
- the invention relates to fusion peptide of example 13:
- the invention relates to fusion peptide of example 14:
- the invention relates to fusion peptide of example 15:
- the invention relates to fusion peptide of example 16:
- the invention relates to fusion peptide of example 17:
- the invention relates to fusion peptide of example 18:
- the invention relates to fusion peptide of example 19:
- the invention relates to fusion peptide of example 20:
- the invention relates to fusion peptide of example 21 :
- the invention relates to fusion peptide of example 22:
- the invention relates to fusion peptide of example 23:
- the invention relates to fusion peptide of example 24:
- the invention furthermore relates to an intermediate product in the form of a novel backbone, to which the substituents of the invention are attached, which leads to the fusion peptides of the invention.
- the invention also relates to an intermediate product in the form of the novel backbone of the fusion peptides of the present invention, selected from the group consisting of:
- the analogues may be tested as described below.
- the relative binding affinity of insulin analogues for the human insulin receptor can be determined by competition binding in a scintillation proximity assay (SPA) as described in Example 25.
- the fusion peptides of the invention have the ability to bind to the insulin receptor.
- the lipogenesis assay described in Example 26 can be used as a measure of the functional (agonistic) activity of an insulin analogue.
- the fusion peptides of the invention comprising an insulin analogue have the ability to bind to and activate the insulin receptor.
- the fusion peptides of the invention have the ability to reduce blood glucose levels.
- the fusion peptides of the present invention can be tested for pharmacokinetic parameters and/or insulin related pharmacodynamic properties as described in Examples 29 and 30.
- the fusion peptides of the invention can be tested by subcutaneous administration to rats, e.g. comparing with comparator fusion compounds and/or similar B29K acylated insulin analogues according to this protocol.
- the fusion peptides of the present invention lower blood glucose levels.
- the fusion peptides of the present invention show comparable blood glucose reductions relative to similar B29K acylated insulin analogues.
- the fusion peptides of the present invention comprise spacers with uncharged spacers (GQAP)n or (GAQP)n, with surprising superior blood glucose reduction relative to comparator compounds comprising charged spacers (GQEP)n.
- EGF (A) peptide analogues have the ability to bind to PCSK9. Such binding may be assessed using the assay described in example 27 herein.
- the fusion proteins of the present invention are PCSK9 inhibitors.
- the fusion protein of the invention inhibits PCSK9 binding to human Low Density Lipoprotein Receptor (LDL-R).
- the invention provides a fusion protein comprising an EGF(A) peptide analogue of SEQ ID NO:1 , wherein the fusion protein is capable of inhibiting PCSK9 binding to human Low Density Lipoprotein Receptor (LDL-R).
- the fusion proteins of the invention have the ability to inhibit PCSK9 binding to the LDL-R.
- the fusion proteins of the invention have the ability to inhibit PCSK9 binding to the LDL-R and reduce LDL levels in the blood.
- the fusion proteins of the invention reduce LDL blood levels.
- the fusion proteins of the present have an improved ability to bind to PCSK9 compared to native LDL-R(293-332) ( (SEQ ID NO: 1 , native EGF-(A)). In one embodiment, the fusion proteins of the present invention have comparable ability to bind to PCSK9 relative to LDL-R(293-332) EGF(A) analogue: (301 Leu, 309Arg, 312Glu, 321 Glu) (comparator fusion protein 9).
- the K, of the fusion proteins of the invention as described herein as measured in the PCSK9-LDL-R binding competitive ELISA assay is below 20 nM, such as below 15 nM, or such as below 10 nM, or such as below 5 nM.
- the K, of the fusion proteins of the invention as described herein as measured in the PCSK9-LDL-R binding competitive ELISA assay is below 5 nM.
- EGF-(A) analogue within the fusion proteins of the invention and derivatives hereof may be further characterized by their ability to improve LDL uptake, such as described in example 28 herein.
- the fusion proteins of the invention increase LDL uptake in the presence of PCSK9.
- the fusion proteins of the invention are capable of reversing or reducing PCSK9 mediated reduction of LDL uptake.
- the fusion proteins of the invention have an EC50, as measured in the LDL uptake assay, below 1500 nM, such as below 1000 nM, such as below 500 nM or such as below 200 nM.
- the fusion proteins of the invention have an EC50, as measured in the LDL uptake assay, below 1500 nM.
- the fusion proteins of the invention have an EC50, as measured in the LDL uptake assay, below 500 nM.
- the fusion proteins of the invention have an EC50, as measured in the LDL uptake assay, below 200 nM. It was found that hPCSK9 administered to mice resulted in an almost complete down regulation of the hepatic LDL receptor protein (Figure 12). The insulin-EGF(A) fusion protein effectively prevented this PCSK9-mediated down regulation of the LDLr protein in a dose-dependent way. Furthermore, it was shown that two insulin-EGF(A)fusion proteins were able to prevent the hPCSK9-mediated down regulation of LDLr protein similar to what was seen with the EGF(A) derivative alone ( Figure 14).
- Dual-activity meaning an increase in the LDL receptor expression level in mouse liver by inhibiting the action of intravenously injected hPCSK9 with an insulin-EGF(A) based anti-PCSK9 peptide and glucose lowering effect by the insulin part of the molecule.
- the selected compounds were found to lower blood glucose and prevent the hPCSK9-mediated down regulation of LDLr protein similar to what was seen with an EGF(A) derivative alone.
- the fusion protein of the present invention activates the insulin receptor.
- the fusion protein of the present invention lowers blood glucose.
- the fusion protein of the present invention showed superior blood glucose reduction compared to comparator fusion proteins.
- the fusion protein of the present invention showed improved blood glucose reduction compared to comparator fusion proteins.
- the fusion protein of the present invention binds to PCSK9.
- the fusion protein of the present invention inhibits PCKS9 binding to the LDL-R.
- the fusion protein of the present invention shows an improved ability to bind PCSK9 compared to wild type EGF(A).
- the fusion protein of the present invention has a Ki below 20 nM, when measured in the PCSK9-LDL-R binding competitive ELISA assay.
- the fusion protein of the present invention has a Ki below 5 nM, when measured in the PCSK9-LDL-R binding competitive ELISA assay.
- the fusion protein of the present invention increases LDL uptake. In one embodiment, the fusion protein of the present invention has an EC50 below 1000 nM when measured in the LDL uptake assay.
- the fusion protein of the present invention has an EC50 below 500 nM when measured in the LDL uptake assay.
- the fusion protein of the present invention has an EC50 below 200 nM when measured in the LDL uptake assay.
- the bi-functional fusion proteins of the present invention have been found, in in vitro assays, to bind to both the insulin receptor and PCSK9 resulting in activation of the insulin response and prevention of PCSK9 binding and thereby degradation of the LDLR. Furthermore, the inventors surprisingly found a combined effect on glucose lowering (insulin effect) and enhancement of hepatic LDLR expression (PCSK9i effect) in vivo.
- the fusion proteins of the present invention comprising an uncharged spacer show superior blood glucose reduction relative to comparator fusion proteins comprising charged spacers (GQEP)n and even further that the level of reduction is dependent on the length of said uncharged spacer.
- the invention also relates to pharmaceutical compositions comprising a fusion protein of the invention, including e.g. an analogue of the invention, or a pharmaceutically acceptable salt, amide, or ester thereof, and one or more pharmaceutically acceptable excipient (s).
- a fusion protein of the invention including e.g. an analogue of the invention, or a pharmaceutically acceptable salt, amide, or ester thereof, and one or more pharmaceutically acceptable excipient (s).
- Such compositions may be prepared as is known in the art.
- excipient broadly refers to any component other than the active therapeutic ingredient(s).
- the excipient may be an inert substance, an inactive substance, and/or a not medicinally active substance.
- the excipient may serve various purposes, e.g. as a carrier, vehicle, diluent, tablet aid, and/or to improve administration, and/or absorption of the active substance.
- Non-limiting examples of excipients are: solvents, diluents, buffers, preservatives, tonicity regulating agents, chelating agents, and stabilisers.
- the formulation of pharmaceutically active ingredients with various excipients is known in the art, see e.g. Remington: The Science and Practice of Pharmacy (e.g. 21 st edition (2005), and any later editions).
- a composition of the invention may be in the form of a liquid formulation, i.e.
- Aqueous formulation comprising water.
- a liquid formulation may be a solution, or a suspension. Alternatively, it may be a solid formulation, e.g. a freeze-dried or spray-dried composition.
- a pharmaceutical composition of the invention may further comprise a second active ingredient, such as a therapeutic agent, which may simplify administration in case of combination treatments.
- a composition of the invention may be for parenteral administration, e.g. performed by subcutaneous, intramuscular, intraperitoneal, or intravenous injection.
- diabetes or“diabetes mellitus” includes type 1 diabetes, type 2 diabetes, gestational diabetes (during pregnancy) and other states that cause hyperglycaemia.
- the term is used for a metabolic disorder in which the pancreas produces insufficient amounts of insulin, or in which the cells of the body fail to respond appropriately to insulin thus preventing cells from absorbing glucose. As a result, glucose builds up in the blood.
- Type 1 diabetes also called insulin-dependent diabetes mellitus (IDDM) and juvenile-onset diabetes, is caused by B-cell destruction, usually leading to absolute insulin deficiency.
- IDDM insulin-dependent diabetes mellitus
- juvenile-onset diabetes is caused by B-cell destruction, usually leading to absolute insulin deficiency.
- Type 2 diabetes also known as non-insulin-dependent diabetes mellitus (NIDDM) and adult-onset diabetes, is associated with predominant insulin resistance and thus relative insulin deficiency and/or a predominantly insulin secretory defect with insulin resistance.
- NIDDM non-insulin-dependent diabetes mellitus
- adult-onset diabetes is associated with predominant insulin resistance and thus relative insulin deficiency and/or a predominantly insulin secretory defect with insulin resistance.
- a fusion protein according to the invention is used for the preparation of a medicament for the treatment or prevention of hyperglycemia including stress induced hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes.
- a fusion protein according to the invention is used as a medicament for delaying or preventing disease progression in type 2 diabetes.
- the fusion protein is for use as a medicament for the treatment or prevention of hyperglycemia including stress induced hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes.
- the invention is related to a method for the treatment or prevention of hyperglycemia including stress induced hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, the method comprising administering to a patient in need of such treatment an effective amount for such treatment of a fusion protein according to the invention.
- a fusion protein of the invention or a composition thereof may be used in a patient with diabetes for:
- the present invention relates to a method for treatment in a patient with diabetes for:
- lipid parameters such as prevention and/or treatment of dyslipidemia, lowering total serum lipids; increasing HDL-C; lowering LDL-C, lowering small, dense LDL-C; lowering VLDL-C; lowering triglycerides; lowering cholesterol; lowering plasma levels of lipoprotein a (Lp(a)); ; wherein a pharmaceutically active amount of a fusion protein according to the invention, e.g. a peptide analogue or a derivative according to the invention, is administered to a patient with diabetes.
- a pharmaceutically active amount of a fusion protein according to the invention e.g. a peptide analogue or a derivative according to the invention
- the invention relates to the use of a fusion protein as described herein for use in the manufacture of a medicament.
- the invention also relates to a fusion protein of the invention, or a pharmaceutical composition thereof for use as a medicament or in the manufacture of a medicament.
- treatment is meant to include both the prevention and minimization of the referenced disease, disorder, or condition (i.e., “treatment” refers to both prophylactic and therapeutic administration of a fusion protein of the present invention or composition comprising a fusion protein of the present invention unless otherwise indicated or clearly contradicted by context.
- the route of administration may be any route which effectively transports a fusion protein of this invention to the desired or appropriate place in the body, such as parenterally, for example, subcutaneously, intramuscularly or intraveneously.
- a fusion protein of this invention can be administered orally, pulmonary, rectally, transdermally, buccally, sublingually, or nasally.
- a fusion protein comprising an insulin peptide, an EGF(A) peptide, a spacer and a
- said insulin peptide is human insulin (SEQ ID NOs 2-3) or an analogue of human insulin
- said EGF(A) peptide is an analogue of the EGF(A) domain of LDL-R (293-332) (SEQ ID NO:1 )
- said substituent is of formula (I): Acy-AA2 m -AA3 p -, wherein
- Acy is a fatty diacid comprising from about 16 to about 20 carbon atoms
- AA2 is an acidic amino acid residue and wherein m is an integer in the range from 1 to 10 and
- AA3 is a neutral, alkyleneglycol-containing amino acid residue and p is an integer in the range from 1 to 10, and
- EGF(A) analogue comprises 1-15 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises 1-13 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises 1-1 1 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises 1-9 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises 1-5 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises 1-3 amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises one or two amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises eight amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises seven amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises six amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises five amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises four amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises three amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises two amino acid mutation(s) compared to SEQ ID NO.:1.
- EGF(A) analogue comprises one of the following combinations below:
- the fusion protein according to embodiment 22, wherein the EGF(A) analogue comprises 301 L, 309R and 312E.
- the fusion protein according to embodiment 22, wherein the EGF(A) analogue comprises 301 L, 309R, 312E and 321 E.
- insulin analogue/derivative is an analogue/derivative of human insulin comprising 0-10 mutations.
- fusion protein according to any of the previous embodiments, wherein the fusion protein activates the insulin receptor and binds to PCSK9.
- fusion protein according to any one of the previous embodiments, wherein said fusion protein comprises a spacer connecting the EGF(A) analogue and the insulin analogue/derivative.
- spacer comprises amide bonds.
- spacer comprises 4-80 amino acid residues.
- spacer comprises one or more of the following amino acid residues: Ala(A), Gly(G), Pro(P) and/or Gln(Q).
- fusion protein according to any of the previous embodiments, wherein said fusion protein comprises one substituent.
- said substituent is attached via a Lys/K amino acid residue.
- AA3p of formula (I): Acy-AA2 m -AA3p- comprises 2xOEG.
- AA2 m - AA3 P - of formula (I): Acy-AA2 m -AA3p- is represented independently by gGlu-OEG or gGlu-OEG-OEG.
- AA2 m -AA3 p - of formula (I): Acy- AA2 m -AA3p-, is represented by gGlu-OEG.
- AA3 P - is represented independently by C20 diacid-gGlu-2xOEG.
- fusion protein according to any of the previous embodiments, wherein the fusion protein activates the insulin receptor.
- fusion protein according to any of the previous embodiments, wherein the fusion protein has the ability to lower blood glucose.
- fusion protein according to any of the previous embodiments, wherein the fusion protein showed superior blood glucose reduction compared to comparator fusion proteins.
- fusion protein according to any of the previous embodiments, wherein the fusion protein showed improved blood glucose reduction compared to comparator fusion proteins.
- fusion protein according to any of the previous embodiments, wherein the fusion protein has an improved ability to bind PCSK9 compared to wild type EGF(A).
- fusion protein according to any of the previous embodiments, wherein the Ki of the fusion protein, when measured in the PCSK9-LDL-R binding competitive ELISA assay is below 20 nM.
- fusion protein according to any of the previous embodiments, wherein the Ki of the fusion protein, when measured in the PCSK9-LDL-R binding competitive ELISA assay is below 5 nM.
- fusion protein according to any of the previous embodiments, wherein the fusion protein increases LDL uptake.
- fusion protein according to any of the previous embodiments, wherein the fusion protein has an EC50 below 1000 nM when measured in the LDL uptake assay.
- fusion protein according to any of the previous embodiments, wherein the fusion protein has an EC50 below 500 nM when measured in the LDL uptake assay.
- fusion protein according to any of the previous embodiments, wherein the fusion protein has an EC50 below 200 nM when measured in the LDL uptake assay.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 1-24.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of example 1.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 1-24.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 2-5, 8-15 and 17-21.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 6, 7, 16, 22, 23 and 24.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 1-4, 5-14 and 16-24.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 1 and 3-12.
- fusion protein according to any of the previous embodiments, wherein said fusion protein is represented by fusion proteins of examples 1 and 3-8.
- the fusion protein according to any of the previous embodiments, for use as a medicament.
- the fusion protein according to any of the previous embodiments, for use in the prevention or treatment of a cardiovascular disease in diabetic patients.
- triglycerides lowering cholesterol, lowering plasma levels of lipoprotein a (Lp(a)) or inhibiting generation of apolipoprotein A (apo(A)).
- a pharmaceutical composition comprising a fusion protein according to any of
- embodiments 1-1 18, and a pharmaceutically acceptable excipient are provided.
- a pharmaceutical composition for the treatment of diabetes in a patient in need of such treatment comprising a therapeutically effective amount of a fusion protein according to any one of embodiments 1-118, together with a pharmaceutically acceptable carrier.
- composition of embodiment 122 for use as a medicament.
- composition of embodiment 122 for use in the treatment of patients with diabetes and high risk of cardiovascular disease.
- diabetes of Type 1 diabetes of Type 2
- diabetes of Type 2 impaired glucose tolerance, hyperglycemia, dyslipidemia.
- a method for improving lipid parameters comprising a step of administering a
- a method for improving lipid parameters a patient with diabetes comprising a step of administering a pharmaceutically active amount of a fusion protein according to any of the previous embodiments 1- 118, such as prevention and/or treatment of dyslipidemia, lowering total serum lipids; increasing HDL; lowering LDL-C; lowering small, dense LDL- C; lowering VLDL-C; non_HDL-C; lowering triglycerides; lowering cholesterol; lowering plasma levels of lipoprotein a (Lp(a)).
- An insulin analogue according to any of the previous embodiments 1- 118 for use in a method of treatment in a patient with diabetes for: improving lipid parameters, such as prevention and/or treatment of dyslipidemia, lowering total serum lipids, increasing HDL-C, lowering LDL-C, lowering small, dense LDL-C, lowering VLDL-C, lowering triglycerides, lowering cholesterol, lowering plasma levels of lipoprotein a (Lp(a)) or inhibiting generation of apolipoprotein A (apo(A)); and prevention and/or treatment of cardiovascular diseases. .
- a method for prevention and/or treatment of a cardiovascular disease in diabetes patients comprising a step of administering a pharmaceutically active amount of a fusion protein according to any of the previous embodiments 1- 118.
- API Active Pharmaceutical Ingredient
- DIPEA DIEA / ⁇ /,/ ⁇ /-disopropylethylamine
- EGF Epidermal growth factor-like
- EGF(A) Epidermal growth factor-like domain A eps: epsilon
- HCI hydrochloric acid HDL High density lipoprotein
- hLDL-R human LDL receptor
- HSA Human Serum Albumin
- IGF-1 insulin-like growth factor 1 receptor
- IP intra peritoneal
- LDL-R or LDLr LDL receptor
- LDL low density lipoprotein
- LDL-C LDL cholesterol
- NMP N-methyl pyrrolidone
- PBS Phosphate Buffered Saline
- PD pharmacodynamics e.g. blood/plasma glucose lowering effect
- rhLDL-R recombinant human LDL receptor
- TCTU 0-(6-Chlorobenzotriazol-1 -yl)-N,N,N',N'-tetramethyluronium
- THPTA tris-hydroxypropyltriazolylmethylamine
- TIS or TIPS triisopropylsilane
- TRIS tris(hydroxymethyl)aminomethane or 2-amino-2-hydroxymethyl-propane- 1 ,3-diol
- TBS-T Tris buffered saline
- the analogues i.e the two-chain non-acylated insulin EGF(A) fusion proteins can either be expressed in e-coli or in yeast as further described below. Recombinant expression of EGF(A) Insulin fusion compound analogues in E. coli and purification
- EGF(A) Insulin fusion protein analogues can be well expressed in E.coli as inclusion bodies (IB).
- the cDNA of Insulin-EGF(A) fusion protein analogues was sub-cloned into a pET 1 1 b derived vector, and then the plasmids were transformed into a BL21 (DE3) derived host strain.
- Fermentation was carried out on fed-batch process in chemical defined medium.
- insulin-EGF(A) fusion protein analogues were further purified as below:
- the solution was diluted 10 times by 20 mM glycine, 1 mM cysteine, 10mM CaCI2, pH 10.5 for refolding, which would be completed in 6-10 hours at room temperature.
- Q Sepharose Big-beads (20 mM Tris, 10 mM CaCh, 10% EtOH, pH 8.0) was used to capture the protein. Thereafter, the elution pool was treated by ALP at the ratio of 1 :1000 for 3-4 hours at room temperature. The cleaved protein was then applied to the Source 30RPC for separation.
- Source 30Q (20 mM Tris, 10 mM CaCh, 10% EtOH, pH 8.0) using a shallow NaCI gradient was employed.
- the EGF(A) insulin fusion analogues are expressed and cultivated by wellknown techniques e.g. as disclosed in WO2017/032798. More specifically, the insulin-EGF(A) fusion proteins are prepared and purified as follows:
- the yeast supernatant was loaded with a flow of 10-20 cv/h onto a column packed with SP Sepharose BB. A wash with 0,1 M citric acid pH 3,5 and a wash with 40% EtOH were performed. The analogue was eluted with 0,2 M Na-Acetate pH 5,5 / 35% EtOH. Reshuffling of disulphide bridges:
- the SP-pool was adjusted to pH 9. Reshuffling reagents were added to final concentration; cysteine 2,5mM, cystine 0,25 mM and CaCI2 25 mM and followed on UPLC.
- Reshuffling pool was adjusted to pH 9 and ALP enzyme was added 1 :100 (w/w). Reaction followed on UPLC. ALP cleavage pool was adjusted to pH 2,5 and diluted 2x in order to be prepared for RPHPLC purification.
- the gradient 20-55% B-buffer.
- reaction may not be applicable as described to each compound included within the disclosed scope of the invention.
- the compounds for which this occurs will be readily recognised by those skilled in the art.
- the reactions can be successfully performed by conventional modifications known to those skilled in the art, i.e. by appropriate protection of interfering groups, by changing to other conventional reagents, or by routine modification of reaction conditions.
- other reactions disclosed herein or otherwise conventional will be applicable to the preparation of the corresponding compounds of the invention.
- all starting materials are known or may easily be prepared from known starting materials. All temperatures are set forth in degrees Celsius and unless otherwise indicated, all parts and percentages are by weight when referring to yields and all parts are by volume when referring to solvents and eluents.
- UV Detector UV: PDA , SQD 2000
- Solvent A 99,90 % H20, 0.1 % TFA
- Solvent B 99.90 % CH3CN, 0.1 % TFA
- UV Detector UV: PDA , SQD 2000
- Solvent A 99,90 % H20, 0.1 % TFA
- Solvent B 99.90 % CH3CN, 0.1 % TFA
- Solvent A 99.90 % H20, 0.02% TFA
- Solvent B 99.90 % CH3CN, 0.02% TFA
- Calculated Mass is the average molecular weight of the desired compound.
- Step gradient 5 % to 90 % B
- Solvent A 99.90 % H20, 0.02% TFA
- Solvent B 99.90 % CH3CN, 0.02% TFA
- Calculated Mass is the average molecular weight of the desired compound.
- the insulin-EGF(A) fusion protein is dissolved in an aqueous buffer, optionally added an organic co-solvent (e.g. EtOH, acetonitrile, DMSO, or NMP), and pH is adjusted to 11.2.
- an organic co-solvent e.g. EtOH, acetonitrile, DMSO, or NMP
- a solution of the activated side chain in NMP (100 mg/ml_) is added dropwise while keeping pH around 1 1.2 by addition of 1 M NaOH, and the progress of the reaction is monitored by LC- MS.
- acetic acid or 1 M HCI is added to the mixture. After dilution with water the mixture is purified by preparative HPLC. Pure fractions are pooled and lyophilised to afford the compound of the invention.
- Example 1 This general procedure is further illustrated in example 1 below. All other compounds of the invention were prepared similarly. Example 1
- Buffer A 0.1 % TFA in milliQ water
- Buffer B 0.1 % TFA in acetonitrile
- This compound was prepared as described in W02017121850.
- Insulin receptor affinity of selected insulin derivatives of the invention measured on solubilised receptors
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19783295.9A EP3861017A1 (en) | 2018-10-05 | 2019-10-04 | Bifunctional compounds comprising insulin peptides and egf(a) peptides |
| US17/281,813 US11649269B2 (en) | 2018-10-05 | 2019-10-04 | Bifunctional compounds comprising insulin peptides and EGF(A) peptides |
| JP2021518432A JP7434299B2 (ja) | 2018-10-05 | 2019-10-04 | インスリンペプチドおよびegf(a)ペプチドを含む二官能性化合物 |
| CN201980064514.4A CN112789289A (zh) | 2018-10-05 | 2019-10-04 | 包含胰岛素肽和egf(a)肽的双功能化合物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18198892.4 | 2018-10-05 | ||
| EP18198892 | 2018-10-05 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020070276A1 true WO2020070276A1 (en) | 2020-04-09 |
Family
ID=64017248
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2019/076889 Ceased WO2020070276A1 (en) | 2018-10-05 | 2019-10-04 | Bifunctional compounds comprising insulin peptides and egf(a) peptides |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US11649269B2 (https=) |
| EP (1) | EP3861017A1 (https=) |
| JP (1) | JP7434299B2 (https=) |
| CN (1) | CN112789289A (https=) |
| AR (1) | AR116605A1 (https=) |
| MA (1) | MA53809A (https=) |
| TW (1) | TW202028229A (https=) |
| WO (1) | WO2020070276A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11186623B2 (en) | 2019-12-24 | 2021-11-30 | Akston Bioscience Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11192930B2 (en) | 2020-04-10 | 2021-12-07 | Askton Bioscences Corporation | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US11198719B2 (en) | 2020-04-29 | 2021-12-14 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US11213581B2 (en) | 2020-04-10 | 2022-01-04 | Akston Biosciences Corporation | Antigen specific immunotherapy for COVID-19 fusion proteins and methods of use |
| US11261229B2 (en) | 2018-06-29 | 2022-03-01 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11267862B2 (en) | 2018-06-29 | 2022-03-08 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11352407B2 (en) | 2019-12-19 | 2022-06-07 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins |
| US11359001B2 (en) | 2016-12-09 | 2022-06-14 | Akston Biosciences Corporation | Insulin-Fc fusions and methods of use |
| US11667689B2 (en) | 2021-07-23 | 2023-06-06 | Akston Biosciences Corporation | Insulin-Fc fusion proteins and methods of use to treat cancer |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114729060B (zh) | 2020-09-30 | 2022-11-25 | 北京质肽生物医药科技有限公司 | 多肽缀合物和使用方法 |
| EP4323413A4 (en) | 2022-03-30 | 2025-10-15 | Beijing Ql Biopharmaceutical Co Ltd | LIQUID PHARMACEUTICAL COMPOSITIONS OF POLYPEPTIDE CONJUGATES AND METHODS OF USE THEREOF |
| CN115947822B (zh) * | 2022-07-04 | 2023-08-18 | 北京惠之衡生物科技有限公司 | 一种长效酰化胰岛素衍生物及其药物组合物和应用 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009022006A1 (en) | 2007-08-15 | 2009-02-19 | Novo Nordisk A/S | Insulins with an acyl moiety comprising repeating units of alkylene glycol containing amino acids |
| WO2009115469A1 (en) | 2008-03-18 | 2009-09-24 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| WO2011117401A1 (en) * | 2010-03-25 | 2011-09-29 | Istituto Di Ricerche Di Biologia Molecolare P. Angeletti S.R.L. | Use of pcsk9 as a vaccine for lowering cholesterol |
| WO2012177741A1 (en) | 2011-06-20 | 2012-12-27 | Genentech, Inc. | Pcsk9-binding polypeptides and methods of use |
| WO2015127273A1 (en) | 2014-02-21 | 2015-08-27 | Medimmune, Llc | Anti-pcsk9~glp-1 fusions and methods for use |
| WO2017032798A1 (en) | 2015-08-25 | 2017-03-02 | Novo Nordisk A/S | Novel insulin derivatives and the medical uses hereof |
| WO2017121850A1 (en) | 2016-01-13 | 2017-07-20 | Novo Nordisk A/S | Egf(a) analogues with fatty acid substituents |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX2010011499A (es) | 2008-04-23 | 2010-11-12 | Amgen Inc | Variantes de proproteina neutralizante de convertasa subtilisina kexina de tipo 9 (pcsk9) y sus usos. |
| CN104558199B (zh) | 2014-09-05 | 2018-07-06 | 成都康弘生物科技有限公司 | 一种治疗高胆固醇血症的融合蛋白制备及其用途 |
| WO2016164762A1 (en) | 2015-04-08 | 2016-10-13 | Moderna Therapeutics, Inc. | Polynucleotides encoding low density lipoprotein receptor egf-a and intracellular domain mutants and methods of using the same |
-
2019
- 2019-10-04 WO PCT/EP2019/076889 patent/WO2020070276A1/en not_active Ceased
- 2019-10-04 EP EP19783295.9A patent/EP3861017A1/en not_active Withdrawn
- 2019-10-04 US US17/281,813 patent/US11649269B2/en active Active
- 2019-10-04 TW TW108135986A patent/TW202028229A/zh unknown
- 2019-10-04 MA MA053809A patent/MA53809A/fr unknown
- 2019-10-04 JP JP2021518432A patent/JP7434299B2/ja active Active
- 2019-10-04 CN CN201980064514.4A patent/CN112789289A/zh not_active Withdrawn
- 2019-10-04 AR ARP190102838A patent/AR116605A1/es unknown
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009022006A1 (en) | 2007-08-15 | 2009-02-19 | Novo Nordisk A/S | Insulins with an acyl moiety comprising repeating units of alkylene glycol containing amino acids |
| WO2009115469A1 (en) | 2008-03-18 | 2009-09-24 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| WO2011117401A1 (en) * | 2010-03-25 | 2011-09-29 | Istituto Di Ricerche Di Biologia Molecolare P. Angeletti S.R.L. | Use of pcsk9 as a vaccine for lowering cholesterol |
| WO2012177741A1 (en) | 2011-06-20 | 2012-12-27 | Genentech, Inc. | Pcsk9-binding polypeptides and methods of use |
| WO2015127273A1 (en) | 2014-02-21 | 2015-08-27 | Medimmune, Llc | Anti-pcsk9~glp-1 fusions and methods for use |
| WO2017032798A1 (en) | 2015-08-25 | 2017-03-02 | Novo Nordisk A/S | Novel insulin derivatives and the medical uses hereof |
| WO2017121850A1 (en) | 2016-01-13 | 2017-07-20 | Novo Nordisk A/S | Egf(a) analogues with fatty acid substituents |
Non-Patent Citations (6)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 2005 |
| BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 375, 2008, pages 69 - 73 |
| GLENDORF T ET AL., BIOCHEMISTRY, vol. 47, 2008, pages 4743 - 4751 |
| J. MOL. BIOL., vol. 422, 2012, pages 685 - 696 |
| VOLUND A, BIOMETRICS, vol. 34, 1978, pages 357 - 365 |
| YINGNAN ZHANG ET AL: "Calcium-Independent Inhibition of PCSK9 by Affinity-Improved Variants of the LDL Receptor EGF(A) Domain", JOURNAL OF MOLECULAR BIOLOGY, vol. 422, no. 5, 1 October 2012 (2012-10-01), pages 685 - 696, XP055199848, ISSN: 0022-2836, DOI: 10.1016/j.jmb.2012.06.018 * |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11359001B2 (en) | 2016-12-09 | 2022-06-14 | Akston Biosciences Corporation | Insulin-Fc fusions and methods of use |
| US11773151B2 (en) | 2018-06-29 | 2023-10-03 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11261229B2 (en) | 2018-06-29 | 2022-03-01 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11267862B2 (en) | 2018-06-29 | 2022-03-08 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11673934B2 (en) | 2018-06-29 | 2023-06-13 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11555058B2 (en) | 2019-12-19 | 2023-01-17 | Akston Biosciences Corporation | Cells engineered to express ultra-long acting insulin-Fc fusion proteins |
| US12606605B2 (en) | 2019-12-19 | 2026-04-21 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11352407B2 (en) | 2019-12-19 | 2022-06-07 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins |
| US11919935B2 (en) | 2019-12-24 | 2024-03-05 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11186623B2 (en) | 2019-12-24 | 2021-11-30 | Akston Bioscience Corporation | Ultra-long acting insulin-Fc fusion proteins and methods of use |
| US11707517B2 (en) | 2020-04-10 | 2023-07-25 | Akston Biosciences Corporation | Antigen specific immunotherapy for COVID-19 fusion proteins and methods of use |
| US11192930B2 (en) | 2020-04-10 | 2021-12-07 | Askton Bioscences Corporation | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US11814418B2 (en) | 2020-04-10 | 2023-11-14 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US12240881B2 (en) | 2020-04-10 | 2025-03-04 | Dechra Limited | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US12343393B2 (en) | 2020-04-10 | 2025-07-01 | Vakston, Inc. | Antigen specific immunotherapy for COVID-19 fusion proteins and methods of use |
| US11213581B2 (en) | 2020-04-10 | 2022-01-04 | Akston Biosciences Corporation | Antigen specific immunotherapy for COVID-19 fusion proteins and methods of use |
| US11198719B2 (en) | 2020-04-29 | 2021-12-14 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion protein and methods of use |
| US12195511B2 (en) | 2020-04-29 | 2025-01-14 | Akston Biosciences Corporation | Ultra-long acting insulin-Fc fusion protein |
| US11667689B2 (en) | 2021-07-23 | 2023-06-06 | Akston Biosciences Corporation | Insulin-Fc fusion proteins and methods of use to treat cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022504153A (ja) | 2022-01-13 |
| TW202028229A (zh) | 2020-08-01 |
| US11649269B2 (en) | 2023-05-16 |
| US20220009989A1 (en) | 2022-01-13 |
| AR116605A1 (es) | 2021-05-26 |
| EP3861017A1 (en) | 2021-08-11 |
| JP7434299B2 (ja) | 2024-02-20 |
| MA53809A (fr) | 2022-01-12 |
| CN112789289A (zh) | 2021-05-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11649269B2 (en) | Bifunctional compounds comprising insulin peptides and EGF(A) peptides | |
| CN112074531B (zh) | Gip衍生物及其用途 | |
| JP6657230B2 (ja) | インクレチン−インスリンコンジュゲート | |
| JP6538645B2 (ja) | インスリン‐インクレチン複合物 | |
| KR102824306B1 (ko) | 인크레틴 유사체 및 그의 용도 | |
| KR102002783B1 (ko) | 포도당 의존성 인슐리노트로핀 폴리펩타이드 유사물질, 이의 약학적 조성물 및 응용 | |
| CA2893445C (en) | Glucagon/glp-1 agonists for the treatment of obesity | |
| KR20110040760A (ko) | 대사 질환 및 비만 치료용 gip-기초된 혼합형 항진제 | |
| KR20110039230A (ko) | 생리학적 pH 완충액에서 강화된 용해도 및 안정성을 나타내는 글루카곤 유사체 | |
| CA2677932A1 (en) | Glucagon/glp-1 receptor co-agonists | |
| CA2674354A1 (en) | Glucagon analogs exhibiting enhanced solubility in physiological ph buffers | |
| JP2012530145A (ja) | Gip受容体活性グルカゴン化合物 | |
| AU2012234276A1 (en) | Novel glucagon analogues | |
| AU2013323669A1 (en) | Insulin analog dimers | |
| WO2016131893A1 (en) | Incretin fusion polypeptides | |
| EP3448417A1 (en) | Insulin dimer-incretin conjugates | |
| CN104968674A (zh) | 具有胆固醇流出活性的新颖的glp-1受体激动剂 | |
| KR20180016441A (ko) | 프로테아제-내성 지질화 glp-1 유사체 | |
| EP4658674A1 (en) | Gip/glp1/gcg tri-receptor agonists and uses thereof | |
| JP2026031900A (ja) | Fc-アシル化ポリペプチドコンジュゲート | |
| EA049440B1 (ru) | Новые аналоги инсулина и варианты их применения |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19783295 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021518432 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2019783295 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2019783295 Country of ref document: EP Effective date: 20210506 |