WO2020016318A1 - Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins - Google Patents

Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins Download PDF

Info

Publication number
WO2020016318A1
WO2020016318A1 PCT/EP2019/069280 EP2019069280W WO2020016318A1 WO 2020016318 A1 WO2020016318 A1 WO 2020016318A1 EP 2019069280 W EP2019069280 W EP 2019069280W WO 2020016318 A1 WO2020016318 A1 WO 2020016318A1
Authority
WO
WIPO (PCT)
Prior art keywords
disease
protein
vector
subject
viral vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2019/069280
Other languages
English (en)
French (fr)
Inventor
Sébastien Lacroix-Desmazes
Federico Mingozzi
Jordan Dimitrov
Christian Leborgne
Sean ARMOUR
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institut National de la Sante et de la Recherche Medicale INSERM
Universite Paris Descartes
Universite Paris Diderot Paris 7
Genethon
Sorbonne Universite
Spark Therapeutics Inc
Original Assignee
Institut National de la Sante et de la Recherche Medicale INSERM
Universite Paris Descartes
Universite Paris Diderot Paris 7
Genethon
Sorbonne Universite
Spark Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=67303476&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2020016318(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to US17/050,911 priority Critical patent/US20210228738A1/en
Priority to UAA202100146A priority patent/UA130604C2/uk
Priority to LTEPPCT/EP2019/069280T priority patent/LT3768304T/lt
Priority to MX2021000580A priority patent/MX2021000580A/es
Priority to CN201980048115.9A priority patent/CN112689515A/zh
Priority to DK19740384.3T priority patent/DK3768304T3/da
Priority to PL19740384.3T priority patent/PL3768304T3/pl
Priority to SG11202100306VA priority patent/SG11202100306VA/en
Priority to KR1020217001502A priority patent/KR20210042308A/ko
Priority to BR112021000807A priority patent/BR112021000807A8/pt
Priority to JP2021502435A priority patent/JP2021529821A/ja
Priority to RS20221191A priority patent/RS63878B1/sr
Priority to EP19740384.3A priority patent/EP3768304B1/en
Priority to CA3106368A priority patent/CA3106368A1/en
Priority to CN202411396316.7A priority patent/CN119345338A/zh
Priority to EP22198839.7A priority patent/EP4154904A1/en
Priority to SI201930426T priority patent/SI3768304T1/sl
Priority to FIEP19740384.3T priority patent/FI3768304T3/fi
Application filed by Institut National de la Sante et de la Recherche Medicale INSERM, Universite Paris Descartes, Universite Paris Diderot Paris 7, Genethon, Sorbonne Universite, Spark Therapeutics Inc filed Critical Institut National de la Sante et de la Recherche Medicale INSERM
Priority to PE2021000066A priority patent/PE20211859A1/es
Priority to HRP20221542TT priority patent/HRP20221542T1/hr
Priority to ES19740384T priority patent/ES2935970T3/es
Priority to SM20230005T priority patent/SMT202300005T1/it
Priority to AU2019306121A priority patent/AU2019306121B2/en
Publication of WO2020016318A1 publication Critical patent/WO2020016318A1/en
Priority to IL280099A priority patent/IL280099A/en
Priority to ZA2021/00202A priority patent/ZA202100202B/en
Priority to CONC2021/0000326A priority patent/CO2021000326A2/es
Priority to PH12021550115A priority patent/PH12021550115A1/en
Anticipated expiration legal-status Critical
Priority to US17/224,367 priority patent/US20210246469A1/en
Priority to US17/862,622 priority patent/US20230142731A1/en
Priority to JP2024051529A priority patent/JP2024075765A/ja
Priority to AU2025217293A priority patent/AU2025217293A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/48Hydrolases (3) acting on peptide bonds (3.4)
    • A61K38/4873Cysteine endopeptidases (3.4.22), e.g. stem bromelain, papain, ficin, cathepsin H
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/48Hydrolases (3) acting on peptide bonds (3.4)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/06Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies from serum
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • C12N15/861Adenoviral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/52Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/58Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from fungi
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6472Cysteine endopeptidases (3.4.22)
    • C12N9/6475Interleukin 1-beta convertase-like enzymes (3.4.22.10; 3.4.22.36; 3.4.22.63)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22Cysteine endopeptidases (3.4.22)
    • C12Y304/22038Cathepsin K (3.4.22.38)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • C12N2310/141MicroRNAs, miRNAs
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22Cysteine endopeptidases (3.4.22)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22Cysteine endopeptidases (3.4.22)
    • C12Y304/2201Streptopain (3.4.22.10)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins

Definitions

  • Adeno-associated virus (AAV) and other viral vectors as well as lipid-, polymer-, and protein-based nanoparticle gene therapy approaches can be targeted by the adaptive immune system, leading to blunted efficacy and the possibility of a patient becoming completely refractory to therapeutic intervention.
  • the adaptive- immune system relies on development of antigen- specific immunoglobulin (e.g ., IgG) antibodies which lead to the inhibition or clearance of the target molecule. Since humans are naturally exposed to wild-type AAV, AAV gene therapy can be hampered by the presence of pre-existing anti-AAV antibodies. Additionally, development of anti-AAV antibodies following AAV gene transfer can prevent redosing with the same or cross reactive vectors.
  • anti-AAV antibodies show a high degree of cross-reactivity with the different AAV serotypes (Boutin et al. (2010) Hum Gene Ther. 21, 704-12).
  • neutralizing antibodies drastically reduce the transduction efficiency, particularly when the vector is delivered directly into the bloodstream (Manno et al. (2006) Nat Med. 12, 342-7; Masat et al. (2013) Discov Med. 15, 379-89; Arruda et al. (2010) Blood. 115, 4678-88; Haurigot et al. (2010) Mol Ther. 18, 1318-29; Jiang et al. (2006) Blood. 108, 3321-8; Scallan et al. (2006) Blood. 107, 1810-7).
  • IdeS Proteolysis of immunoglobulins is a common mechanism used by pathogens in order to circumvent host defense systems (Travis et al. (2000) Biochim Biophys Acta. 1477, 35-50; Travis et al. (1995) Trends Microbiol. 3, 405-7).
  • IdeS is a naturally occurring 35 kDa cysteine protease, specifically an endopeptidase, expressed by the pathogenic bacteria Streptococcus pyogenes that exhibits specificity for its target sequence found in human IgG, in addition to several other species.
  • IdeS is capable of cleaving IgG below the hinge region (von Pawel-Rammingen et al. (2003) Curr Opin Microbiol. 6, 50-5), leading to the generation of F(ab')2 and Fc/2 fragments (Ryan et al. (2008) Mol Immunol. 45, 1837-46).
  • EndoS is a naturally occurring glycosidase, specifically an endoglycosidase, from S. pyogenes , that specifically hydrolyzes glycans from human IgG and alters antibody effector functions, including Fc receptor binding.
  • Described herein are, inter alia, methods for treating patients that may develop or already have pre-existing neutralizing antibodies to gene therapy vectors, by administering a protease that cleaves peptide bonds present in immunoglobulins or by administering a glycosidase that cleaves carbohydrate residues present on immunoglobulins, or other similar enzymatic cleavage of immunoglobulins in vivo.
  • Methods according to the instant invention may be used, inter alia, to treat patients with pre-existing neutralizing antibodies to gene therapy vectors and to re dose patients previously treated with a gene therapy vector.
  • a method of treating a subject in need of treatment for a disease caused by a loss of function or activity of a protein includes: (a) administering to the subject a recombinant viral vector comprising a heterologous polynucleotide that encodes a protein or peptide that provides or supplements a function or activity of the protein; and (b) administering to the subject an amount of a protease or glycosidase effective to degrade or digest and/or inhibit or reduce effector function of antibodies that bind to said recombinant viral vector and/or the protein or peptide encoded by the heterologous polynucleotide.
  • a method of treating a subject in need of treatment for a disease caused by a gain of function activity or expression, of a protein includes: (a) administering to the subject a recombinant viral vector comprising a heterologous polynucleotide that is transcribed into a nucleic acid that inhibits, decreases or reduces expression of the gain of function, activity or expression of said protein; and (b) administering to the subject a protease or glycosidase effective to degrade or digest and/or inhibit or reduce effector function of antibodies that bind to said recombinant viral vector.
  • a method of treating a subject in need of treatment for a disease caused by a loss of function or activity of a protein includes: (a) administering to the subject a protease or glycosidase effective to degrade or digest and/or inhibit or reduce effector function of viral vector binding antibodies; and (b) administering to the subject a recombinant viral vector comprising a heterologous polynucleotide that encodes a protein or peptide that provides or supplements a function or activity of said protein.
  • a method of treating a subject in need of treatment for a disease caused by a gain of function activity or expression, of a protein includes: (a) administering to the subject a protease or glycosidase effective to degrade or digest and/or inhibit or reduce effector function of viral vector binding antibodies; and (b) administering to the subject a recombinant viral vector comprising a heterologous polynucleotide that is transcribed into a nucleic acid that inhibits, decreases or reduces expression of the gain of function, activity or expression of said protein.
  • step (b) is performed within about 90 days after step (a) is performed. In certain embodiments, step (b) is performed within about 60 days before or after step (a). In certain embodiments, step (b) is performed within about 45 days before or after step (a). In certain embodiments, step (b) is performed within about 30 days before or after step (a). In certain embodiments, step (b) is performed within about 21 days before or after step (a). In certain embodiments, step (b) is performed within about 14 days before or after step (a). In certain embodiments, step (b) is performed within about 7 days before or after step (a). In certain embodiments, step (b) is performed within about 72 hours before or after step (a).
  • step (b) is performed within about 48 hours before or after step (a). In certain embodiments, step (b) is performed within about 24 hours before or after step (a). In certain embodiments, step (b) is performed within about 12 hours before or after step (a). In certain embodiments, step (b) is performed within about 6 hours before or after step (a).
  • the protease comprises a cysteine protease or a thiol protease.
  • the protease comprises a protease from Streptococcus pyogenes , Streptococcus equi or Mycoplasma canis.
  • the protease comprises IdeS or a modified variant thereof set forth in any of SEQ ID NOs:3 - 18 23 or 48.
  • the glycosidase comprises an endoglycosidase.
  • the endoglycosidase comprises a sequence set forth in any of SEQ ID NOs:44 - 47.
  • the protease or glycosidase degrades or digests and/or inhibits or reduces effector function of human antibodies.
  • the viral vector comprises a lentiviral vector, an adenoviral vector or an adeno-associated virus (AAV) vector.
  • AAV adeno-associated virus
  • the lentiviral vector includes envelope proteins to which the antibodies bind.
  • the AAV vector includes capsid proteins to which the antibodies bind.
  • the AAV vector comprises VP 1 , VP2 and/or VP3 capsid proteins to which the antibodies bind.
  • the AAV vector comprises VP 1 , VP2 and/or VP3 capsid protein having 60% or more sequence identity to VP1, VP2 and/or VP3 capsid protein selected from the group consisting of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV3B, AAV-2i8, RhlO, Rh74, SEQ ID NO: 1 and SEQ ID NO:2 VP1 , VP2 and/or VP3 capsid proteins.
  • the AAV vector comprises VP1 , VP2 and/or VP3 capsid protein having 100% sequence identity to VP1 , VP2 and/or VP3 capsid protein selected from the group consisting of AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV3B, AAV-2i8, RhlO, Rh74, SEQ ID NO: l and SEQ ID N0:2 VP1 , VP2 and/or VP 3 capsid proteins.
  • the subject has antibodies that bind to said viral vector.
  • antibodies that bind to the viral vector are absent from the subject.
  • the subject has antibodies that bind to the protein or peptide encoded by the heterologous polynucleotide.
  • the antibodies comprise IgG, IgM, IgA, IgD and/or IgE.
  • a method includes determining the presence of, quantifying the amount of or an effector function of viral vector binding antibodies present in said subject before performing step (a), after performing step (a) but before performing step (b) and/or after performing steps (a) and (b).
  • a method includes analyzing a biological sample from said subject for the presence, amount or an effector function of viral vector binding antibodies present in said sample before performing step (a), after performing step (a) but before performing step (b) and/or after performing steps (a) and (b).
  • a biological sample from the subject is a blood product.
  • a blood product comprises plasma or serum.
  • a method leads to a reduction of 20-50%, 50-75%, 75-90%, 90- 95% or 95% or more of said viral vector binding antibodies.
  • the viral vector binding antibodies present in the biological sample or blood product from the subject is less than about 1 : 100,000 where 1 part of said biological sample or blood product diluted in 100,000 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in said biological sample or blood product from said subject is less than about 1 :50,000, where 1 part of the biological sample or blood product diluted in 50,000 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in the biological sample or blood product from the subject is less than about 1 : 10,000, where 1 part of the biological sample or blood product diluted in 10,000 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in the biological sample or blood product from the subject is less than about 1 : 1 ,000, where 1 part of the biological sample or blood product diluted in 1 ,000 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in the biological sample or blood product from the subject is less than about 1 : 100, where 1 part of the biological sample or blood product diluted in 100 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in the biological sample or blood product from the subject is less than about 1 : 10, where 1 part of the biological sample or blood product diluted in 10 parts of buffer results in 50% viral vector neutralization.
  • the viral vector binding antibodies present in the biological sample or blood product is less than about 1 :5, where 1 part of the biological sample or blood product diluted in 5 parts of buffer results in 50% viral vector neutralization.
  • the ratio of viral vector binding antibodies present in the biological sample or blood product is less than about 1 :4, where 1 part of the biological sample or blood product diluted in 4 parts of buffer results in 50% viral vector neutralization.
  • the ratio of viral vector binding antibodies present in the biological sample or blood product is less than about 1 :3, where 1 part of the biological sample or blood product diluted in 3 parts of buffer results in 50% viral vector neutralization.
  • the ratio of viral vector binding antibodies present in the subject, biological sample or blood product is less than about 1 :2, where 1 part of the biological sample or blood product diluted in 2 parts of buffer results in 50% viral vector neutralization.
  • the ratio of viral vector binding antibodies present in the subject, biological sample or blood product is less than about 1 : 1 , where 1 part of the biological sample or blood product diluted in 1 part of buffer results in 50% viral vector neutralization.
  • a method includes determining the presence of or quantifying the amount of antibodies that bind to the polypeptide or peptide encoded by the heterologous polynucleotide after performing step (a) but before performing step (b) and/or after performing steps (a) and (b).
  • a method includes determining the presence of or quantifying the amount of antibodies that bind to the nucleic acid after performing step (a) but before performing step (b) and/or after performing steps (a) and (b).
  • a subject has a lung disease (e.g ., cystic fibrosis), a bleeding disorder ⁇ e.g., hemophilia A or hemophilia B with or without inhibitors), thalassemia, a blood disorder ⁇ e.g., anemia), Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis (ALS), epilepsy, a lysosomal storage disease ⁇ e.g., aspartylglucosaminuria, Batten disease, late infantile neuronal ceroid lipofuscinosis type 2 (CLN2), cystinosis, Fabry disease, Gaucher disease types I, II, and III, glycogen storage disease II (Pompe disease), GM2-gangliosidosis type I (Tay Sachs disease), GM2-gangliosidosis type II (Sandhoff disease), mucolipidosis types I (sialidosis type I and II), II
  • a lung disease e.
  • a subject has a blood clotting disorder.
  • a subject has hemophilia A, hemophilia A with inhibitory antibodies, hemophilia B, hemophilia B with inhibitory antibodies, a deficiency in any coagulation Factor: VII, VIII, IX, X, XI, V, XII, II, von Willebrand factor, or a combined FV/FVIII deficiency, thalassemia, vitamin K epoxide reductase Cl deficiency or gamma-carboxylase deficiency.
  • a subject has anemia, bleeding associated with trauma, injury, thrombosis, thrombocytopenia, stroke, coagulopathy, disseminated intravascular coagulation (DIC); over-anticoagulation associated with heparin, low molecular weight heparin, pentasaccharide, warfarin, small molecule antithrombotics (i.e., FXa inhibitors), or a platelet disorder such as, Bernard Soulier syndrome, Glanzmann thrombasthenia, or storage pool deficiency.
  • DIC disseminated intravascular coagulation
  • a subject has a disease that affects or originates in the central nervous system (CNS).
  • the disease is a neurodegenerative disease.
  • the CNS or neurodegenerative disease is Alzheimer’s disease, Huntington's disease, ALS, hereditary spastic hemiplegia, primary lateral sclerosis, spinal muscular atrophy, Kennedy’s disease, a polyglutamine repeat disease, or Parkinson's disease.
  • the CNS or neurodegenerative disease is a polyglutamine repeat disease.
  • the polyglutamine repeat disease is a spinocerebellar ataxia (SCA1 , SCA2, SCA3, SCA6, SCA7, or SCA17).
  • the heterologous polynucleotide encodes a protein selected from the group consisting of insulin, glucagon, growth hormone (GH), parathyroid hormone (PTH), growth hormone releasing factor (GRF), follicle stimulating hormone (FSH), luteinizing hormone (LH), human chorionic gonadotropin (hCG), vascular endothelial growth factor (VEGF), angiopoietins, angiostatin, granulocyte colony stimulating factor (GCSF), erythropoietin (EPO), connective tissue growth factor (CTGF), basic fibroblast growth factor (bFGF), acidic fibroblast growth factor (aFGF), epidermal growth factor (EGF), transforming growth factor a (TGFa), platelet-derived growth factor (PDGF), insulin growth factors I and II (IGF-I and IGF-II), TGF , activins, inhibins, bone morphogenic protein (BMP), nerve growth factor (NGF),
  • BMP bone morphogenic
  • the heterologous polynucleotide encodes a protein selected from the group consisting of thrombopoietin (TPO), interleukins (IL1 through IL-36), monocyte chemoattractant protein, leukemia inhibitory factor, granulocyte-macrophage colony stimulating factor, Fas ligand, tumor necrosis factors a and b, interferons a, b, and g, stem cell factor, flk-2/flt3 ligand, IgG, IgM, IgA, IgD and IgE, chimeric immunoglobulins, humanized antibodies, single chain antibodies, T cell receptors, chimeric T cell receptors, single chain T cell receptors, class I and class II MHC molecules.
  • TPO thrombopoietin
  • IL1 through IL-36 interleukins
  • monocyte chemoattractant protein protein
  • leukemia inhibitory factor granulocyte-macrophage colon
  • the heterologous polynucleotide encodes CFTR (cystic fibrosis transmembrane regulator protein), a blood coagulation (clotting) factor (Factor XIII, Factor IX, Factor VIII, Factor X, Factor VII, Factor Vila, protein C, etc.), a gain of function blood coagulation factor, an antibody, retinal pigment epithelium-specific 65 kDa protein (RPE65), erythropoietin, LDL receptor, lipoprotein lipase, ornithine transcarbamylase, b-globin, a-globin, spectrin, a- antitrypsin, adenosine deaminase (ADA), a metal transporter (ATP7A or ATP7), sulfamidase, an enzyme involved in lysosomal storage disease (ARSA), hypoxanthine guanine phosphoribosyl transferas
  • CFTR cy
  • the heterologous polynucleotide encodes an inhibitory nucleic acid.
  • the inhibitory nucleic acid is selected from the group consisting of a siRNA, an antisense molecule, miRNA, RNAi, a ribozyme and a shRNA.
  • the inhibitory nucleic acid binds to a gene, a transcript of a gene, or a transcript of a gene associated with a polynucleotide repeat disease selected from the group consisting of a huntingtin (HTT) gene, a gene associated with dentatorubropallidoluysian atrophy (atrophin 1, ATN 1 ), androgen receptor on the X chromosome in spinobulbar muscular atrophy, human Ataxin- 1, -2, -3, and -7, Ca v 2.l P/Q voltage-dependent calcium channel (CACNA1A), TATA-binding protein, Ataxin 8 opposite strand (ATXN80S), Serine/threonine -protein phosphatase 2A 55 kDa regulatory subunit B beta isoform in spinocerebellar ataxia (type 1, 2, 3, 6, 7, 8, 12 17), FMR1 (fragile X mental retardation 1) in fragile X syndrome, FMR1 (fragile X mental retardation 1)
  • the protein encoded by the heterologous polynucleotide comprises a gene editing nuclease.
  • the gene editing nuclease comprises a zinc finger nuclease (ZFN) or a transcription activator-like effector nuclease (TALEN).
  • the gene editing nuclease comprises a functional Type II CRISPR-Cas9.
  • step (a) and/or step (b) of a method according to the instant invention are performed two or more times.
  • the subject is a mammal. In certain embodiments, the subject is a human.
  • compositions for example and without limitation, packages and kits, having components that may be used to practice methods according to the instant invention.
  • a package or kit has disposed therein: (a) a recombinant viral vector comprising a heterologous polynucleotide that encodes a protein or peptide; (b) a protease or glycosidase that degrades or digests antibodies; and (c) a label with instructions for performing a method as disclosed herein.
  • (a) and (b) are in separate or the same container.
  • a package or kit has disposed therein: (a) a recombinant viral vector comprising a heterologous polynucleotide that is transcribed into a nucleic acid that inhibits, decreases or reduces expression of a protein; (b) a protease or glycosidase that degrades or digests antibodies; and (c) a label with instructions for performing a method as disclosed herein.
  • (a) and (b) are in separate or the same container.
  • a method for treating a disease treated by gene therapy using a vector comprising administering to a subject in need thereof a therapeutically effective amount of an immunoglobulin G-degrading enzyme polypetide.
  • FIG. 1 is a graph showing hydrolysis of human IgG in mice reconstituted with IVIg.
  • Wild-type C57BL/6 mice were reconstituted with human IgG (IVIg, 9 mg/mouse) and injected 30 min later with IdeS (250 IU/mouse, 3 mice) or PBS (2 mice). Blood was collected before the injection of IdeS and 1 , 6 and 10 hours later.
  • Intact human IgG was measured in mouse serum by ELISA and is expressed as pg/mL using IVIg as a standard.
  • FIG. 2 is a scheme of the experimental protocol for the in vivo neutralization of anti- AAV IgG.
  • Wild-type C57BL/6 mice (6 mice per group) or Hemophilia B (HB) mice (4 mice per group) were reconstituted with human IgG (IVIg, 9 mg/mouse, day (D) minus 1 (D-l)) and injected 30 minutes (min, mn) later with IdeS (250, 500 or 1250 IU/mouse, D-l + 30 min). Thirty hours (hr, h) later (DO), the mice were injected with AAV8 vector (2x1010 vg/mouse).
  • FIGs 3A, 3B, 3C, 3D, 3E, and 3F are graphs showing the effect of IdeS on human anti-AAV8 IgG, anti-AAV8 neutralizing antibody (NAb), anti-AAV2 IgG, anti-AAV2 NAb, anti- AAV9 IgG, and anti-AAV9 NAb, respectively, in passively immunized mice.
  • Blood was collected from mice (6 mice/group) injected with IVIg and IdeS (IVIg/IdeS) or with IVIg alone (IVIg/PBS), at D-l+l5min and D-l+24 (see scheme in Figure 2).
  • the dose of IdeS was 250 IU/mouse in Figs.
  • Figs. 3E and 3F The levels of anti-AAV IgG were measured by ELISA and the levels of AAV NAbs were measured by a neutralization assay. Levels of anti-AAV8, anti-AAV2 and anti-AAV9 IgG, respectively in Figs. 3A, 3C and 3E, are expressed in pg/mL. Levels of anti-AAV8, anti-AAV2 and anti-AAV9 NAb, respectively in Figs. 3B, 3D and 3F, are expressed in titer (l/x). Data are represented as mean ⁇ SD. Statistical differences were assessed using the non-parametric two-sided Mann- Whitney test (ns: not significant).
  • FIGS 4A, 4B, 4C and 4D are graphs showing that IdeS treatment rescues transgene expression with AAV8 vectors in passively immunized mice.
  • Mice (6 mice/group) passively immunized with IVIg or PBS and injected with IdeS (250 IU/mouse (Figs. 4A and 4B) or 1250 IU/mouse (Figs. 4C and 4D)) or PBS were treated with 2x1010 vg/mouse AAV8 vector encoding human Factor IX (hFIX) (Figs. 4A and 4B) or Gaussia luciferase (GLuc) (Figs. 4C and 4D).
  • Figs. 4A the hFIX plasma levels were measured using a specific anti-hFIX ELISA. hFIX levels are expressed as pg/mL using purified hFIX as a standard.
  • Fig. 4C the Gaussia luciferase activity in plasma was measured using a luminescence assay. GLuc activity is expressed as RLU (Relative Light Units).
  • Figs. 4B and 4D vector genome copy number per diploid genome in the liver of mice by qPCR at the time of sacrifice. Data are represented as mean ⁇ SD. Statistical analyses were performed by two-way ANOVA with Dunnett test.
  • Figures 5A and 5B are graphs showing the assay of in vitro digestion of human and non human primate anti-AAV8 IgG by IdeS.
  • IVIg 200 pg
  • serum from an AAV8 seropositive human serum from an AAV8 seropositive monkey were incubated with IdeS (100 IU) or PBS for 22 hr at 37 °C.
  • Fig. 5A depicts the levels of anti-AAV8 IgG measured by ELISA.
  • Fig. 5B depicts results of an AAV neutralization assay (left Y axis) and the % of neutralizing activity observed at the dilution (right Y axis, black stars). Data are represented as mean ⁇ SD.
  • FIGs 6 A and 6B are graphs showing that IdeS treatment allows efficient gene therapy with AAV8 vectors in passively immunized hemophilia B (HB) mice.
  • HB mice (4 mice per group) were reconstituted with human IgG (IVIg, 9 mg/mouse, D-l) and injected 30 min later with IdeS (1250 IU/mouse, D-l + 30 min).
  • IdeS (1250 IU/mouse, D-l + 30 min).
  • DO mice were injected with an AAV8 vector carrying a hFIX transgene (2x1010 vg/mouse). Blood was collected 24 hours after IdeS injection, as well as at D7 and D14. Levels of hFIX were measured in plasma using a dedicated ELISA (Fig. 6A).
  • Figure 7 is a scheme of the experimental protocol in NHPs.
  • Two male cynomolgus monkeys, seropositive for AAV8 (NAb titer 1 : 17.2), were infused with 2x1012 vg/kg of AAV8- hFIX vector (DO).
  • DO AAV8- hFIX vector
  • NHP2 received double injections (i.v.) of IdeS (500 pg/kg) at days D-2 and D-l (NHP treated).
  • NHP1 received no prior treatment (control NHP).
  • Blood samples were collected before and after IdeS injections, as well as at DO, Dl , D4, D7, D13, D21 , D28, D35 and D50.
  • DO DO
  • Figures 8A, 8B and 8C are graphs showing the effect of IdeS treatment on IgG in a AAV8-seropositive monkey.
  • Fig. 8A Intact IgG level in serum was measured by ELISA and is expressed as mg/mL, using purified monkey IgG as a standard.
  • Fig. 8B Anti-AAV8 IgG level in serum was measured before and after IdeS treatment by ELISA. In the treated monkey (NHP2), the anti-AAV8 IgG level was 2.7-fold reduced after the injection of IdeS (from 2.86 to 1.05 pg/mL).
  • Fig. 8C Anti-AAV8 NAb level was measured before and after IdeS treatment using a neutralization assay.
  • FIGs 9 A and 9B are graphs showing higher transgene expression in an AAV8- seropositive monkey treated with IdeS.
  • Fig. 9A hFIX plasma levels were measured using a specific anti -hFIX ELISA. hFIX levels are expressed as ng/mL using purified hFIX as a standard.
  • Fig. 9B vector genome copy number (VGCN) per diploid genome in the liver by qPCR at the time of sacrifice. The VGCN assessment was done from 4 wedge biopsies, taken at different sites of the 4 lobes (right, left, caudate (caud), and quadrate (quad)). Data are represented as mean ⁇ SD.
  • Figures 10A and 10B are graphs shows levels of anti-AAV8 IgG and anti-AAV8 NAb, respectively, in an AAV8 -seropositive monkey treated with IdeS.
  • the levels of anti-AAV8 IgG were measured by ELISA and are expressed in pg/mL ( Figure 10A).
  • Anti-AAV8 NAb were measured in neutralization assays and are expressed in titer (l :x) ( Figure 10B). Data are represented as mean ⁇ SD.
  • Statistical analyses were performed by two-way ANOVA with Tukey’s multiple comparison test (****: p ⁇ 0.000l).
  • Figure 11 is a scheme of the experimental protocol for AAV8 re-administration in NHPs.
  • Two males cynomolgus monkeys, seropositive for AAV8 (NAb titer 1 :31.6), were infused with 5x1012 vg/kg of AAV8-hFIX vector (DO).
  • DO AAV8-hFIX vector
  • NHP4 received a single intravenous (IV) injection of IdeS (500 pg/kg ) at day D-l (NHP treated).
  • NHP3 received no prior treatment (control NHP).
  • both monkeys received double IV injections of IdeS (500 pg/kg) at days D80 and D8 l, and 5x1012 vg/kg of AAV8-hFIX vector at D82. Blood samples were collected at different time points during the experiment. At euthanasia (D105), liver biopsies were collected from 4 lobes for a VGCN assessment.
  • FIGs 12A and 12B are graphs showing IdeS treatment allows efficient AAV vector re-dosing in an AAV8-seropositive monkey, leading to an increase of transgene expression.
  • Fig. 12A hFIX plasma levels were measured using a specific anti -hFIX ELISA. hFIX levels are expressed as ng/mL using purified hFIX as a standard.
  • Fig. 12B vector genome copy number (VGCN) per diploid genome in the liver was determined by qPCR at the time of sacrifice. The VGCN assessment was done from 4 wedge biopsies, taken at different sites of the 4 lobes (left, right, caudate (caud), and quadrate (quad)). Data are represented as mean ⁇ SD. Statistical analyses were performed by two-way ANOVA with Sidak’s multiple comparison test (*: p ⁇ 0.05; **: p ⁇ 0.0l ; ****; pO.OOOl).
  • Figures 13A and 13B are graphs showing levels of anti-AAV8 IgG and anti-AAV8 NAb, respectively, in AAV8-seropositive monkey treated with IdeS upon re-administration of AAV8 vector.
  • Fig. 13A Anti-AAV8 IgG levels were measured by ELISA.
  • Fig. 13B anti-AAV8 NAb titers were measured using a neutralization assay. Data are represented as mean ⁇ SD.
  • Figures 14A, 14B and 14C show SDS-PAGE analyses of cleavage of IgG by IdeS in samples of human patient sera (Fig. 14A), non-human primate (rhesus macaque) plasma (Fig.
  • Figure 15 is a graph showing GAA activity levels in murine plasma after infusion of AAV-Spkl-GAA vector in animals immunized with varying amounts of IVIg that was pre-treated with or without IdeZ.
  • AAV-Spkl-GAA vector was infused one day after IVIg immunization.
  • Transgene activity was assessed by GAA Activity Assay at 2 weeks post vector administration.
  • GAA activity in nmol/hr/mF is plotted for each mouse in each group. Control mice were administered only vector in the absence of IVIg.
  • Figure 16 shows anti-Spkl neutralizing antibody (NAb) titer levels in murine plasma pre- and post-IdeS infusion.
  • NAb neutralizing antibody
  • Figure 17 shows anti-Spkl IgG NAb levels (ng/mF) in murine plasma pre- and post- IdeS infusion. Negative control animals were not treated with either IVIg or IdeS. IdeS Fow refers to 0.4 mg/kg IdeS used in the study, and IdeS High refers to 4 mg/kg IdeS.
  • Figure 18 shows GAA activity levels (nmol/hr/mF) in murine plasma after infusion of AAV-Spkl-GAA vector in animals immunized with IVIg then treated with IdeS. All animals received 2x10 12 vg/kg AAV-Spkl-GAA vector. Transgene activity was measured in plasma samples from mice immunized with IVIg, then treated with or without IdeS, and finally administered with vector. Transgene activity was assessed by GAA Activity Assay at 1 week post vector administration. GAA activity in nmol/hr/mL is plotted for each mouse in each group.
  • FIG 19 shows GAA activity levels (nmol/hr/mF) two weeks after infusion of AAV- Spkl-GAA vector (2 x 10 12 vg/kg) in animals previously infused with IVIg (0, 300, 800, or 1600 mg/kg) and treated with IdeS (0, 0.4, 1.0 or 2.0 mg/kg). GAA activity is plotted for each mouse in each group. Mice in IVIg administered groups that did not develop a corresponding anti-Spkl NAb titer (i.e., having NAb titer ⁇ 1 : 1 or 1 : 1 - 1 :2.5 pre-IdeS treatment) were excluded.
  • a corresponding anti-Spkl NAb titer i.e., having NAb titer ⁇ 1 : 1 or 1 : 1 - 1 :2.5 pre-IdeS treatment
  • Figure 20 shows anti-Spkl NAb titer levels in the plasma of C57BL/6 mice, having an artificial titer of human anti-capsid neutralizing IgG, measured pre- and post-infusion with different preparations of IdeS (Lot #1 and Lot #2).
  • Figure 21 is a graph showing levels of human Factor VIII in plasma from C57BL/6 mice, having an artificial titer of human anti-capsid neutralizing IgG, pre-dose and at 1 and 2 weeks after dosing with AAV- Spkl-hF VIII .
  • FIG. 22 is a graph showing anti-Spkl capsid IgG levels (ng/mL) in mouse plasma pre- and post-IdeS infusion.
  • C57BL/6 mice were given IVIg to induce an artificial titer of human anti capsid neutralizing IgG.
  • Negative control animals were not treated with either IVIg or IdeS.
  • Low IVIg refers to 300 mg/kg IVIg used in the study, Mid IVIg refers to 800 mg/kg, and High IVIg refers to 1600 mg/kg.
  • animals were treated with increasing doses of IdeS (0, 0.4, 1.0, 2.0 mg/kg IdeS). Animals treated with IVIg but demonstrating no anti-capsid IgG response were excluded from the graph.
  • kits for improving the benefit or effectiveness of gene therapy comprising administration of an agent that degrades or digests antibodies and/or inhibits or reduces effector function of antibodies.
  • methods to degrade or digest antibodies that bind to a viral vector such as a recombinant viral vector, and/or degrade or digest antibodies that bind to a nucleic acid or a protein or peptide encoded by a heterologous polynucleotide encapsidated by a recombinant viral vector and/or inhibit or reduce effector function of antibodies that bind to a recombinant viral vector, and/or a nucleic acid or a protein or peptide encoded by a heterologous polynucleotide encapsidated by the recombinant viral vector.
  • a method comprises administering to a subject an amount of a protease effective to degrade or digest antibodies or a glycosidase effective to inhibit or reduce effector function of antibodies that bind to a recombinant viral vector, and/or a nucleic acid, and/or a protein or peptide encoded by a heterologous polynucleotide.
  • a method comprises administering to a subject an amount of an endopeptidase effective to degrade or digest antibodies or an endoglycosidase effective to inhibit or reduce effector function of antibodies that bind to a recombinant viral vector, and/or a nucleic acid, and/or a protein or peptide encoded by a heterologous polynucleotide.
  • a method comprises administering to a subject an amount of a glycosidase effective to reduce Fc receptor binding of antibodies that bind to a recombinant viral vector, and/or a nucleic acid, and/or a protein or peptide encoded by a heterologous polynucleotide. In certain embodiments, a method comprises administering to a subject an amount of an endoglycosidase effective to reduce Fc receptor binding of antibodies that bind to a recombinant viral vector, and/or a nucleic acid, and/or a protein or peptide encoded by a heterologous polynucleotide.
  • the instant invention relates to an immunoglobulin G-degrading enzyme poleptide for use in the treatment of a disease treated by gene therapy using a vector in a patient in need thereof.
  • the instant invention relates to an i) immunoglobulin G- degrading enzyme polypeptide, and ii) a vector, as a combined preparation for simultaneous, separate or sequential use in the treatment of a disease treated by gene therapy using said vector in a patient in need thereof.
  • the instant invention relates to a combination of an immunoglobulin G-degrading enzyme polypeptide and a vector, for use in the treatment of a disease treated by gene therapy using said vector in a patient in need thereof.
  • the immunoglobulin G-degrading enzyme polypeptide is administered before, simultaneously (concomitantly) with, or after said vector.
  • a disease treated by gene therapy using a vector denotes a disease wherein a polynucleotide (encoding at least one polypeptide or inhibitory nucleic acid) is delivered into the cell(s) of a patient as a drug to treat said disease (gene therapy).
  • the vector encodes at least one specific polypeptide or inhibitory nucleic acid useful to treat a disease.
  • the vector encodes/comprises a therapeutic polynucleotide appropriate for treating a disease.
  • the vector encodes/comprises a therapeutic polynucleotide appropriate for treating a disease using gene therapy.
  • the patient is a vector-seropositive patient.
  • the patient is a vector-seronegative patient.
  • the term“immunoglobulin G-degrading enzyme polypeptide” denotes a polypeptide which is a protease which degrades immunoglobulin G.
  • the immunoglobulin G-degrading enzyme polypeptide is papain, pepsin or the immunoglobulin G- degrading enzyme polypeptide of S. pyogenes (IdeS), or variants from other bacterial or microbial organisms, or engineered versions thereof.
  • the immunoglobulin G- degrading enzyme polypeptide specifically degrades immunoglobulin G.
  • the immunoglobulin G-degrading enzyme polypeptide comprises a sequence selected from any of SEQ ID NOs:3-43 or 48.
  • the terms“patient” and“subject” interchangeably refer to an animal, typically a mammal, such as a rodent, a feline, a canine, and a primate. Particularly, a subject or patient according to the instant invention is a human.
  • treatment refers to both prophylactic or preventive treatment like gene therapy as well as curative or disease modifying treatment, including treatment of subjects at risk of contracting the disease or suspected to have contracted the disease as well as subjects who are ill or have been diagnosed as suffering from a disease or medical condition, and includes suppression of clinical relapse.
  • the treatment may be administered to a subject having a medical disorder or who ultimately may acquire the disorder, in order to prevent, cure, delay the onset of, reduce the severity of, or ameliorate one or more symptoms of a disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
  • composition provided, for example, as a package or kit, having (a) a recombinant viral vector comprising a heterologous polynucleotide that encodes a protein or peptide or a heterologous polynucleotide; (b) a protease or glycosidase that degrades or digests antibodies; and (c) a label with instructions for performing the method described herein, wherein (a) and (b) are in separate or the same container.
  • viral vectors that may be used in the instant include, for example and without limitation, adeno-associated viral (AAV) vectors.
  • AAV adeno-associated viral
  • the term“recombinant,” as a modifier of a viral vector, such as a recombinant AAV (rAAV) vector, as well as a modifier of sequences such as recombinant polynucleotides and polypeptides, means that compositions have been manipulated (i.e., engineered) in a fashion that generally does not occur in nature.
  • a particular example of a recombinant AAV vector would be where a nucleic acid that is not normally present in a wild-type AAV genome (heterologous polynucleotide) is inserted within a viral genome.
  • nucleic acid e.g ., gene
  • a nucleic acid e.g ., gene
  • a therapeutic protein or polynucleotide sequence is cloned into a vector, with or without 5’, 3’ and/or intron regions that the gene is normally associated within the AAV genome.
  • recombinant is not always used herein in reference to an AAV vector, as well as sequences such as polynucleotides, recombinant forms including AAV vectors, polynucleotides, etc., are expressly included in spite of any such omission.
  • A“rAAV vector,” for example, is derived from a wild type genome of AAV by using molecular methods to remove all or a part of a wild type AAV genome, and replacing with a non native (heterologous) nucleic acid, such as a nucleic acid encoding a therapeutic protein or polynucleotide sequence.
  • a non native (heterologous) nucleic acid such as a nucleic acid encoding a therapeutic protein or polynucleotide sequence.
  • ITR inverted terminal repeat
  • a rAAV is distinguished from an AAV genome since all or a part of an AAV genome has been replaced with a non-native sequence with respect to the AAV genomic nucleic acid, such as with a heterologous nucleic acid encoding a therapeutic protein or polynucleotide sequence. Incorporation of a non-native (heterologous) sequence therefore defines an AAV as a“recombinant” AAV vector, which can be referred to as a“rAAV vector.”
  • a recombinant AAV vector sequence can be packaged- referred to herein as a“particle” for subsequent infection (transduction) of a cell, ex vivo, in vitro or in vivo.
  • a recombinant vector sequence is encapsidated or packaged into an AAV particle
  • the particle can also be referred to as a“rAAV”,“rAAV particle” and/or“rAAV virion.”
  • Such rAAV, rAAV particles and rAAV virions include proteins that encapsidate or package a vector genome. Particular examples include in the case of AAV, capsid proteins.
  • A“vector genome”, which may be abbreviated as“vg”, refers to the portion of the recombinant plasmid sequence that is ultimately packaged or encapsidated to form a rAAV particle.
  • the AAV vector genome does not include the portion of the“plasmid” that does not correspond to the vector genome sequence of the recombinant plasmid.
  • a“vector genome” refers to the nucleic acid that is packaged or encapsidated by rAAV.
  • the term“serotype” in reference to an AAV vector means a capsid that is serologically distinct from other AAV serotypes. Serologic distinctiveness is determined on the basis of lack of cross-reactivity between antibodies to one AAV as compared to another AAV. Cross-reactivity differences are usually due to differences in capsid protein sequences/antigenic determinants ( e.g ., due to VP1 , VP2, and/or VP3 sequence differences of AAV serotypes). An antibody to one AAV may cross-react with one or more other AAV serotypes due to homology of capsid protein sequence.
  • a serotype means that the virus of interest has been tested against serum specific for all existing and characterized serotypes for neutralizing activity and no antibodies have been found that neutralize the virus of interest.
  • the new virus e.g ., AAV
  • this new virus e.g., AAV
  • serology testing for neutralizing activity has yet to be performed on mutant viruses with capsid sequence modifications to determine if they are of another serotype according to the traditional definition of serotype.
  • the term“serotype” broadly refers to both serologically distinct viruses (e.g., AAV) as well as viruses (e.g., AAV) that are not serologically distinct that may be within a subgroup or a variant of a given serotype.
  • rAAV vectors include any viral strain or serotype.
  • a rAAV vector genome or particle can be based upon any AAV serotype, such as AAV-l, -2, -3, -4, -5, -6, -7, -8, -9, -10, -1 1, -12, -rh74, -rhlO or AAV-2i8, for example.
  • Such vectors can be based on the same strain or serotype (or subgroup or variant), or be different from each other.
  • a rAAV plasmid or vector genome or particle (capsid) based upon one serotype genome can be identical to one or more of the capsid proteins that package the vector.
  • a rAAV plasmid or vector genome can be based upon an AAV serotype genome distinct from one or more of the capsid proteins that package the vector genome, in which case at least one of the three capsid proteins could be a different AAV serotype, e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 , AAV12, -rh74, -rhlO, AAV-2i8, SPK1 (SEQ ID NO: 1), SPK2 (SEQ ID NO:2), or variant thereof, for example.
  • a rAAV2 vector genome can comprise AAV2 ITRs but capsids from a different serotype, such as AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 , AAV12, -rh74, -rhlO, AAV-2i8, SPK1 (SEQ ID NO: l), SPK2 (SEQ ID NO:2), or variant thereof, for example.
  • rAAV vectors include gene/protein sequences identical to gene/protein sequences characteristic for a particular serotype, as well as“mixed” serotypes, which also can be referred to as“pseudotypes.”
  • the vector is an AAV vector, a lentiviral vector or adenovirus vector.
  • the term vector also includes a recombinant vector which induces neutralizing immunoglobulin G after its first administration.
  • the vector is an AAV vector.
  • the vector is an AAV8 vector encoding human FIX (comprising a therapeutic polynucleotide encoding human FIX).
  • the vector is an AAV8 vector encoding human FIX, useful for the treatment of hemophilia.
  • the rAAV plasmid or vector genome or particle is based upon reptile or invertebrate AAV variants, such as snake and lizard parvovirus (Penzes et a/., 2015, J. Gen. Virol., 96:2769-2779) or insect and shrimp parvovirus (Roekring et al., 2002, Virus Res., 87:79-87).
  • AAV variants such as snake and lizard parvovirus (Penzes et a/., 2015, J. Gen. Virol., 96:2769-2779) or insect and shrimp parvovirus (Roekring et al., 2002, Virus Res., 87:79-87).
  • the recombinant plasmid or vector genome or particle is based upon a bocavirus variant.
  • Human bocavirus variants are described, for example, in Guido et al, 2016, World J. Gastroenterol., 22: 8684-8697.
  • a rAAV vector includes or consists of a capsid sequence at least 70% or more (e.g ., 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, etc.) identical to one or more AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 , AAV12, -rh74, -rhlO AAV-2i8, SPK1 (SEQ ID NO: l), SPK2 (SEQ ID NO:2) capsid proteins (VP1 , VP2, and/or VP3 sequences).
  • a rAAV vector includes or consists of a sequence at least 70% or more (e.g., 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, etc.) identical to one or more AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1, AAV12, -rh74, -rhlO or AAV-2i8, ITR(s).
  • rAAV vectors include AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1, AAV12, RhlO, Rh74 and AAV-2i8 variants (e.g., ITR and capsid variants, such as amino acid insertions, additions, substitutions and deletions) thereof, for example, as set forth in WO 2013/158879 (International Application PCT/US2013/037170), WO 2015/013313 (International Application PCT/US2014/047670) and US 2013/0059732 (U.S. Patent Application No. 13/594,773).
  • ITR and capsid variants such as amino acid insertions, additions, substitutions and deletions
  • rAAV such as AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, -rh74, -rhlO, AAV-2i8, SPK1 (SEQ ID NO: l), SPK2 (SEQ ID NO:2) and variants, hybrids and chimeric sequences, can be constructed using recombinant techniques that are known to a skilled artisan, to include one or more heterologous polynucleotide sequences (transgenes) flanked with one or more functional AAV ITR sequences.
  • transgenes heterologous polynucleotide sequences
  • a lentivirus used in the instant invention may be a human immunodeficiency- 1 (HIV-l), human immunodeficiency-2 (HIV-2), simian immunodeficiency virus (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), Jembrana Disease Virus (JDV), equine infectious anemia virus (EIAV), or caprine arthritis encephalitis virus (CAEV).
  • HV-l human immunodeficiency- 1
  • HV-2 human immunodeficiency-2
  • SIV simian immunodeficiency virus
  • FIV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • JDV Jembrana Disease Virus
  • EIAV equine infectious anemia virus
  • CAEV caprine arthritis encephalitis virus
  • Lentiviral vectors are capable of providing efficient delivery, integration and long-term expression of heterologous polynucleotide sequences into non-dividing cells both in vitro and in vivo.
  • a variety of lentiviral vectors are known in the art, see Naldini el ah (Proc. Natl. Acad. Sci. USA, 93: 11382-11388 (1996); Science, 272: 263-267 (1996)), Zufferey et ah, (Nat. Biotechnol., 15:871-875, 1997), Dull et al, (J Virol. 1998 Nov;72(l l):8463-7l , 1998), U.S. Pat. Nos.
  • 6,013,516 and 5,994,136 any of which may be a suitable viral vector for use in the instant invention.
  • An immune response such as humoral immunity, can develop against a wildtype virus in a subject exposed to the wildtype virus. Such exposure can lead to pre-existing antibodies in the subject that bind to a viral vector based upon the wildtype virus even prior to treatment with a gene therapy method employing the viral vector.
  • AAV vector has its general meaning in the art and denotes a vector derived from an adeno-associated virus serotype, including without limitation AAV1 , AAV2, variants AAV2, AAV3, variant AAV3, AAV3B, variant AAV3B, AAV4, AAV5, AAV6, variant AAV6, AAV7, AAV8, AAV9, AAV10 such as AAVcylO and AAVrhlO, AAVrh74, AAVDJ, AAV-Anc80 ; AAV-LK03, AAV2i8 and porcine AAV, such as AAVpo4 and AAVpo6 capsid or with a chimeric capsid or any other naturally occurring serotypes of AAV that can infect humans, monkeys or other species, and all other serotypes engineered by shuffling, peptide insertion, error-prone PCR, rational design, or using machine learning and other techniques like AAVLK03, AAVDJ
  • AAV vectors can have one or more of the AAV wild- type genes deleted in whole or part, preferably the rep and/or cap genes, but retain functional flanking inverted terminal repeat (ITR) sequences.
  • Functional ITR sequences are necessary for the rescue, replication and packaging of the AAV virion.
  • an AAV vector is defined herein to include at least those sequences required in cis for replication and packaging e.g ., functional ITRs) of the virus.
  • the ITRs need not be the wild-type nucleotide sequences, and may be altered, e.g., by the insertion, deletion or substitution of nucleotides, so long as the sequences provide for functional rescue, replication and packaging.
  • AAV expression vectors are constructed using known techniques to at least provide as operatively linked components in the direction of transcription, control elements including a transcriptional initiation region, the nucleic acid molecule of the instant invention and a transcriptional termination region.
  • the control elements are selected to be functional in a mammalian cell.
  • the resulting construct which contains the operatively linked components is bounded (5' and 3’) with functional AAV ITR sequences.
  • AAV ITRs adeno-associated virus inverted terminal repeats
  • AAV ITRs the art- recognized regions found at each end of the AAV genome which function together in cis as origins of DNA replication and as packaging signals for the virus.
  • AAV ITRs, together with the AAV rep coding region provide for the efficient excision and rescue from, and integration of a nucleotide sequence interposed between two flanking ITRs into a mammalian cell genome.
  • the nucleotide sequences of AAV ITR regions are known. See, e.g., Kotin, 1994; Berns, KI "Parvoviridae and their Replication” in Fundamental Virology, 2nd Edition, (B. N. Fields and D. M.
  • an "AAV ITR" does not necessarily comprise the wild-type nucleotide sequence, but may be altered, e.g., by the insertion, deletion or substitution of nucleotides. Additionally, the AAV ITR may be derived from any of several AAV serotypes, including without limitation, AAV-l, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, etc.
  • the AAV vector of the instant invention is selected from vectors derived from AAV serotypes having tropism for and high transduction efficiencies in cells of the mammalian central and peripheral nervous system, particularly neurons, neuronal progenitors, astrocytes, oligodendrocytes and glial cells.
  • the AAV vector is an AAV4, AAV9 or an AAVrhlO that have been described to well transduce brain cells especially neurons.
  • the AAV vector of the instant invention is a double- stranded, self-complementary AAV (scAAV) vector.
  • scAAV self-complementary AAV
  • self-complementary vectors can be used. The efficiency of an AAV vector in terms of the number of genome-containing particles required for transduction, is hindered by the need to convert the single-stranded DNA (ssDNA) genome into double-stranded DNA (dsDNA) prior to expression.
  • This step can be circumvented through the use of self-complementary vectors, which package an inverted repeat genome that can fold into dsDNA without the requirement for DNA synthesis or base-pairing between multiple vector genomes.
  • Resulting self-complementary AAV (scAAV) vectors have increased resulting expression of the transgene.
  • scAAV self-complementary AAV
  • a rAAV vector comprising a ATRS ITR cannot correctly be nicked during the replication cycle and, accordingly, produces a self-complementary, double-stranded AAV (scAAV) genome, which can efficiently be packaged into infectious AAV particles.
  • scAAV self-complementary, double-stranded AAV
  • An AAV vector of the instant invention can be constructed by directly inserting the selected sequence (s) into an AAV genome which has had the major AAV open reading frames ("ORFs") excised therefrom. Other portions of the AAV genome can also be deleted, so long as a sufficient portion of the ITRs remain to allow for replication and packaging functions.
  • ORFs major AAV open reading frames
  • Such constructs can be designed using techniques well known in the art. See, e.g., U.S. Patents Nos. 5,173, 414 and 5,139, 941 ; International Publications Nos. WO 92/01070 and WO 93/03769.
  • AAV ITRs can be excised from the viral genome or from an AAV vector containing the same and fused 5' and 3' of a selected nucleic acid construct that is present in another vector using standard ligation techniques.
  • AAV vectors which contain ITRs have been described in, e.g., U.S. Patent No. 5,139, 941.
  • AAV vectors are described therein which are available from the American Type Culture Collection ("ATCC") under Accession Numbers 53222, 53223, 53224, 53225 and 53226.
  • chimeric genes can be produced synthetically to include AAV ITR sequences arranged 5' and 3' of one or more selected nucleic acid sequences.
  • AAV virions Preferred codons for expression of the chimeric gene sequence in mammalian CNS and PNS cells can be used.
  • the complete chimeric sequence is assembled from overlapping oligonucleotides prepared by standard methods.
  • an AAV expression vector is introduced into a suitable host cell using known techniques, such as by transfection.
  • transfection techniques are generally known in the art. See, e.g. , Graham et al., 1973; Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York, Davis et al. (1986) Basic Methods in Molecular Biology, Elsevier, and Chu et al., 1981.
  • transfection methods include calcium phosphate co-precipitation (Graham et al., 1973), direct micro injection into cultured cells (Capecchi, 1980), electroporation (Shigekawa et al, 1988), liposome mediated gene transfer (Mannino et al., 1988), lipid-mediated transduction (Felgner et al, 1987), and nucleic acid delivery using high-velocity microprojectiles (Klein et al, 1987).
  • a vector of the instant invention comprises an expression cassette.
  • expression cassette refers to a nucleic acid construct comprising nucleic acid elements sufficient for the expression of the nucleic acid molecule of the instant invention.
  • an expression cassette comprises the nucleic acid molecule of the instant invention operatively linked to a promoter sequence.
  • operatively linked refers to the association of two or more nucleic acid fragments on a single nucleic acid fragment so that the function of one is affected by the other.
  • a promoter is operatively linked with a coding sequence when it is capable of affecting the expression of that coding sequence (e.g., the coding sequence is under the transcriptional control of the promoter).
  • Encoding sequences can be operatively linked to regulatory sequences in sense or antisense orientation.
  • the promoter is a heterologous promoter.
  • the term“heterologous promoter”, as used herein, refers to a promoter that is not found to be operatively linked to a given encoding sequence in nature.
  • an expression cassette may comprise additional elements, for example, an intron, an enhancer, a polyadenylation site, a woodchuck response element (WRE), and/or other elements known to affect expression levels of the encoding sequence.
  • WRE woodchuck response element
  • the term“promoter” refers to a nucleotide sequence capable of controlling the expression of a coding sequence or functional RNA.
  • the nucleic acid molecule of the instant invention is located 3’ of a promoter sequence.
  • a promoter sequence consists of proximal and more distal upstream elements and can comprise an enhancer element.
  • An“enhancer” is a nucleotide sequence that can stimulate promoter activity and may be an innate element of the promoter or a heterologous element inserted to enhance the level or tissue-specificity of a promoter.
  • the promoter is derived in its entirety from a native gene.
  • the promoter is composed of different elements derived from different naturally occurring promoters.
  • the promoter comprises a synthetic nucleotide sequence.
  • promoters will direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions or to the presence or the absence of a drug or transcriptional co-factor.
  • Ubiquitous, cell-type-specific, tissue-specific, developmental stage-specific, and conditional promoters for example, drug-responsive promoters (e.g ., tetracycline-responsive promoters) are well known to those of skill in the art.
  • promoter examples include, but are not limited to, the phosphoglycerate kinase (PKG) promoter, CAG (composite of the CMV enhancer the chicken beta actin promoter (CBA) and the rabbit beta globin intron.), NSE (neuronal specific enolase), synapsin or NeuN promoters, the SV40 early promoter, mouse mammary tumor virus LTR promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), SFFV promoter, rous sarcoma virus (RSV) promoter, synthetic promoters, hybrid promoters, and the like.
  • PKG phosphoglycerate kinase
  • CAG composite of the CMV enhancer the chicken beta actin promoter (CBA) and the rabbit beta globin intron.
  • NSE neuron
  • promoters can be of human origin or from other species, including from mice.
  • Common promoters include, e.g., the human cytomegalovirus (CMV) immediate early gene promoter, the SV40 early promoter, the Rous sarcoma virus long terminal repeat, [beta]- actin, rat insulin promoter, the phosphoglycerate kinase promoter, the human alpha- 1 antitrypsin (hAAT) promoter, the transthyretin promoter, the TBG promoter and other liver-specific promoters, the desmin promoter and similar muscle-specific promoters, the EF1 -alpha promoter, the CAG promoter and other constitutive promoters, hybrid promoters with multi-tissue specificity, promoters specific for neurons like synapsin and glyceraldehyde-3 -phosphate dehydrogenase promoter, all of which are promoters well known and readily available to those of skill in the art, can be used to obtain high
  • the expression cassette comprises an appropriate secretory signal sequence that will allow the secretion of the polypeptide encoded by the nucleic acid molecule of the instant invention.
  • secretory signal sequence or variations thereof are intended to refer to amino acid sequences that function to enhance (as defined above) secretion of an operably linked polypeptide from the cell as compared with the level of secretion seen with the native polypeptide.
  • by“enhanced” secretion it is meant that the relative proportion of the polypeptide synthesized by the cell that is secreted from the cell is increased; it is not necessary that the absolute amount of secreted protein is also increased.
  • essentially all (i.e., at least 95%, 97%, 98%, 99% or more) of the polypeptide is secreted. It is not necessary, however, that essentially all or even most of the polypeptide is secreted, as long as the level of secretion is enhanced as compared with the native polypeptide.
  • secretory signal sequences are cleaved within the endoplasmic reticulum and, in certain embodiments, the secretory signal sequence is cleaved prior to secretion. It is not necessary, however, that the secretory signal sequence is cleaved as long as secretion of the polypeptide from the cell is enhanced and the polypeptide is functional.
  • the secretory signal sequence is partially or entirely retained.
  • the secretory signal sequence can be derived in whole or in part from the secretory signal of a secreted polypeptide (i.e., from the precursor) and/or can be in whole or in part synthetic.
  • the length of the secretory signal sequence is not critical; generally, known secretory signal sequences are from about 10-15 to 50-60 amino acids in length.
  • known secretory signals from secreted polypeptides can be altered or modified ( e.g ., by substitution, deletion, truncation or insertion of amino acids) as long as the resulting secretory signal sequence functions to enhance secretion of an operably linked polypeptide.
  • the secretory signal sequences of the instant invention can comprise, consist essentially of or consist of a naturally occurring secretory signal sequence or a modification thereof (as described above). Numerous secreted proteins and sequences that direct secretion from the cell are known in the art.
  • the secretory signal sequence of the instant invention can further be in whole or in part synthetic or artificial. Synthetic or artificial secretory signal peptides are known in the art, see e.g., Barash et al., Biochem. Biophys. Res. Comm. 294:835-42 (2002).
  • the instant invention includes a method of treating a disease by gene therapy using a vector, comprising administering to a subject in need thereof a therapeutically effective amount of an immunoglobulin G-degrading enzyme polypeptide.
  • the instant invention relates to a nucleic acid sequence encoding an immunoglobulin G-degrading enzyme polypeptide for use in the treatment of a disease treated by gene therapy using an vector in a patient in need thereof.
  • the instant invention includes i) a nucleic acid sequence encoding an immunoglobulin G-degrading enzyme polypeptide, and ii) a vector, as a combined preparation for simultaneous, separate or sequential use in the treatment of a disease treated by gene therapy using said vector in a patient in need thereof.
  • the instant invention includes a combination of a nucleic acid sequence encoding an immunoglobulin G-degrading enzyme polypeptide and an vector for use the treatment of a disease treated by gene therapy using said vector in a patient in need thereof.
  • the instant invention includes a nucleic acid sequence encoding an IdeS polypeptide of SEQ I D NO:4 or a function-conservative variant thereof as described herein.
  • the nucleic acid sequence encoding an IdeS polypeptide of SEQ ID NO:4 comprises or consists of SEQ ID NO:52.
  • the nucleic acid sequence comprises at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or 99.9% identity to the sequence of SEQ ID NO:52.
  • the mRNA of the nucleic acids of the instant invention can be used.
  • Nucleic acids of the instant invention may be produced by any technique known per se in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination(s).
  • the instant invention includes an expression vector comprising a nucleic acid sequence encoding an immunoglobulin G-degrading enzyme polypeptide for use in the treatment of a disease treated by gene therapy using an vector in a patient in need thereof.
  • the expression vector comprises a nucleic acid sequence encoding an amino sequence comprising SEQ ID NO:52 or a function-conservative variant thereof as described here above.
  • the vector which comprises SEQ ID NO:52 or a function- conservative variant thereof is not an AAV vector.
  • Expression vectors which may be used in the instant invention may comprise at least one expression control element operationally linked to the nucleic acid sequence.
  • the expression control elements are inserted in the vector to control and regulate the expression of the nucleic acid sequence.
  • Examples of expression control elements include, but are not limited to, lac system, operator and promoter regions of phage lambda, yeast promoters and promoters derived from polyomavirus, adenovirus, retrovirus, lentivirus or SV40.
  • Additional preferred or required operational elements include, but are not limited to, leader sequence, termination codons, polyadenylation signals and any other sequences necessary or preferred for the appropriate transcription and subsequent translation of the nucleic acid sequence in the host system.
  • the expression vector should contain additional elements necessary for the transfer and subsequent replication of the expression vector containing the nucleic acid sequence in the host system. Examples of such elements include, but are not limited to, origins of replication and selectable markers. It will further be understood by one skilled in the art that such vectors are easily constructed using conventional methods or commercially available.
  • the instant invention includes a host cell comprising an expression vector as described here above.
  • host cells may be, for example and without limitation, eukaryote cells, such as animal, plant, insect and yeast cells and prokaryotes cells, such as E. coli.
  • the means by which the vector carrying the gene may be introduced into the cells include, but are not limited to, microinjection, electroporation, transduction, or transfection using DEAE-dextran, lipofection, calcium phosphate or other procedures known to one skilled in the art.
  • eukaryotic expression vectors that function in eukaryotic cells are used.
  • examples of such vectors include, but are not limited to, viral vectors such as retrovirus, adenovirus, adeno-associated virus, herpes virus, vaccinia virus, poxvirus, poliovirus; lentivirus, bacterial expression vectors, plasmids, such as pcDNA3 or the baculovirus transfer vectors.
  • Preferred eukaryotic cell lines include, but are not limited to, COS cells, CHO cells, HeLa cells, NIH/3T3 cells, 293 cells (ATCC# CRL1573), T2 cells, dendritic cells, or monocytes.
  • An immune response such as humoral immunity can also develop against a recombinant viral vector, and/or a heterologous polynucleotide or a protein or peptide encoded by a heterologous polynucleotide encapsidated by the viral vector, resulting in inhibition or reduction in viral vector cell transduction, heterologous polynucleotide expression or function, or function or activity of the protein or peptide encoded by a heterologous polynucleotide in a subject to which the viral vector is administered.
  • Antibodies that bind to a viral vector used in the instant invention can reduce or inhibit cell transduction of viral vectors useful for gene therapy.
  • a viral vector used in the instant invention such as a recombinant viral vector, which can be referred to as“neutralizing” antibodies
  • cell transduction is reduced or inhibited thereby reducing introduction of the viral packaged heterologous polynucleotide into cells and subsequent expression and, as appropriate, subsequent translation into a protein or peptide.
  • antibodies that bind to a heterologous polynucleotide or a protein or peptide encoded by a heterologous polynucleotide encapsidated by the viral vector can inhibit expression of a heterologous polynucleotide, function or activity of a heterologous polynucleotide or function or activity of a protein or peptide encoded by a heterologous polynucleotide.
  • antibodies can be present that bind to a recombinant viral vector (e.g ., AAV) and/or antibodies can be present that bind to a protein or peptide encoded by a heterologous polynucleotide in a subject.
  • antibodies can be present that bind to a heterologous polynucleotide encapsidated by the recombinant viral vector.
  • Antibodies that bind to a recombinant viral vector e.g., AAV
  • Antibodies that bind to a protein or peptide encoded by a heterologous polynucleotide, should they be produced can be degraded or digested by a protease as set forth herein.
  • Antibodies that bind to a recombinant viral vector e.g., AAV
  • Antibodies that bind to a protein or peptide encoded by a heterologous polynucleotide, should they be produced can also have their effector function reduced or inhibited as set forth herein.
  • effector function in reference to an antibody means normal functional attributes of an antibody.
  • antibody functional attributes include, for example, binding to an antigen; activation of the complement cascade (referred to as complement dependent cytotoxicity); binding to Fc receptor on effector cells, such as macrophages, monocytes, natural killer cells and eosinophils, to engage antibody - dependent cellular cytotoxicity (ADCC); and as a signal for ingestion of bound antigen/pathogen by immune cells such as phagocytes and dendritic cells.
  • a reduction or inhibition of antibody effector function can therefore refer to any one or more of the foregoing nonlimiting functional atributes. Effector function assays are known in the art as well as described in WO2016012285, for example.
  • Fc receptor refers to any Fc receptor.
  • Fc receptors include Fc gamma immunoglobulin receptors (FcyRs) which are present on cells.
  • FcyR refers to one, some, or all of the family of Fc receptors comprising FcyRI (CD64), FcyRIIA (CD32A), FcyRIIB (CD32B), FcyRIIIA (CDl6a) and FcyRIIIB (CDl6b).
  • antibody binding to a viral vector is reduced or inhibited by way of a protease.
  • antibody binding to Fc receptor on effector cells such as macrophages, monocytes, natural killer cells or eosinophils, is reduced or inhibited by way of a glycosidase.
  • an endoglycosidase hydrolyzes a glycan structure on the Fc interacting domain of an antibody.
  • an endoglycosidase hydrolyzes a glycan structure on the Fc interacting domain of an IgG, such as the N-linked bi-antennary glycan at position Asn-297 (Kabat numbering).
  • antibody activation of complement cascade is reduced or inhibited by way of a protease.
  • antibody stimulation or reduction of ingestion by immune cells is reduced or inhibited by way of a protease or glycosidase.
  • a protease and/or glycosidase is administered to a subject before administration of a recombinant viral (e.g ., AAV) vector.
  • a protease and/or glycosidase is administered to a subject after administration of a recombinant viral (e.g., AAV) vector.
  • a recombinant viral (e.g., AAV) vector and a protease and/or glycosidase are administered substantially contemporaneously, or at about the same time.
  • Antibodies comprise any of IgG, IgM, IgA, IgD and/or IgE. Accordingly, the instant invention is directed to digesting, degrading or reducing or inhibiting effector function of any of one of these five classes of antibodies, any two of these five classes of antibodies, any three of these five classes of antibodies, any four of these five classes of antibodies or all five of these five classes of antibodies.
  • Levels of antibodies in a subject can be analyzed, measured or determined before and/or after administration of a recombinant viral vector.
  • Levels of antibodies in a subject can also be analyzed, measured or determined before and/or after the administration of a protease or glycosidase.
  • Levels of antibodies in a subject may also be analyzed or measured multiple times, before and/or after administration of a recombinant viral vector as well as before and/or after administration of a protease or glycosidase.
  • Effector function of antibodies in a subject can be analyzed, measured or determined before and/or after administration of a recombinant viral vector. Effector function of antibodies in a subject can also be analyzed, measured or determined before and/or after the administration of a protease or glycosidase. Effector function of antibodies in a subject may also be analyzed or measured multiple times, before and/or after administration of a recombinant viral vector as well as before and/or after administration of a protease or glycosidase.
  • An increase in the equilibrium binding constant corresponds to a decrease in the binding between IgG and an Fc receptor. Accordingly, a reduction in Fc receptor binding of an antibody as a consequence of glycosidase activity may result in an increase in the equilibrium binding constant for the IgG:FcR interaction. A reduction in Fc receptor binding of an antibody may result in an increase in the equilibrium binding constant for the IgG:FcR interaction by a factor of at least 1, at least 2, at least 3, or at least 4, or at least 5, or at least 6, or at least 7 or at least 8.
  • an immune response e.g ., a humoral immune response
  • a subject caused by exposure to wild-type virus is treated by administering an amount of a protease and/or glycosidase effective to degrade or digest antibodies that bind to a recombinant viral vector based upon the wildtype virus prior to administration of the recombinant viral vector to the subject.
  • an immune response e.g., a humoral immune response
  • a recombinant viral vector such as AAV
  • an immune response is treated by administering an amount of a protease and/or glycosidase effective to degrade or digest antibodies that bind to the recombinant viral vector, or antibodies that bind to the heterologous polynucleotide or a protein or peptide encoded by the heterologous polynucleotide encapsidated by the viral vector.
  • administration of a recombinant viral vector to a subject is preceded by administration of a protease and/or glycosidase to inhibit or prevent an immune response (e.g., a humoral immune response) against the recombinant viral vector or antibodies that bind to the heterologous polynucleotide or a protein or peptide encoded by the heterologous polynucleotide encapsidated by the viral vector.
  • an immune response e.g., a humoral immune response
  • a protease and/or glycosidase is administered to a subject before an immune response (e.g., a humoral immune response), such as before development of neutralizing antibodies or development of antibodies that bind to the heterologous polynucleotide or a protein or peptide encoded by the heterologous polynucleotide encapsidated by the viral vector.
  • an immune response e.g., a humoral immune response
  • Proteases are enzymes that degrade or digest proteins.
  • proteases are also designated peptidases, proteinases, peptide hydrolases, or proteolytic enzymes.
  • Proteases that may be used in the instant invention can be subdivided into two broad groups based on their substrate-specificity.
  • Proteases may be of the exo-type that hydrolyzes peptide bonds located towards the N-terminal end or the C-terminal end (exoprotease or exopeptidase).
  • exoproteases or exopeptidases include, for example, Flavozyme (Novozymes), ProteaAX (Amano), and Pancreatin from porcine pancreas.
  • Proteases that may be used in the instant invention may be of the endo-type that hydrolyzes peptide bonds internally in polypeptide chains (endoprotease or endopeptidase).
  • endoproteases include, for example, IdeS, IdeZ, IgdE, IdeMC, trypsin, chymotrypsin, papain and pepsin.
  • proteases examples include, for example and without limitation, cysteine proteases from Streptococcus pyogenes , Streptococcus equi, Mycoplasma canis, S. agalactiae,S. pseudoporcinus or Pseudomonas putida.
  • a protease includes endopeptidase IdeS from Streptococcus pyogenes or a modified variant thereof set forth in any of SEQ ID NO:3-l8.
  • the protease includes protease set forth in SEQ ID NO: 19 or SEQ ID NO:20, or a modified variant thereof.
  • the protease includes endopeptidase IdeZ from Streptococcus equi , or a modified variant thereof set forth in any of SEQ ID NOs:2l-43.
  • proteases that may be used in the instant invention include, for example and without limitation, IgdE enzymes from S. suis, S. porcinus, S. equi, described in WO 2017/134274.
  • Other proteases that may be used in the instant invention include, for example and without limitation, IdeMC and homologs described in WO 2018/093868.
  • Other endopeptidases that may be used in the instant invention include, for example and without limitation, IdeZ with and without the N-terminal methionine and signal peptide and IdeS/IdeZ hybrid proteins described in WO 2016/128559.
  • Other proteases that may be used in the instant invention include, for example and without limitation, proteases described in Jordan et al. (N Engl.
  • Glycosidases are enzymes that hydrolyzes glycosidic bonds in complex sugars. There are generally two broad groups, namely exoglycosidases and endoglycosidases. Glycosidases cleave and thereby releases glycans/oligosaccharides from glycoproteins such as antibodies.
  • Exoglycosidases that may be used in the instant invention include, for example and without limitation, N-acetylglucosaminidase, fucosidase, galactosidase, glucosidase, mannosidase, neuraminidase, and xylosidase.
  • Endoglycosidases that may be used in the instant invention include, for example and without limitation, EndoS, Endo D, endoglycosidase-H, Endo Fl, Endo F2 and Endo F3.
  • a glycosidase comprises an endoglycosidase.
  • a glycosidase comprises an exoglycosidase.
  • an endoglycosidase includes, for example and without limitation, EndoS.
  • an endoglycosidase comprises a sequence set forth in any one of SEQ ID NOs:44-47, or a modified variant thereof.
  • an EndoS polypeptide includes an EndoS polypeptide, a fragment of an EndoS polypeptide, a variant of an EndoS polypeptide, or a variant of a fragment of an EndoS polypeptide, provided that said polypeptide, fragment, variant or variant of fragment has immunoglobulin (Ig) endoglycosidase activity.
  • Ig immunoglobulin
  • an EndoS polypeptide is S. pyogenes EndoS.
  • a variant of an EndoS polypeptide may be an EndoS polypeptide from another organism, such as another bacterium.
  • a bacterium is a Streptococcus, such as Streptococcus equi, Streptococcus zooepidemicus or Streptococcus pyogenes.
  • the variant may be from Corynebacterium pseudotuberculosis, for example the CP40 protein; Enterococcus faecalis, for example the EndoE protein; or Elizabethkingia meningoseptica (formerly Flavobacterium meningosepticum), for example the EndoF2 protein.
  • An EndoS polypeptide may comprise or consist of (a) the amino acid sequence of any one of SEQ ID NOs:44-47; or (b) a fragment of (a) having Ig endoglycosidase activity; or (c) a variant of (a) having at least 50% identity to the amino acid sequence of any one of SEQ ID NOs:44-47 and having Ig endoglycosidase activity; or (d) a variant of (b) having at least 50% identity to the corresponding portion of the amino acid sequence of any one of SEQ ID NOs:44- 47 and having Ig endoglycosidase activity.
  • the variant polypeptide has at least about 60% or more identity e.g ., 60-70%, 70-80% or 80-90% identity) to the amino acid sequence of any one of SEQ ID NOs:44-47, or a fragment thereof having Ig endoglycosidase activity. In certain embodiments, the variant polypeptide has 90-100% identity to the amino acid sequence of any one of SEQ ID NOs:44-47, or a fragment thereof having Ig endoglycosidase activity.
  • a protease may comprise or consist of (a) the amino acid sequence of any one of SEQ ID NOs:3-43 or 48; or (b) a fragment of (a) having protease activity; or (c) a variant of (a) having at least 50% identity to the amino acid sequence of any one of SEQ ID NOs:3-43 or 48 and having protease activity; or (d) a variant of (b) having at least 50% identity to the corresponding portion of the amino acid sequence of any one of SEQ ID NOs:3-43 or 48 and having protease activity.
  • the variant polypeptide has at least about 60% or more identity (e.g., 60- 70%, 70-80% or 80-90% identity) to the amino acid sequence of any one of SEQ ID NOs:3-43 or 48, or a fragment thereof having protease activity. In certain embodiments, the variant polypeptide has 90-100% identity to the amino acid sequence of any one of SEQ ID NOs:3-43 or 48, or a fragment thereof having protease activity.
  • the protease or glycosidase is the devoid of its native signal sequence and has an additional N terminal methionine, such as SEQ ID NO:48 which is the mature form of IdeS of S. pyogenes (without the signal sequence, but having an added N terminal methionine).
  • SEQ ID NO:48 which is the mature form of IdeS of S. pyogenes (without the signal sequence, but having an added N terminal methionine).
  • Any protease or glycosidase used in the methods of the invention can include an added N terminal methionine in place of the native signal sequence.
  • the protease or glycosidase has a non-native N terminal signal or leader peptide sequence in place of its native signal sequence.
  • Any protease or glycosidase used in the methods of the invention can include a non-native N terminal signal sequence in place of the native signal sequence.
  • the non-native N terminal signal sequence is selected from SEQ ID NOs:49-5l , or function-conservative variants thereof.
  • the immunoglobulin G-degrading enzyme polypeptide is capable of degrading adenovirus-neutralizing antibodies present in a patient. [0168] In certain embodiments, the immunoglobulin G-degrading enzyme polypeptide is capable of degrading AAV-neutralizing antibodies present in a patient.
  • the immunoglobulin G-degrading enzyme polypeptide is the immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide.
  • the immunoglobulin G-degrading enzyme polypeptide is the immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide, which is administered to degrade adenovirus-neutralizing antibodies present in a patient.
  • IdeS S. pyogenes
  • the immunoglobulin G-degrading enzyme polypeptide is the immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide, which is administered to degrade AAV-neutralizing antibodies present in a patient.
  • IdeS S. pyogenes
  • the instant invention relates to the use of an immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide in the treatment of a disease treated by administering a gene therapy vector to a patient in need thereof.
  • IdeS immunoglobulin G-degrading enzyme of S. pyogenes
  • the instant invention relates to the use of an immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide in the treatment of a disease treated by administering a gene therapy vector to a patient in need thereof, wherein the IdeS is administered to the patient in order to degrade neutralizing anti- AAV antibodies present in the patient.
  • IdeS immunoglobulin G-degrading enzyme of S. pyogenes
  • the patient is a vector-seropositive patient
  • the instant invention relates to an immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide for use in the treatment of AAV-seropositive patients.
  • IdeS immunoglobulin G-degrading enzyme of S. pyogenes
  • the patient is a vector-seronegative patient
  • the instant invention relates to an immunoglobulin G-degrading enzyme of S. pyogenes (IdeS) polypeptide for use in the treatment of AAV-seronegative patients.
  • IdeS immunoglobulin G-degrading enzyme of S. pyogenes
  • the IdeS polypeptide according to the instant invention is S. pyogenes IdeS, or a variant or fragment of S. pyogenes IdeS which retains cysteine protease activity.
  • the variant may be an IdeS polypeptide from another organism, such as another bacterium.
  • the bacterium is preferably a Streptococcus.
  • the Streptococcus is preferably a group A Streptococcus, a group C Streptococcus or a group G Streptococcus.
  • the variant may be an IdeS polypeptide from a group C Streptococcus such as S. equi or S. zooepidemicus.
  • the variant may be from Pseudomonas putida or recombinant variant from other bacterial strains.
  • the IdeS polypeptide according to the instant invention comprises the sequence of any of SEQ ID NOs:3-43 or 48.
  • the cysteine protease activity of the polypeptide has the ability to cleave all four human subclasses of IgG at glycine residue 237 in the lower hinge region of the IgG heavy chains without cleaving the IgA, IgM, IgD and IgE isotypes.
  • the IdeS polypeptide comprises or consists of the amino acid sequence of any of SEQ ID NOs:3 - 18, 23 or 48 or a function-conservative variant thereof.
  • polypeptide according to the instant invention may differ by 1, 2, 3, 4 or 5 amino acids from the sequence of any of SEQ ID NOs:3 - 18, 23 or 48.
  • the instant invention includes polypeptides that are function- conservative variants of the polypeptide of any of SEQ ID NOs:3 - 18, 23 or 48.
  • the polypeptide of the instant invention comprises at least 60%, 65%, 70%, 75%, 80%, at least 85%, at least 90%, at least 95%, at least 97% or 100% of identity to the sequence of any of SEQ ID NOs:3 - 18, 23 or 48, and is still able to cleave all four human subclasses of IgG at glycine residue 237 in the lower hinge region of the IgG heavy chains without cleaving the IgA, IgM, IgD and IgE isotypes.
  • the polypeptide of the instant invention consists of the amino acid sequence as set forth in any of SEQ ID NOs:3 - 18, 23 or 48 or a variant thereof comprising at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or 99.9% identity with the sequence of any of SEQ ID NOs:3 - 18, 23 or 48 and is still able to cleave all four human subclasses of IgG at glycine residue 237 in the lower hinge region of the IgG heavy chains without cleaving the IgA, IgM, IgD and IgE isotypes.
  • the polypeptide of the instant invention is a fragment of the polypeptide of any of SEQ ID NOs:3 - 18, 23 or 48 which is still able to cleave all four human subclasses of IgG at glycine residue 237 in the lower hinge region of the IgG heavy chains without cleaving the IgA, IgM, IgD and IgE isotypes.
  • the polypeptide of the instant invention contains residues Lys- 55 and/or Cys-65 and/or His-233 and/or Asp-255 and/or Asp-257 corresponding to the amino acid residues of any of SEQ ID NOs:3 - 18, 23 or 48.
  • the polypeptide of the instant invention contains each of residues corresponding to Lys-55, Cys-65, His-233, Asp-255 and Asp-257 of SEQ ID NO:4. In certain embodiments, the polypeptide of the instant invention contains at least one of, at least two of, at least three of, at least 4 of, or all 5 of the residues corresponding to Lys-55, Cys-65, His-233, Asp-255 and Asp-257 of SEQ ID NO:4.
  • polypeptides or fragments of the instant invention are still able to cleave the four human subclasses of IgG.
  • a test may be performed with each polypeptide or fragment. For example, after incubation of the tested polypeptides or fragments with human IgG, the study of the digestion fragments will be done by Western blot. Lack of detection of intact IgG and detection of digestion fragments of human IgG will indicate that the tested polypeptides or fragments have the capacity to cleave all four human subclasses of IgG.
  • the term "function-conservative variant(s)" refer to those in which a given amino acid residue in a protein or enzyme has been changed (inserted, deleted or substituted) without altering the overall conformation and function of the peptide. Such variants include protein having amino acid alterations such as deletions, insertions and/or substitutions.
  • A“deletion” refers to the absence of one or more amino acids in the protein.
  • An“insertion” refers to the addition of one or more of amino acids in the protein.
  • A“substitution” refers to the replacement of one or more amino acids by another amino acid residue in the protein.
  • a given amino acid is replaced by an amino acid having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, hydrophobic, aromatic, and the like).
  • This given amino acid can be a natural amino acid or a non-natural amino acid.
  • Amino acids other than those indicated as conserved may differ in a protein so that the percent protein or amino acid sequence similarity between any two proteins of similar function may vary and may be, for example, from 70 % to 99 % as determined according to an alignment scheme such as by the Cluster Method, wherein similarity is based on the MEGALIGN algorithm.
  • a “function-conservative variant” also includes a polypeptide which has at least 60 % amino acid identity as determined by BLAST or FASTA algorithms, preferably at least 75 %, more preferably at least 85%, still preferably at least 90 %, and even more preferably at least 95%, and which has the same or substantially similar properties or functions as the native or parent protein to which it is compared.
  • Two amino acid sequences are "substantially homologous" or “substantially similar” when greater than 80 %, preferably greater than 85 %, preferably greater than 90 % of the amino acids are identical, or greater than about 90 %, preferably greater than 95 %, are similar (functionally identical) over the whole length of the shorter sequence.
  • the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any of sequence comparison algorithms such as BLAST, FASTA, etc.
  • GCG Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin
  • sequence comparison algorithms such as BLAST, FASTA, etc.
  • the polypeptide of the instant invention comprises the sequence of SEQ ID NO:4 or SEQ ID NO:48 in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the functional aspects of the polypeptide of SEQ ID NO:4 or SEQ ID NO:48 as described herein.
  • the polypeptide of the instant invention comprises the sequence of any of SEQ ID NOs:3-l 8, 23 or 48 in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the functional aspects of the polypeptide of SEQ ID NOs:3-l8, 23 or 48 as described herein.
  • Examples of conservative substitutions include the substitution of one non-polar (hydrophobic) residue such as isoleucine, valine, leucine or methionine for another, the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, between glycine and serine, the substitution of one basic residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue, such as aspartic acid or glutamic acid or another.
  • the term "conservative substitution” also includes the use of a chemically derivatized residue in place of a non-derivatized residue.
  • “Chemical derivative” refers to a subject peptide having one or more residues chemically derivatized by reaction of a functional side group. Examples of such derivatized molecules include for example, those molecules in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
  • Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides. Free hydroxyl groups may be derivatized to form O-acyl or O-alkyl derivatives. The imidazole nitrogen of histidine may be derivatized to form N-im-benzylhistidine. Chemical derivatives also include peptides that contain one or more naturally-occurring amino acid derivatives of the twenty standard amino acids.
  • 4-hydroxyproline may be substituted for proline
  • 5 -hydroxy lysine may be substituted for lysine
  • 3-methylhistidine may be substituted for histidine
  • homoserine may be substituted for serine
  • ornithine may be substituted for lysine.
  • the term“conservative substitution” also includes the use of non-natural amino acids aimed to control and stabilize peptides or proteins secondary structures.
  • These non natural amino acids are chemically modified amino acids such as prolinoamino acids, beta-amino acids, N-methylamino acids, cyclopropylamino acids, alpha, alpha-substituted amino acids as describe here below.
  • These non-natural amino acids may include also fluorinated, chlorinated, brominated or iodinated modified amino acids.
  • polypeptide of the instant invention may additionally include a signal sequence.
  • the signal sequence comprises or consists of the amino acid sequences: SEQ ID NO:49, SEQ ID NO:50 or SEQ ID NO:5l or function-conservative variants thereof.
  • polypeptides of the instant invention may comprise a tag.
  • a tag is a tag- containing sequence which can be useful for the purification of the peptides. It is attached by a variety of techniques such as affinity chromatography, for the localization of said peptide or polypeptide within a cell or a tissue sample using immuno labeling techniques, the detection of said peptide or polypeptide by immunob lotting etc.
  • tags commonly employed in the art are the GST (glutathion-S-transferase)-tag, the FLAGTM-tag, the Strep-tagTM, V5 tag, myc tag, His tag etc.
  • polypeptides of the instant invention may be labelled by a fluorescent dye.
  • Dye-labelled fluorescent peptides are important tools in cellular studies.
  • Peptides can be labelled on the N-terminal side or on the C-terminal side.
  • Amine-reactive fluorescent probes are widely used to modify peptides at the N-terminal or lysine residue.
  • a number of fluorescent amino-reactive dyes have been developed to label various peptides, and the resultant conjugates are widely used in biological applications.
  • Three major classes of amine- reactive fluorescent reagents are currently used to label peptides: succinimidyl esters (SE), isothiocyanates and sulfonyl chlorides.
  • Amine- containing dyes are used to modify peptides using water-soluble carbodiimides (such as EDC) to convert the carboxy groups of the peptides into amide groups.
  • EDC water-soluble carbodiimides
  • NHS NHSS
  • EDC-mediated protein-carboxylic acid conjugations may be used to improve the coupling efficiency of EDC-mediated protein-carboxylic acid conjugations.
  • polypeptides used in the therapeutic methods according to the instant invention may be modified in order to improve their therapeutic efficacy.
  • modification of therapeutic compounds may be used to decrease toxicity, increase circulatory time, modify biodistribution or reduce immunogenicity.
  • the toxicity of potentially important therapeutic compounds can be decreased significantly by combination with a variety of drug carrier vehicles that modify biodistribution.
  • a strategy for improving drug viability is the utilization of water-soluble polymers.
  • Various water-soluble polymers have been shown to modify biodistribution, improve the mode of cellular uptake, change the permeability through physiological barriers; and modify the rate of clearance from the body.
  • water-soluble polymers have been synthesized that contain drug moieties as terminal groups, as part of the backbone, or as pendent groups on the polymer chain.
  • PEG Polyethylene glycol
  • Attachment to various drugs, proteins, and liposomes has been shown to improve residence time and decrease toxicity.
  • PEG can be coupled to active agents through the hydroxyl groups at the ends of the chain and via other chemical methods; however, PEG itself is limited to at most two active agents per molecule.
  • copolymers of PEG and amino acids were explored as novel biomaterials which would retain the biocompatibility properties of PEG, but which would have the added advantage of numerous attachment points per molecule (providing greater drug loading), and which could be synthetically designed to suit a variety of applications.
  • PEGylation techniques for the effective modification of drugs.
  • drug delivery polymers that consist of alternating polymers of PEG and tri functional monomers such as lysine have been used by VectraMed (Plainsboro, N.J.).
  • the PEG chains typically 2000 daltons or less
  • Such copolymers retain the desirable properties of PEG, while providing reactive pendent groups (the carboxylic acid groups of lysine) at strictly controlled and predetermined intervals along the polymer chain.
  • the reactive pendent groups can be used for derivatization, cross-linking, or conjugation with other molecules.
  • These polymers are useful in producing stable, long-circulating pro-drugs by varying the molecular weight of the polymer, the molecular weight of the PEG segments, and the cleavable linkage between the drug and the polymer.
  • the molecular weight of the PEG segments affects the spacing of the drug/linking group complex and the amount of drug per molecular weight of conjugate (smaller PEG segments provides greater drug loading).
  • increasing the overall molecular weight of the block co-polymer conjugate will increase the circulatory half-life of the conjugate. Nevertheless, the conjugate must either be readily degradable or have a molecular weight below the threshold- limiting glomerular filtration (e.g ., less than 45 kDa).
  • linkers may be used to maintain the therapeutic agent in a pro-drug form until released from the backbone polymer by a specific trigger, typically enzyme activity in the targeted tissue.
  • a specific trigger typically enzyme activity in the targeted tissue.
  • tissue activated drug delivery is particularly useful where delivery to a specific site of biodistribution is required and the therapeutic agent is released at or near the site of pathology.
  • Linking group libraries for use in activated drug delivery are known to those of skill in the art and may be based on enzyme kinetics, prevalence of active enzyme, and cleavage specificity of the selected disease-specific enzymes (see e.g., technologies of established by VectraMed, Plainsboro, N.J.).
  • Such linkers may be used in modifying the peptides-derived described herein for therapeutic delivery.
  • polypeptides may be produced by conventional automated peptide synthesis methods or by recombinant expression. General principles for designing and making proteins are well known to those of skill in the art.
  • Polypeptides of the instant invention may be synthesized in solution or on a solid support in accordance with conventional techniques.
  • Various automatic synthesizers are commercially available and can be used in accordance with known protocols as described in Stewart and Young; Tam et al., 1983; Merrifield, 1986 and Barany and Merrifield, Gross and Meienhofer, 1979.
  • Peptides of the instant invention may also be synthesized by solid-phase technology employing an exemplary peptide synthesizer such as a Model 433A from Applied Biosystems Inc.
  • the purity of any given protein; generated through automated peptide synthesis or through recombinant methods may be determined using reverse phase HPLC analysis. Chemical authenticity of each peptide may be established by any method well known to those of skill in the art.
  • recombinant DNA technology may be employed wherein a nucleotide sequence which encodes a protein of choice is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression as described herein below. Recombinant methods are especially preferred for producing longer polypeptides.
  • a variety of expression vector/host systems may be utilized to contain and express the peptide or protein coding sequence. These include but are not limited to microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors (Giga-Hama et al, 1999); insect cell systems infected with virus expression vectors (e.g., baculovirus, see Ghosh et al, 2002); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid; see e.g., Babe et al, 2000); or animal cell systems.
  • microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors (Giga-Hama et al,
  • Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), W138, BHK, HepG2, 3T3, RIN, MDCK, A549, PC12, K562 and 293 cells.
  • Exemplary protocols for the recombinant expression of the peptide substrates or fusion polypeptides in bacteria, yeast and other invertebrates are known to those of skill in the art and a briefly described herein below.
  • CT.S. Pat. No. 6,569,645; CT.S. Pat. No. 6,043,344; CT.S. Pat. No. 6,074,849; and CT.S. Pat. No. 6,579,520 provide specific examples for the recombinant production of peptides and these patents are expressly incorporated herein by reference for those teachings.
  • Mammalian host systems for the expression of recombinant proteins also are well known to those of skill in the art. Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity.
  • Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation.
  • Post-translational processing which cleaves a "prepro" form of the protein may also be important for correct insertion, folding and/or function.
  • Different host cells such as CHO, HeLa, MDCK, 293, WI38, and the like have specific cellular machinery and characteristic mechanisms for such post- translational activities and may be chosen to ensure the correct modification and processing of the introduced, foreign protein.
  • the expression vectors include DNA encoding the given protein being operably linked to suitable transcriptional or translational regulatory sequences, such as those derived from a mammalian, microbial, viral, or insect genes.
  • suitable transcriptional or translational regulatory sequences such as those derived from a mammalian, microbial, viral, or insect genes.
  • regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences which control transcription and translation.
  • expression vector expression construct
  • expression cassette any type of genetic construct containing a nucleic acid coding for a gene product in which part or all of the nucleic acid encoding sequence is capable of being transcribed.
  • Expression requires that appropriate signals be provided in the vectors, such as enhancers/promoters from both viral and mammalian sources that may be used to drive expression of the nucleic acids of interest in host cells.
  • the nucleic acid being expressed is under transcriptional control of a promoter.
  • a "promoter” includes a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a gene. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the peptide of interest (i.e., 4N1K, a variant and the like).
  • a promoter nucleotide sequence is operably linked to a given DNA sequence if the promoter nucleotide sequence directs the transcription of the sequence.
  • the phrase "under transcriptional control" means that the promoter is in the correct location and orientation in relation to the nucleic acid to control RNA polymerase initiation and expression of the gene. Any promoter that will drive the expression of the nucleic acid may be used.
  • the particular promoter employed to control the expression of a nucleic acid sequence of interest is not believed to be important, so long as it is capable of directing the expression of the nucleic acid in the targeted cell.
  • a human cell it is preferable to position the nucleic acid coding region adjacent to and under the control of a promoter that is capable of being expressed in a human cell.
  • a promoter might include either a human or viral promoter.
  • Common promoters include, e.g., the human cytomegalovirus (CMV) immediate early gene promoter, the SV40 early promoter, the Rous sarcoma virus long terminal repeat, [beta]-actin, rat insulin promoter, the phosphoglycerol kinase promoter, the human alpha- 1 antitrypsin promoter, the transthyretin promoter, the TBG promoter and other liver-specific promoters, the desmin promoter and similar muscle-specific promoters, the EF1 -alpha promoter, the CAG promoter and other constitutive promoters, hybrid promoters with multi-tissue specificity, promoters specific for neurons like synapsin and glyceraldehyde-3 -phosphate dehydrogenase promoter, all of which are promoters well known and readily available to those of skill in the art, can be used to obtain high-level expression of the coding sequence of interest.
  • CMV human cytomegalovirus
  • Another regulatory element that is used in protein expression is an enhancer. These are genetic elements that increase transcription from a promoter located at a distant position on the same molecule of DNA. Where an expression construct employs a cDNA insert, one will typically desire to include a polyadenylation signal sequence to effect proper polyadenylation of the gene transcript. Any polyadenylation signal sequence recognized by cells of the selected transgenic animal species is suitable for use in the instant invention, such as human or bovine growth hormone and SV40 polyadenylation signals.
  • an immunoglobulin G-degrading enzyme polypeptide like the Ides can be suitable for the treatment of a disease treated by gene therapy using an AAV vector.
  • the instant invention relates to a therapeutic composition
  • a therapeutic composition comprising an immunoglobulin G-degrading enzyme polypeptide or nucleic acids encoding an immunoglobulin G-degrading enzyme polypeptide or an expression vector comprising a nucleic acid encoding an immunoglobulin G-degrading enzyme polypeptide according to the instant invention for use in the treatment of a disease treated by gene therapy using a vector in a patient in need thereof.
  • Any therapeutic agent of the instant invention may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
  • “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
  • a pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
  • compositions The form of the pharmaceutical compositions, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
  • compositions of the instant invention may be formulated for topical, oral, intranasal, parenteral, intraocular, intravenous, intramuscular or subcutaneous administration and the like.
  • compositions of the instant invention may contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
  • the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
  • compositions of the instant invention may comprise a further therapeutically active agent.
  • a protease or glycosidase can be administered to a subject at any suitable dose.
  • a suitable dosage may be from about 0.05 mg/kg to about 5 mg/kg body weight of a subject, or from about 0.1 mg/kg to about 4 mg/kg body weight of a subject.
  • IdeZ is administered at a dosage of about 0.01 mg/kg to about 10 mg/kg body weight of a subject.
  • a suitable dosage may be from about 0.05 mg/kg to about 5 mg/kg body weight of a subject, or from about 0.1 mg/kg to about 4 mg/kg body weight of a subject.
  • IdeS is administered at a dosage of about 0.01 mg/kg to about 10 mg/kg body weight of a subject.
  • a suitable dosage may be from about 0.05 mg/kg to about 5 mg/kg body weight of a subject, or from about 0.1 mg/kg to about 4mg/kg body weight of a subject.
  • EndoS is administered at a dosage of about 0.01 mg/kg to about 10 mg/kg body weight of a subject.
  • a suitable dosage may be from about 0.05 mg/kg to about 5 mg/kg body weight of a subject, or from about 0.1 mg/kg to about 4mg/kg body weight of a subject.
  • a method may comprise first (a) administering to a subject a protease and/or glycosidase effective to degrade or digest neutralizing antibodies; and then (b) administering to the subject a recombinant viral vector.
  • (b) administering to a subject a recombinant viral vector is performed between about 1 minute to about 90 days after (a) administering to a subject a protease and/or glycosidase effective to degrade or digest neutralizing antibodies.
  • administering to a subject a protease and/or glycosidase effective to degrade or digest neutralizing antibodies, and (b) administering to the subject a recombinant viral vector are performed at about the same time.
  • a method may comprise first (a) administering to a subject a recombinant viral vector bearing a heterologous polynucleotide and then (b) administering to the subject an amount of a protease and/or glycosidase effective to degrade or digest antibodies that bind to a recombinant viral vector and/or heterologous polynucleotide or protein or peptide encoded by the heterologous polynucleotide.
  • (b) administering to the subject an amount of a protease and/or glycosidase effective to degrade or digest antibodies that bind to a recombinant viral vector and/or heterologous polynucleotide or protein or peptide encoded by the heterologous polynucleotide is performed between about 1 minute to about 90 days after (a) administering to a subject a recombinant viral vector bearing the heterologous polynucleotide.
  • (a) administering to a subject a recombinant viral vector bearing a heterologous polynucleotide, and (b) administering to the subject an amount of a protease and/or glycosidase effective to degrade or digest antibodies that bind to a recombinant viral vector and/or heterologous polynucleotide or protein or peptide encoded by the heterologous polynucleotide, are performed at about the same time.
  • Antibodies such as neutralizing antibodies, may be preexisting and may be present in a subject, even before administration of a viral vector, at levels that inhibit or reduce recombinant viral vector cell transduction. Alternatively, antibodies may develop in a subject after exposure to a virus upon which the recombinant viral vector is based. Still further, antibodies, such as neutralizing antibodies, or antibodies that bind to the heterologous polynucleotide or a protein or peptide encoded by the heterologous polynucleotide encapsidated by the viral vector may develop in a subject after administration of a recombinant viral vector.
  • the methods herein are applicable to subjects with pre-existing antibodies and subjects without pre-existing antibodies.
  • such subjects include subjects that have been exposed to wildtype virus and develop pre-existing antibodies against the viral vector based upon the wildtype virus, as well as subjects that have received a viral vector gene therapy treatment and have developed antibodies and may be subsequently treated with one or more additional doses of the same viral vector gene therapy (referred to as redosing) or be treated with a different gene therapy treatment (e.g ., a different heterologous polynucleotide) using the same viral vector to deliver the gene therapy treatment.
  • redosing additional doses of the same viral vector gene therapy
  • a different gene therapy treatment e.g ., a different heterologous polynucleotide
  • a subject may be tested for antibodies prior to viral vector administration and/or prior to administration of a protease glycosidase.
  • antibodies to test for include neutralizing antibodies, antibodies that bind to a protease or glycosidase as set forth herein, antibodies that bind to the heterologous polynucleotide and antibodies that bind to the protein or peptide encoded by the heterologous polynucleotide.
  • Subjects can therefore be screened for neutralizing antibodies, antibodies that bind to a protease or glycosidase as set forth herein, antibodies that bind to a heterologous polynucleotide or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide, prior to administration of a recombinant viral vector and/or prior to administration of a protease glycosidase.
  • Subjects that have pre-existing antibodies (e.g ., IgG) that bind to a protease or glycosidase as set forth herein can optionally be excluded from initial treatment by a method according to the instant invention.
  • IgG pre-existing antibodies
  • not all subjects that have or develop antibodies that bind to a protease or glycosidase need be excluded from treatment methods according to the instant invention.
  • a subject with detectable anti-IdeS IgG having a titer of less than 15 mg/per liter can still be treated using methods according to the instant invention.
  • Subjects also can be screened for neutralizing antibodies, antibodies that bind to a heterologous polynucleotide or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide after administration of a recombinant viral vector.
  • Such subjects can optionally be monitored for a period of time after administration of the recombinant viral vector in order to determine if such antibodies develop or are prevented from developing in a subject in which pre-existing antibodies have not been detected, or in the case of a subject with pre-existing antibodies whether protease and/or glycosidase decreases or eliminates such pre-existing antibodies.
  • a protease and/or glycosidase is administered to a subject after testing positive for the presence of neutralizing antibodies, antibodies that bind to a protease or glycosidase as set forth herein, antibodies that bind to a heterologous polynucleotide or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide.
  • a protease and/or glycosidase is administered to a subject before testing positive for the presence of neutralizing antibodies, antibodies that bind to a protease or glycosidase as set forth herein, antibodies that bind to a heterologous polynucleotide or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide.
  • subjects are not tested for antibodies prior to or after administration of a protease and/or glycosidase.
  • antibodies that bind to a protease or glycosidase as set forth herein, antibodies that bind to a heterologous polynucleotide or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide after administration of a protease and/or glycosidase or administration of a recombinant viral vector is optional in treatment methods according to the instant invention.
  • a protease or glycosidase can be administered to a subject any number of times.
  • a protease and/or glycosidase can be administered 2 to 5 times, 2 to 10 times, 2 to 15 times to a subject.
  • a protease or glycosidase can be administered to a subject for any duration of time on a regular basis, such as consecutive days, or alternating days, or an irregular basis.
  • a protease and/or glycosidase is administered from about 1 to 12 weeks, or from about 1 to 10 weeks, or from about 1 to 8 weeks, or from about 1 to 6 weeks, or from about 1 to 4 weeks, or from about 1 to 2 weeks, or about 2 weeks after administration of a recombinant viral vector.
  • a recombinant viral vector is administered before or after a protease or glycosidase is administered to a subject.
  • a recombinant viral vector is administered to a subject e.g., 1-12, 12-24 or 24-48 hours, or 2-4, 4-6, 6-8, 8-10, 10-14, 14-20, 20-25, 25-30, 30-50, or more than 50 days following administering a protease or glycosidase to the subject.
  • a protease or glycosyl is administered to a subject e.g., 1-12, 12-24 or 24-48 hours, or 2-4, 4-6, 6-8, 8-10, 10-14, 14-20, 20-25, 25-30, 30-50, or more than 50 days following administering a recombinant viral vector to the subject.
  • the recombinant viral vector, protease and/or glycosidase may be administered alone or in a combination.
  • a recombinant viral vector is administered to a subject separately from a protease and/or glycosidase.
  • a recombinant viral vector is administered to a subject in combination with a protease and/or glycosidase.
  • a mixture of a protease and glycosidase is administered to a subject, one or more times.
  • two or more proteases or glycosidases are administered to a subject, one or more times.
  • At least one immunosuppressive agent is administered to a subject prior to, substantially contemporaneously with or after administration of a recombinant viral vector, protease or glycosidase to the subject.
  • an immunosuppressive agent is an anti-inflammatory agent such as a steroid.
  • an immunosuppressive agent is prednisone, cyclosporine (e.g ., cyclosporine A), mycophenolate, rituximab, rapamycin or a derivative thereof.
  • Additional strategies to reduce humoral immunity include methods to remove, deplete, capture, and/or inactivate antibodies, commonly referred to as apheresis and more particularly, plasmapheresis where blood products are involved.
  • Apheresis or plasmapheresis is a process in which a human subject’s plasma is circulated ex vivo (extracorporal) through a device that modifies the plasma through addition, removal and/or replacement of components before its return to the patient.
  • Plasmapheresis can be used to remove human immunoglobulins (e.g., IgG, IgE, IgA, IgD) from a blood product (e.g., plasma).
  • This procedure depletes, captures, inactivates, reduces or removes immunoglobulins (antibodies) that bind a recombinant viral vector, bind to a heterologous polynucleotide, bind to a protein or peptide encoded by the heterologous polynucleotide, bind to a protease and/or bind to a glycosidase thereby reducing the titer of antibodies in the treated subject that may contribute, for example, to viral vector neutralization.
  • An example is a device composed of an AAV capsid affinity matrix column.
  • AAV capsid affinity matrix Passing blood product (e.g., plasma) through such an AAV capsid affinity matrix would result in binding only of AAV antibodies, and of all isotypes (including IgG, IgM, etc.).
  • Immunoadsorption U.S. Patent Application publication US 2018/0169273 Al
  • Affinity ligands international patent application publication WO/2018/158397
  • Any of the aforementioned strategies can be used prior to, substantially contemporaneously with or after administration of a recombinant viral vector, protease or glycosidase to the subject.
  • Additional strategies to reduce (overcome) or avoid humoral immunity to AAV in systemic gene transfer include use of AAV empty capsid particles and/or capsid proteins as decoys to adsorb anti-AAV antibodies. Still further strategies are described in Mingozzi et al., 2013, Blood, 122:23-36.
  • a protease and/or glycosidase may be encapsulated or complexed with liposomes, nanoparticles, lipid nanoparticles, polymers, microparticles, microcapsules, micelles, or extracellular vesicles.
  • viral particles may be encapsulated or complexed with liposomes, nanoparticles, lipid nanoparticles, polymers, microparticles, microcapsules, micelles, or extracellular vesicles.
  • liposomes, nanoparticles, lipid nanoparticles, polymers, microparticles, microcapsules, micelles, or extracellular vesicles can be used in the instant invention for non-viral delivery of gene therapy nucleic acids.
  • A“lipid nanoparticle” or“LNP” refers to a lipid-based vesicle useful for delivery of recombinant viral vector and or protease and/or glycosidase and having dimensions on the nanoscale, i.e., from about 10 nm to about 1000 nm, or from about 50 to about 500 nm, or from about 75 to about 127 nm. Without being bound by theory, LNP is believed to provide the protease, glycosidase, or recombinant viral vector with partial or complete shielding from the immune system.
  • Shielding allows delivery of the protease, glycosidase, or recombinant viral vector to a tissue or cell while avoiding inducing a substantial immune response against the protease, glycosidase, or recombinant viral vector in vivo. Shielding may also allow repeated administration without inducing a substantial immune response against the protease, glycosidase, or recombinant viral vector in vivo (e.g., in a subject such as a human). Shielding may also improve or increase delivery efficiency, duration of therapeutic effect and/or therapeutic efficacy in vivo.
  • the pi (isoelectric point) of AAV is in a range from about 6 to about 6.5.
  • the AAV surface carries a slight negative charge.
  • the LNP may be beneficial for the LNP to comprise a cationic lipid such as, for example, an amino lipid.
  • a cationic lipid such as, for example, an amino lipid.
  • Exemplary amino lipids have been described in U.S. Patent Nos. 9,352,042, 9,220,683, 9,186,325, 9,139,554, 9,126,966 9,018,187, 8,999,351, 8,722,082, 8,642,076, 8,569,256, 8,466,122, and 7,745,651 and U.S. Patent Publication Nos. 2016/0213785, 2016/0199485, 2015/0265708, 2014/0288146, 2013/0123338, 2013/0116307, 2013/0064894, 2012/017241 1, and 2010/01 17125.
  • the terms“cationic lipid” and“amino lipid” are used interchangeably herein to include those lipids and salts thereof having one, two, three, or more fatty acid or fatty alkyl chains and a pH-titratable amino group (e.g ., an alkylamino or dialkylamino group).
  • the cationic lipid is typically protonated (i.e., positively charged) at a pH below the pKa of the cationic lipid and is substantially neutral at a pH above the pKa.
  • the cationic lipids may also be titratable cationic lipids.
  • the cationic lipids comprise: a protonatable tertiary amine ⁇ e.g., pH-titratable) group; Cl 8 alkyl chains, wherein each alkyl chain independently has 0 to 3 (e.g., 0, 1 , 2, or 3) double bonds; and ether, ester, or ketal linkages between the head group and alkyl chains.
  • Cationic lipids may include, without limitation, 1 ,2-dilinoleyloxy-N,N- dimethylaminopropane (DLinDMA), 1 ,2-dilinolenyloxy-N,N-dimethylaminopropane (DLenDMA), 1 ,2-di-Y-linolenyloxy-N,N-dimethylaminopropane (g-DLenDMA), 2,2-dilinoleyl- 4-(2-dimethylaminoethyl)-[l,3]-dioxolane (DLin-K-C2-DMA, also known as DLin-C2K-DMA, XTC2, and C2K), 2,2-dilinoleyl-4-dimethylaminomethyl-[l,3]-dioxolane (DLin-K-DMA), dilinoleylmethyl-3-dimethylaminopropionate (DLin-M-C2-D
  • cationic lipids also include, but are not limited to, l,2-distearyloxy-N,N-dimethyl-3-aminopropane (DSDMA), 1 ,2- dioleyloxy-N,N-dimethyl-3-aminopropane (DODMA), 2,2-dilinoleyl-4-(3- dimethylaminopropyl)-[l ,3]-dioxolane (DLin-K-C3-DMA), 2,2-dilinoleyl-4-(3- dimethylaminobutyl)-[l,3]-dioxolane (DLin-K-C4-DMA), DLen-C2K-DMA, y-DLen-C2K- DMA, and (DLin-MP-DMA) (also known as 1-B11).
  • DSDMA distearyloxy-N,N-dimethyl-3-aminopropane
  • DODMA dioleyloxy-N,N
  • Still further cationic lipids may include, without limitation, 2,2-dilinoleyl-5- dimethylaminomethyl-[l,3]-dioxane (DLin-K6-DMA), 2,2-dilinoleyl-4-N-methylpepiazino- [l,3]-dioxolane (DLin-K-MPZ), l,2-dilinoleylcarbamoyloxy-3-dimethylaminopropane (DLin-C- DAP), l,2-dilinoleyoxy-3-(dimethylamino)acetoxypropane (DLin-DAC), 1 ,2-dilinolcyoxy-3- morpholinopropane (DLin-MA), l ,2-dilinoleoyl-3-dimethylaminopropane (DLinDAP), 1,2- dilinoleylthio-3-dimethylaminopropane (DLin-S-DMA),
  • a number of commercial preparations of cationic lipids can be used, such as, LIPOFECTIN® (including DOTMA and DOPE, available from GIBCO/BRL), and LIPOFECT AMINE® (comprising DOSPA and DOPE, available from GIBCO/BRL).
  • LIPOFECTIN® including DOTMA and DOPE, available from GIBCO/BRL
  • LIPOFECT AMINE® comprising DOSPA and DOPE, available from GIBCO/BRL
  • cationic lipid may be present in an amount from about 10% by weight of the LNP to about 85% by weight of the lipid nanoparticle, or from about 50 % by weight of the LNP to about 75% by weight of the LNP.
  • Sterols may confer fluidity to the LNP.
  • “sterol” refers to any naturally occurring sterol of plant (phytosterols) or animal (zoosterols) origin as well as non-naturally occurring synthetic sterols, all of which are characterized by the presence of a hydroxyl group at the 3-position of the steroid A-ring.
  • the sterol can be any sterol conventionally used in the field of liposome, lipid vesicle or lipid particle preparation, most commonly cholesterol.
  • Phytosterols may include campesterol, sitosterol, and stigmasterol.
  • Sterols also includes sterol-modified lipids, such as those described in U.S. Patent Application Publication 2011/0177156.
  • a sterol may be present in an amount from about 5% by weight of the LNP to about 50% by weight of the lipid nanoparticle or from about 10% by weight of the LNP to about 25% by weight of the LNP.
  • LNP can comprise a neutral lipid.
  • Neutral lipids may comprise any lipid species which exists either in an uncharged or neutral zwitterionic form at physiological pH. Such lipids include, without limitation, diacylphosphatidylcholine, diacylphosphatidylethanolamine, ceramide, sphingomyelin, dihydrosphingomyelin, cephalin, and cerebrosides. The selection of neutral lipids is generally guided by consideration of, inter alia, particle size and the requisite stability.
  • the neutral lipid component may be a lipid having two acyl groups (e.g ., diacylphosphatidylcholine and diacylphosphatidylethanolamine).
  • Lipids having a variety of acyl chain groups of varying chain length and degree of saturation are available or may be isolated or synthesized by well-known techniques.
  • lipids containing saturated fatty acids with carbon chain lengths in the range of Cl 4 to C22 may be used.
  • lipids with mono or diunsaturated fatty acids with carbon chain lengths in the range of C 14 to C22 are used.
  • lipids having mixtures of saturated and unsaturated fatty acid chains can be used.
  • Exemplary neutral lipids include, without limitation, l,2-dioleoyl-sn-glycero-3-phosphatidyl-ethanolamine (DOPE), 1 ,2-distearoyl-sn- glycero-3-phosphocholine (DSPC), l-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), or any related phosphatidylcholine.
  • DOPE 1,2-distearoyl-sn- glycero-3-phosphocholine
  • POPC l-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine
  • the neutral lipids may also be composed of sphingomyelin, dihydrosphingomyelin, or phospholipids with other head groups, such as serine and inositol.
  • the neutral lipid may be present in an amount from about 0.1% by weight of the lipid nanoparticle to about 75% by weight of the LNP, or from about 5% by weight of the LNP to about 15% by weight of the LNP.
  • LNP encapsulated protease, glycosidase, or recombinant viral vector can be incorporated into pharmaceutical compositions, e.g., a pharmaceutically acceptable carrier or excipient. Such pharmaceutical compositions are useful for, among other things, administration and delivery of LNP encapsulated protease, glycosidase, or recombinant viral vector to a subject in vivo or ex vivo.
  • Preparations of LNP can be combined with additional components, which may include, for example and without limitation, polyethylene glycol (PEG) and sterols.
  • PEG refers to a polyethylene glycol, a linear, water-soluble polymer of ethylene PEG repeating units with two terminal hydroxyl groups. PEGs are classified by their molecular weights; for example, PEG 2000 has an average molecular weight of about 2,000 daltons, and PEG 5000 has an average molecular weight of about 5,000 daltons. PEGs are commercially available from Sigma Chemical Co.
  • PEGs monomethoxypolyethylene glycol (MePEG-OH), monomethoxypolyethylene glycol-succinate (MePEG-S), monomethoxypolyethylene glycol- succinimidyl succinate (MePEG-S-NHS), monomethoxypolyethylene glycol-amine (MePEG- NH2), monomethoxypolyethylene glycol-tresylate (MePEG-TRES), and monomethoxypolyethylene glycol-imidazolyl-carbonyl (MePEG-IM).
  • MePEG-OH monomethoxypolyethylene glycol
  • MePEG-S monomethoxypolyethylene glycol-succinate
  • MePEG-NHS monomethoxypolyethylene glycol- succinimidyl succinate
  • MePEG-NH2 monomethoxypolyethylene glycol-amine
  • MePEG-TRES monomethoxypolyethylene glycol-tresylate
  • MePEG-IM monome
  • PEG may be a polyethylene glycol with an average molecular weight of about 550 to about 10,000 daltons and is optionally substituted by alkyl, alkoxy, acyl or aryl. In certain embodiments, the PEG may be substituted with methyl at the terminal hydroxyl position. In certain embodiments, the PEG may have an average molecular weight from about 750 to about 5,000 daltons, or from about 1 ,000 to about 5,000 daltons, or from about 1 ,500 to about 3,000 daltons or from about 2,000 daltons or of about 750 daltons. The PEG can be optionally substituted with alkyl, alkoxy, acyl or aryl. In certain embodiments, the terminal hydroxyl group may be substituted with a methoxy or methyl group.
  • PEG-modified lipids include the PEG-dialkyloxypropyl conjugates (PEG-DAA) described in U.S. Patent Nos. 8,936,942 and 7,803,397.
  • PEG-modified lipids (or lipid- polyoxyethylene conjugates) that are useful may have a variety of“anchoring” lipid portions to secure the PEG portion to the surface of the lipid vesicle.
  • suitable PEG-modified lipids include PEG-modified phosphatidylethanolamine and phosphatidic acid, PEG-ceramide conjugates (e.g ., PEG-CerCl4 or PEG-CerC20) which are described in ET.S. Patent No.
  • the PEG-modified lipid may be PEG-modified diacylglycerols and dialkylglycerols.
  • the PEG may be in an amount from about 0.5% by weight of the LNP to about 20% by weight of the LNP, or from about 5% by weight of the LNP to about 15% by weight of the LNP.
  • LNP can be a PEG-modified and a sterol-modified LNP.
  • the LNPs, combined with additional components, can be the same or separate LNPs.
  • the same LNP can be PEG modified and sterol modified or, alternatively, a first LNP can be PEG modified and a second LNP can be sterol modified.
  • the first and second modified LNPs can be combined.
  • prior to encapsulating LNPs may have a size in a range from about 10 nm to 500 nm, or from about 50 nm to about 200 nm, or from 75 nm to about 125 nm.
  • LNP encapsulated protease, glycosidase, or recombinant viral vector may have a size in a range from about 10 nm to 500 nm.
  • nucleic acid and“polynucleotide” are used interchangeably herein to refer to all forms of nucleic acid, oligonucleotides, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
  • Nucleic acids include genomic DNA, cDNA and antisense DNA, and spliced or unspliced mRNA, rRNA tRNA and inhibitory DNA or RNA (RNAi, e.g., small or short hairpin (sh)RNA, microRNA (miRNA), small or short interfering (si)RNA, trans-splicing RNA, or antisense RNA).
  • RNAi e.g., small or short hairpin (sh)RNA, microRNA (miRNA), small or short interfering (si)RNA, trans-splicing RNA, or antisense RNA.
  • Nucleic acids include naturally occurring, synthetic, and intentionally modified or altered polynucleotides. Nucleic acids can be single, double, or triplex, linear or circular, and can be of any length. In discussing nucleic acids, a sequence or structure of a particular polynucleotide may be described herein according to the convention of providing the sequence in the 5' to 3' direction.
  • A“heterologous” nucleic acid sequence refers to a polynucleotide inserted into a plasmid or vector for purposes of vector mediated transfer/de livery of the polynucleotide into a cell.
  • Heterologous nucleic acid sequences are distinct from viral nucleic acid, i.e., are non-native with respect to viral nucleic acid.
  • a heterologous nucleic acid sequence, contained within the vector can be expressed (e.g., transcribed, and translated if appropriate).
  • a transferred/delivered heterologous polynucleotide in a cell, contained within the vector need not be expressed.
  • heterologous is not always used herein in reference to nucleic acid sequences and polynucleotides, reference to a nucleic acid sequence or polynucleotide even in the absence of the modifier“heterologous” is intended to include heterologous nucleic acid sequences and polynucleotides in spite of the omission.
  • transgene is used herein to conveniently refer to a nucleic acid that is intended or has been introduced into a cell or organism.
  • Transgenes include any nucleic acid, such as a heterologous polynucleotide sequence or a heterologous nucleic acid encoding a protein or peptide.
  • the term transgene and heterologous nucleic acid/polynucleotide sequences are used interchangeably herein.
  • a heterologous polynucleotide encodes a protein selected from the group consisting of GAA (acid alpha-glucosidase) for treatment of Pompe disease; ATP7B (copper transporting ATPase2) for treatment of Wilson’s disease; alpha galactosidase for treatment of Fabry’s disease; ASS 1 (arginosuccinate synthase) for treatment of Citrullinemia Type 1 ; beta- glucocerebrosidase for treatment of Gaucher disease Type 1 ; beta-hexosaminidase A for treatment of Tay Sachs disease; SERPING1 (Cl protease inhibitor or Cl esterase inhibitor) for treatment of hereditary angioedema (HAE), also known as Cl inhibitor deficiency type I and type II); and glucose-6-phosphatase for treatment of glycogen storage disease type I (GSDI).
  • GAA acid alpha-glucosidase
  • ATP7B copper transporting ATPase2
  • a heterologous polynucleotide encodes a protein selected from the group consisting of insulin, glucagon, growth hormone (GH), parathyroid hormone (PTH), growth hormone releasing factor (GRF), follicle stimulating hormone (FSH), luteinizing hormone (LH), human chorionic gonadotropin (hCG), vascular endothelial growth factor (VEGF), angiopoietins, angiostatin, granulocyte colony stimulating factor (GCSF), erythropoietin (EPO), connective tissue growth factor (CTGF), basic fibroblast growth factor (bFGF), acidic fibroblast growth factor (aFGF), epidermal growth factor (EGF), transforming growth factor a (TGFa), platelet-derived growth factor (PDGF), insulin growth factors I and II (IGF-I and IGF-II), TGF , activins, inhibins, bone morphogenic protein (BMP), nerve growth factor (NGF
  • a heterologous polynucleotide encodes acid a-glucosidase (GAA).
  • Administration of a recombinant viral vector comprising a heterologous polynucleotide encoding GAA to a subject with Pompe or another glycogen storage disease can lead to the expression of the GAA protein.
  • Expression of GAA protein in the patient may serve to suppress, inhibit or reduce the accumulation of glycogen, prevent the accumulation of glycogen or degrade glycogen, which in turn can reduce or decrease one or more adverse effects of Pompe disease, or another glycogen storage disease.
  • a heterologous polynucleotide encodes a protein selected from the group consisting of thrombopoietin (TPO), an interleukin (IL-l through IL-36, etc.), monocyte chemoattractant protein, leukemia inhibitory factor, granulocyte-macrophage colony stimulating factor, Fas ligand, tumor necrosis factors a and b, interferons a, b, and g, stem cell factor, flk-2/flt3 ligand, IgG, IgM, IgA, IgD and IgE, chimeric immunoglobulins, humanized antibodies, single chain antibodies, T cell receptors, chimeric T cell receptors, single chain T cell receptors, class I and class II MHC molecules.
  • TPO thrombopoietin
  • IL-l through IL-36 etc.
  • monocyte chemoattractant protein monocyte chemoattractant protein
  • a heterologous polynucleotide encodes CFTR (cystic fibrosis transmembrane regulator protein), a blood coagulation (clotting) factor (Factor XIII, Factor IX, Factor VIII, Factor X, Factor VII, Factor Vila, protein C, etc.) a gain of function blood coagulation factor, an antibody, retinal pigment epithelium-specific 65 kDa protein (RPE65), erythropoietin, FDF receptor, lipoprotein lipase, ornithine transcarbamylase, b-globin, a-globin, spectrin, a- antitrypsin, adenosine deaminase (ADA), a metal transporter (ATP7A or ATP7), sulfamidase, an enzyme involved in lysosomal storage disease (ARSA), hypoxanthine guanine phosphoribosyl transfera
  • CFTR cy
  • a heterologous polynucleotide encodes erythropoietin (EPO) for treatment of anemia; interferon-alpha, interferon-beta, and interferon-gamma for treatment of various immune disorders, viral infections and cancer; an interleukin (IL), including any one of IL-l through IL-36, and corresponding receptors, for treatment of various inflammatory diseases or immuno-deficiencies; a chemokine, including chemokine (C-X-C motif) ligand 5 (CXCL5) for treatment of immune disorders; granulocyte-colony stimulating factor (G-CSF) for treatment of immune disorders such as Crohn’s disease; granulocyte-macrophage colony stimulating factor (GM-CSF) for treatment of various human inflammatory diseases; macrophage colony stimulating factor (M-CSF) for treatment of various human inflammatory diseases; keratinocyte growth factor (KGF) for treatment of epithelial tissue damage
  • EPO erythrop
  • polypeptides “proteins” and“peptides” are used interchangeably herein.
  • the “polypeptides,” “proteins” and“peptides” encoded by the “polynucleotide sequences,” include full-length native sequences, as with naturally occurring proteins, as well as functional subsequences, modified forms or sequence variants so long as the subsequence, modified form or variant retains some degree of functionality of the native full-length protein.
  • polypeptides, proteins and peptides encoded by the polynucleotide sequences can be, but are not required to be, identical to the endogenous protein that is defective, or whose expression is insufficient, or deficient in the treated mammal.
  • the heterologous polynucleotide encodes an inhibitory nucleic acid selected from the group consisting of a siRNA, an antisense molecule, miRNA, RNAi, a ribozyme and a shRNA.
  • an inhibitory nucleic acid binds to a gene, a transcript of a gene, or a transcript of a gene associated with a polynucleotide repeat disease selected from the group consisting of a huntingtin (HTT) gene, a gene associated with dentatorubropallidoluysian atrophy (atrophin 1, ATN1), androgen receptor on the X chromosome in spinobulbar muscular atrophy, human Ataxin-l , -2, -3, and -7, Cav2.l P/Q voltage-dependent calcium channel (CACNA1A), TATA-binding protein, Ataxin 8 opposite strand (ATXN80S), Serine/threonine -protein phosphatase 2A 55 kDa regulatory subunit B beta isoform in spinocerebellar ataxia (type 1, 2, 3, 6, 7, 8, 12 17), FMR1 (fragile X mental retardation 1) in fragile X syndrome, FMR1 (fragile X mental retardation 1) in fragile X syndrome
  • Recombinant viral vector doses can be administered at any appropriate dose. Generally, doses will range from at least lxlO 8 , or more, for example, lxlO 9 , l xlO 10 , lxlO 11 , lxlO 12 , lxlO 13 or lxlO 14 , or more, vector genomes per kilogram (vg/kg) of the weight of the subject, to achieve a therapeutic effect.
  • a dose from about lxlO 11 vg/kg to about 5xl0 14 vg/kg inclusive, or from about 5xlO n vg/kg to about lxlO 14 vg/kg inclusive, or from about 5xlO n vg/kg to about 5xl0 13 vg/kg inclusive, or from about 5xlO n vg/kg to about lxlO 13 vg/kg inclusive, or from about 5x10 11 vg/kg or about 5x10 12 vg/kg inclusive, or from about 5x10 11 vg/kg to about lxlO 12 vg/kg inclusive.
  • Doses can be, for example, about 5xl0 14 vg/kg, or less than about 5xl0 14 vg/kg, such as a dose from about 2x10 11 to about 2x10 14 vg/kg inclusive, in particular, for example, about 2xl0 12 vg/kg, about 6xl0 12 vg/kg, or about 2xl0 13 vg/kg.
  • administration of a protease and/or glycosidase to a subject reduces the dose of a recombinant viral vector comprising a heterologous polynucleotide required to be effective for treatment of a subject.
  • administration of a protease and/or glycosidase to a subject allows for administration of an increased dose of a recombinant viral vector comprising a heterologous polynucleotide.
  • Doses can vary and depend upon the type, onset, progression, severity, frequency, duration, or probability of the disease to which treatment is directed, the clinical endpoint desired, previous or simultaneous treatments, the general health, age, gender, race or immunological competency of the subject and other factors that will be appreciated by the skilled artisan.
  • the dose amount, number, frequency or duration may be proportionally increased or reduced, as indicated by any adverse side effects, complications or other risk factors of the treatment or therapy and the status of the subject. The skilled artisan will appreciate the factors that may influence the dosage and timing required to provide an amount sufficient for providing a therapeutic or prophylactic benefit.
  • the dose to achieve a therapeutic effect e.g., the dose in vector genomes/per kilogram of body weight (vg/kg) will vary based on several factors including, but not limited to: route of administration, the level of heterologous polynucleotide expression required to achieve a therapeutic effect, the specific disease treated, any host immune response to the recombinant viral vector, a host immune response to the heterologous polynucleotide or expression product (protein or peptide), and the stability of the protein or peptide expressed.
  • route of administration e.g., the level of heterologous polynucleotide expression required to achieve a therapeutic effect
  • the specific disease treated any host immune response to the recombinant viral vector, a host immune response to the heterologous polynucleotide or expression product (protein or peptide), and the stability of the protein or peptide expressed.
  • An“effective amount” or“sufficient amount” refers to an amount that provides, in single or multiple doses, alone or in combination, with one or more other compositions, treatments, protocols, or therapeutic regimens agents, a detectable response of any duration of time (long or short term), an expected or desired outcome in or a benefit to a subject of any measurable or detectable degree or for any duration of time (e.g ., for minutes, hours, days, months, years, or cured).
  • the doses of an“effective amount” or“sufficient amount” for treatment typically are effective to provide a response to one, multiple or all adverse symptoms, consequences or complications of the disease, one or more adverse symptoms, disorders, illnesses, pathologies, or complications, for example, caused by or associated with the disease, to a measurable extent, although decreasing, reducing, inhibiting, suppressing, limiting or controlling progression or worsening of the disease is a satisfactory outcome.
  • An effective amount or a sufficient amount can but need not be provided in a single administration, may require multiple administrations, and, can but need not be, administered alone or in combination with another composition ⁇ e.g., agent), treatment, protocol or therapeutic regimen.
  • the amount may be proportionally increased as indicated by the need of the subject, type, status and severity of the disease treated or side effects (if any) of treatment.
  • an effective amount or a sufficient amount need not be effective or sufficient if given in single or multiple doses without a second composition ⁇ e.g., another drug or agent), treatment, protocol or therapeutic regimen, since additional doses, amounts or duration above and beyond such doses, or additional compositions ⁇ e.g., drugs or agents), treatments, protocols or therapeutic regimens may be included in order to be considered effective or sufficient in a given subject.
  • Amounts considered effective also include amounts that result in a reduction of the use of another treatment, therapeutic regimen or protocol, such as administration of recombinant GAA for treatment of a lysosomal storage disease (e.g ., Pompe disease), or administration of a recombinant clotting factor protein (e.g., FVIII or FIX) for treatment of a clotting disorder (e.g., hemophilia A (HemA) or hemophilia B (HemB)).
  • a lysosomal storage disease e.g ., Pompe disease
  • a recombinant clotting factor protein e.g., FVIII or FIX
  • a clotting disorder e.g., hemophilia A (HemA) or hemophilia B (HemB)
  • an effective amount would be an amount of GAA that inhibits or reduces glycogen production or accumulation, enhances or increases glycogen degradation or removal, reduces lysosomal alterations in tissues of the body of a subject, or improves muscle tone and/or muscle strength and/or respiratory function in a subject, for example.
  • Effective amounts can be determined, for example, by ascertaining the kinetics of GAA uptake by myoblasts from plasma. Myoblasts GAA uptake rates (K uptake ) of about 141 - 147 nM may appear to be effective (see, e.g., Maga et ah, J. Biol. Chem. 2012)
  • GAA activity levels in plasma of greater than about 1 ,000 nmol/hr/mL, for example, about 1,000 to about 2,000 nmol/hr/mL have been observed to be therapeutically effective.
  • a blood coagulation factor concentration that is greater than 1% of factor concentration found in a normal individual is needed to change a severe disease phenotype to a moderate one.
  • a severe phenotype is characterized by joint damage and life-threatening bleeds.
  • a blood coagulation factor concentration greater than 5% of normal is needed.
  • FVIII and FIX levels in normal humans are about 150-200 ng/mL plasma, but may be less (e.g., range of about 100-150 ng/mL) or greater (e.g., range of about 200-300 ng/mL) and still considered normal, due to functional cloting as determined, for example, by an activated partial thromboplastin time (aPTT) one-stage cloting assay.
  • aPTT activated partial thromboplastin time
  • the composition can be administered to a subject as a combination composition, or administered separately, such as concurrently or in series or sequentially (prior to or following) delivery or administration of a recombinant viral vector comprising a heterologous polynucleotide.
  • the instant invention provides combinations in which a method or use of the instant invention is in a combination with any compound, agent, drag, therapeutic regimen, treatment protocol, process, remedy or composition, set forth herein or known to one of skill in the art.
  • the compound, agent, drag, therapeutic regimen, treatment protocol, process, remedy or composition can be administered or performed prior to, substantially contemporaneously with or following administration of a recombinant viral vector comprising a heterologous polynucleotide, to a subject.
  • the instant invention includes, inter alia, methods and uses that result in a reduced need or use of another compound, agent, drag, therapeutic regimen, treatment protocol, process, or remedy.
  • a method of treatment according to the instant invention has a therapeutic benefit if in a given subject a less frequent or reduced dose or elimination of administration of a recombinant clotting factor protein to supplement for the deficient or defective (abnormal or mutant) endogenous clotting factor in the subject.
  • a methods of treatment according to the instant invention has a therapeutic benefit even if a less frequent or reduced dose of a recombinant viral vector comprising GAA has been previously administered, or continues to be administered to a subject.
  • reducing the need for, or the use of, another treatment or therapy is included in the instant invention.
  • An effective amount or a sufficient amount need not be effective in each and every subject treated, nor a majority of treated subjects in a given group or population.
  • An effective amount or a sufficient amount means effectiveness or sufficiency in a particular subject, not a group or the general population. As is typical for such methods, some subjects will exhibit a greater response, or less or no response to a given treatment method or use.
  • the term“ameliorate” means a detectable or measurable improvement in a subject’s disease or symptom thereof, or an underlying cellular response.
  • a detectable or measurable improvement includes a subjective or objective decrease, reduction, inhibition, suppression, limit or control in the occurrence, frequency, severity, progression, or duration of the disease, or complication caused by or associated with the disease, or an improvement in a symptom or an underlying cause or a consequence of the disease, or a reversal of the disease.
  • an effective amount would be an amount that inhibits or reduces glycogen production or accumulation, enhances or increases glycogen degradation or removal, improves muscle tone and/or muscle strength and/or respiratory function, for example.
  • HemA or HemB an effective amount would be an amount that reduces frequency or severity of acute bleeding episodes in a subject, for example, or an amount that reduces clotting time as measured by a clotting assay, for example.
  • compositions of the instant invention include compositions wherein the active ingredients are contained in an effective amount to achieve the intended therapeutic purpose. Determining a therapeutically effective dose is well within the capability of a skilled medical practitioner using techniques and guidance known in the art and using the teachings provided herein.
  • Therapeutic doses will depend on, among other factors, the age and general condition of the subject, the severity of the aberrant phenotype, and the strength of the control sequences regulating expression levels. Thus, a therapeutically effective amount in humans will fall in a relatively broad range that may be determined by a medical practitioner based on the response of an individual patient to a vector-based treatment. Such doses may be alone or in combination with an immunosuppressive agent or drug.
  • compositions such as pharmaceutical compositions may be delivered to a subject, so as to allow transgene expression and optionally production of encoded protein.
  • pharmaceutical compositions comprising sufficient genetic material to enable a subject to produce a therapeutically effective amount of a blood-clotting factor to improve hemostasis in the subject.
  • pharmaceutical compositions comprising sufficient heterologous polynucleotide to enable a subject to produce a therapeutically effective amount of GAA.
  • a therapeutic effect in a subject is sustained for a period of time, e.g., 2-4, 4-6, 6-8, 8-10, 10-14, 14-20, 20-25, 25-30, or 30-50 days or more, for example, 50-75, 75-100, 100-150, 150-200 days or more.
  • a recombinant viral vector provides a therapeutic effect.
  • a recombinant viral vector provides a therapeutic effect without an immunosuppressive agent.
  • at least one immunosuppressive agent is administered to a subject prior to, substantially contemporaneously with or after administration of a recombinant viral vector to the subject.
  • an immunosuppressive agent is an anti-inflammatory agent.
  • an immunosuppressive agent is a steroid.
  • an immunosuppressive agent is prednisone, cyclosporine (e.g ., cyclosporine A), mycophenolate, rituximab, rapamycin or a derivative thereof. Additional particular agents include a stabilizing compound.
  • a B cell targeting antibody e.g., rituximab
  • a proteasome inhibitor e.g., bortezomib
  • mTOR mammalian target of rapamycin
  • a tyrosine kinase inhibitor e.g., ibrutinib
  • BAFF B-cell activating factor
  • compositions may be administered in any sterile, biocompatible pharmaceutical carrier, including, but not limited to, saline, buffered saline, dextrose, and water.
  • the compositions may be administered to a patient alone, or in combination with other agents, which influence dosage amount, administration frequency and/or therapeutic efficacy.
  • compositions may be delivered subcutaneously, epidermally, intradermally, intrathecally, intraorbitally, intramucosally, intraperitoneally, intravenously, intra-pleurally, intraarterially, orally, intrahepatically, via the portal vein, or intramuscularly.
  • Methods of treatment according to the instant invention include combination therapies that include the additional use of any compound, agent, drug, treatment or other therapeutic regimen or protocol having a desired therapeutic, beneficial, additive, synergistic or complementary activity or effect.
  • Exemplary combination compositions and treatments include second actives, such as, biologies (proteins), agents (e.g ., immunosuppressive agents) and drugs.
  • second actives such as, biologies (proteins), agents (e.g ., immunosuppressive agents) and drugs.
  • Such biologies (proteins), agents, drugs, treatments and therapies can be administered or performed prior to, substantially contemporaneously with or following any other method of treatment according to the instant invention, for example, a therapeutic method of treating a subject for a lysosomal storage disease such as Pompe, or a therapeutic method of treating a subject for a blood clotting disease such as HemA or HemB.
  • the compound, agent, drug, treatment or other therapeutic regimen or protocol can be administered as a combination composition, or administered separately, such as concurrently or in series or sequentially (prior to or following) delivery or administration of a nucleic acid, vector, recombinant vector ⁇ e.g., recombinant viral vector), or recombinant virus particle.
  • the instant invention therefore provides combinations in which a method of treatment according to the instant invention is in a combination with any compound, agent, drug, therapeutic regimen, treatment protocol, process, remedy or composition, set forth herein or known to one of skill in the art.
  • the compound, agent, drug, therapeutic regimen, treatment protocol, process, remedy or composition can be administered or performed prior to, substantially contemporaneously with or following administration of a nucleic acid, vector, recombinant vector ⁇ e.g., recombinant viral vector), or recombinant virus particle administered to a patient according to the instant invention.
  • a nucleic acid e.g., recombinant viral vector
  • recombinant vector e.g., recombinant viral vector
  • virus particle administered to a patient according to the instant invention.
  • administration of a protease and/or glycosidase to a subject may lead to prevention of development of neutralizing antibodies, antibodies that bind to the heterologous polynucleotide and/or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide.
  • administration of the protease and/or glycosidase to such a subject can be prior to administration of a viral vector, substantially contemporaneously at the time of administration of a viral vector, or after administration of a viral vector to the subject.
  • administration of a protease and/or glycosidase to a subject with pre-existing antibodies leads to reduction of neutralizing antibodies, antibodies that bind to the heterologous polynucleotide and/or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide.
  • a recombinant viral vector in accordance with the methods herein.
  • Such subjects may optionally be evaluated for presence of remaining pre-existing antibodies after administration of a recombinant viral vector.
  • such subjects can be administered the recombinant viral vector after a predetermined amount of time has passed during which the protease and/or glycosidase reduces or eliminates any such pre-existing antibodies in the subject.
  • administration of a protease and/or glycosidase to a subject may lead to degradation or digestion of at least 20% to 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% of neutralizing antibodies, antibodies that bind to the heterologous polynucleotide and/or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide, as reflected by measurement of such antibodies in a biological sample obtained from a subject administered a recombinant viral vector.
  • a method according to the instant invention degrades or digests at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% of the neutralizing antibodies, and/or antibodies that bind to the heterologous polynucleotide and/or antibodies that bind to a protein or peptide encoded by the heterologous polynucleotide.
  • Non-limiting examples of a biological sample from a subject that may be analyzed include whole blood, serum, plasma, the like, and a combination thereof.
  • a biological sample may be devoid of cells, or may include cells ( e.g ., red blood cells, platelets and/or lymphocytes).
  • neutralizing antibodies present in a biological sample of a subject may be degraded or digested to less than about 1 :25, where 1 part of the biological sample diluted in 25 of buffer results in 50% recombinant viral vector neutralization.
  • neutralizing antibodies present in a biological sample of the subject may be degraded or digested to less than about 1 :20, less than about 1 : 15, less than about 1 : 10, less than about 1 :5, less than about 1 :4, less than about 1 :3, less than about 1 :2, or less than about 1 : 1 , where 1 part of the biological sample diluted in 20, 15, 10, 5, 4, 3, 2, or 1 part, respectively, of buffer results in 50% recombinant viral vector neutralization.
  • Antibody binding to Fc receptor can be measured by determining the equilibrium binding constant. Reduction in Fc receptor binding of an antibody is determined by an increase in the equilibrium binding constant for the IgG:FcR interaction.
  • Methods according to the instant invention are applicable to both loss of function and gain and function genetic defects.
  • the term“loss-of-function” in reference to a genetic defect as used herein refers to any mutation in a gene in which the protein encoded by said gene (i.e., the mutant protein) exhibits either a partial or a full loss of function that is normally associated with the wild-type protein.
  • the gain-of-function mutation can be a deletion, addition, or substitution of a nucleotide or nucleotides in the gene, which gives rise to the change in the function of the encoded protein.
  • the gain-of-function mutation changes the function of the mutant protein or causes interactions with other proteins.
  • the gain-of-function mutation causes a decrease in or removal of normal wild-type protein, for example, by interaction of the altered, mutant protein with said normal, wild-type protein.
  • Diseases and disorders that may be treated by methods according to the instant invention include, for example and without limitation, lung disease (e.g., cystic fibrosis), a bleeding disorder (e.g., hemophilia A or hemophilia B with or without inhibitors), thalassemia, a blood disorder (e.g., anemia), Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis (AFS), epilepsy, a lysosomal storage disease )e.g., aspartylglucosaminuria, Batten disease, late infantile neuronal ceroid lipofuscinosis type 2 (CFN2), cystinosis, Fabry disease, Gaucher disease types I, II, and III, glycogen storage disease II (Pompe disease), GM2- gangliosidosis type I (Tay Sachs disease), GM2-gangliosidosis type II (Sandhoff disease), mucolipidosis types I (s), s
  • Glycogen storage disease type II also called Pompe disease may be treated by methods according to the instant invention.
  • Pompe disease is an autosomal recessive disorder caused by mutations in the gene encoding the lysosomal enzyme acid a-glucosidase (GAA), which catalyzes the degradation of glycogen.
  • GAA acid a-glucosidase
  • the resulting enzyme deficiency leads to pathological accumulation of glycogen and lysosomal alterations in all tissues of the body, resulting in cardiac, respiratory, and skeletal muscle dysfunction (van der Ploeg & Reuser, 2008).
  • Blood clotting disorders which may be treated by methods according to the instant invention, include, for example and without limitation, hemophilia A, hemophilia A with inhibitory antibodies, hemophilia B, hemophilia B with inhibitory antibodies, a deficiency in any coagulation Factor: VII, VIII, IX, X, XI, V, XII, II, von Willebrand factor, or a combined FV/FVIII deficiency, thalassemia, vitamin K epoxide reductase Cl deficiency or gamma-carboxylase deficiency.
  • Other diseases and disorders that may be treated by methods according to the instant invention include, for example and without limitation, anemia, bleeding associated with trauma, injury, thrombosis, thrombocytopenia, stroke, coagulopathy, disseminated intravascular coagulation (DIC); over-anticoagulation associated with heparin, low molecular weight heparin, pentasaccharide, warfarin, small molecule antithrombotics (i.e., FXa inhibitors), or a platelet disorder such as, Bernard Soulier syndrome, Glanzmann thrombasthenia, or storage pool deficiency.
  • anemia bleeding associated with trauma, injury, thrombosis, thrombocytopenia, stroke, coagulopathy, disseminated intravascular coagulation (DIC); over-anticoagulation associated with heparin, low molecular weight heparin, pentasaccharide, warfarin, small molecule antithrombotics (i.e., FXa inhibitors), or a platelet disorder such
  • Other diseases and disorders that may be treated by methods according to the instant invention include, for example and without limitation, proliferative diseases (cancers, tumors, dysplasias, etc.), Crigler-Najjar and metabolic diseases like metabolic diseases of the liver, Friedreich ataxia, infectious diseases, viral diseases (induced, e.g., by hepatitis B or C viruses, HIV, herpes, retroviruses, etc.), genetic diseases (cystic fibrosis, dystroglycanopathies, myopathies such as Duchenne muscular myopathy or dystrophy, myotubular myopathy, sickle-cell anemia, sickle cell disease, Fanconi’s anemia, diabetes, amyotrophic lateral sclerosis (ALS), myotubularin myopathy, motor neuron diseases such as spinal muscular atrophy (SMA), spinobulbar muscular atrophy, or Charcot-Marie-Tooth disease, arthritis, severe combined immunodeficiencies (such as RS-SCID, ADA-SCID or X
  • the subject has a disease that affects or originates in the central nervous system (CNS).
  • the disease is a neurodegenerative disease.
  • CNS or neurodegenerative disease include Alzheimer’s disease, Huntington's disease, ALS, hereditary spastic hemiplegia, primary lateral sclerosis, spinal muscular atrophy, Kennedy’s disease, a polyglutamine repeat disease, or Parkinson's disease.
  • the disease is a psychiatric disease, an addition (e.g., to tobacco, alcohol, or drugs), epilepsy, Canavan’s disease, or adrenoleukodystrophy.
  • the CNS or neurodegenerative disease is a polyglutamine repeat disease such as, for example and without limitation, spinocerebellar ataxia (SCA1, SCA2, SCA3, SCA6, SCA7, or SCA17).
  • the instant invention may be used in human and veterinary medical applications. Suitable subjects therefore include mammals, such as humans, as well as non-human mammals.
  • the term“subject” refers to an animal, typically a mammal, such as humans, non-human primates (apes, gibbons, gorillas, chimpanzees, orangutans, macaques), a domestic animal (dogs and cats), a farm animal (poultry such as chickens and ducks, horses, cows, goats, sheep, pigs), and experimental animals (mouse, rat, rabbit, guinea pig).
  • Human subjects include fetal, neonatal, infant, juvenile and adult subjects.
  • Subjects also include animal disease models, for example, mouse and other animal models of protein/enzyme deficiencies such as Pompe disease (loss of GAA), and glycogen storage diseases (GSDs) and others known to those of skill in the art.
  • kits that include packaging material and one or more components therein.
  • a kit typically includes a label or packaging insert including a description of the components or instructions for use in vitro, in vivo, or ex vivo, of the components therein.
  • a kit can contain a collection of such components, e.g., a nucleic acid, recombinant vector, virus (e.g., AAV, lentivirus) vector, or virus particle and a protease and/or glycosidase that degrades or digests antibodies.
  • a kit refers to a physical structure housing one or more components of the kit.
  • Packaging material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, vials, tubes, etc.).
  • Labels or inserts can include identifying information of one or more components therein, dose amounts, clinical pharmacology of the active ingredient(s) including mechanism of action, pharmacokinetics and pharmacodynamics. Labels or inserts can include information identifying manufacturer, lot numbers, manufacture location and date, expiration dates. Labels or inserts can include information identifying manufacturer information, lot numbers, manufacturer location and date. Labels or inserts can include information on a disease for which a kit component may be used. Labels or inserts can include instructions for the clinician or subject for using one or more of the kit components in a method, use, or treatment protocol or therapeutic regimen. Instructions can include dosage amounts, frequency or duration, and instructions for practicing any of the methods, uses, treatment protocols or prophylactic or therapeutic regimes described herein.
  • Labels or inserts can include information on any benefit that a component may provide, such as a prophylactic or therapeutic benefit. Labels or inserts can include information on potential adverse side effects, complications or reactions, such as warnings to the subject or clinician regarding situations where it would not be appropriate to use a particular composition. Adverse side effects or complications could also occur when the subject has, will be or is currently taking one or more other medications that may be incompatible with the composition, or the subject has, will be or is currently undergoing another treatment protocol or therapeutic regimen which would be incompatible with the composition and, therefore, instructions could include information regarding such incompatibilities.
  • Labels or inserts include“printed matter,” e.g., paper or cardboard, or separate or affixed to a component, a kit or packing material (e.g., a box), or attached to an ampule, tube or vial containing a kit component.
  • AAV vectors were prepared as previously described (Ayuso et al. (2010) Gene Ther. 17, 503-10). Genome-containing vectors were produced in roller bottles following a triple transfection protocol with cesium chloride gradient purification (Ayuso et al. (2010)). The AAV vector titration was performed by real time PCR (qPCR) performed in ABI PRISM 7900 HT Sequence Detector using Absolute ROX mix (Taqman, Thermo Fisher Scientific, Waltham, MA), except for empty capsids that were titrated by SDS-PAGE followed by silver staining and quantification by densitometry against an AAV capsid used as a standard.
  • qPCR real time PCR
  • ABI PRISM 7900 HT Sequence Detector using Absolute ROX mix Taqman, Thermo Fisher Scientific, Waltham, MA
  • an AAV8 vector encoding luciferase (AAV8-Luc) was used as reporter as previously described (Miao et al. (2006) Blood. 108, 19-27).
  • the AAV vectors used in the in vivo experiments expressed human FIX or Gaussia luciferase, under the control of a liver-specific promoter (Manno et al. (2006); Mingozzi et al. (2013) Gene Ther. 20, 417-24).
  • the IdeS coding sequence(CDS) was cloned into a pEX-N-His-tagged cloning vector (OriGene Technologies, Inc., Rockville MD), which was transformed into BL21 competent E. coli (NEB, Ipswich, MA) following the manufacturer’s instructions. Protein expression was induced at 37 °C for 4 hr by adding IPTG 0.5 mM to the bacterial culture. Detection and purification of the protein were performed using the anti-FabRICATOR antibody A3-AF1-010 (Genovis) and a nickel affinity column (GE Healthcare), respectively.
  • Endotoxin removal was performed using poly( -lysine) resin spin columns (Thermo Scientific, Waltham, MA) and residual endotoxin concentration was assessed by LAL test with Endosafe Cartridge Technology (Charles River Laboratories), according to manufacturer’s instructions.
  • IdeS endopeptidase was diluted in the injectable solution buffer, composed of 50 mM sodium phosphate, 150 mM NaCl, 0.25% human albumin, pH 6.6.
  • the 2V6.11 cells (ATCC CRL-2784) were maintained under 37 °C, 5% C02 condition in Dulbecco’s modified Eagle’s Medium (DMEM) supplemented with 10% FBS, 2mM GlutaMAX (Invitrogen Life Technology, Carlsbad, CA) and have been used for the AAV neutralization assay.
  • DMEM Dulbecco’s modified Eagle’s Medium
  • Serum from AAV8 seropositive human (NAb titer: 1 :31.6) and monkey (NAb titer: 1 : 100) or IVIg (NAb titer: 1 :316) was diluted in PBS to 4-4.5 mg/mL IgG. Fifty microliters of diluted IgG (200 pg) was incubated with IdeS (100 IU, 50 IU/pL) or PBS for 22 hr at 37 °C. Anti- AAV8 IgG were measured by ELISA and in a neutralization assay. In the case of monkey IgG, an antibody specific for gamma chain of monkey IgG conjugated with horseradish peroxidase (HRP) (Fitzgerald, Acton, MA ETSA) was used.
  • HRP horseradish peroxidase
  • ELISA plates were coated with a goat anti -human kappa antibody (2.5 pg/mL in PBS) and blocked with PBS-l% bovine serum albumin (BSA). IgG samples were incubated in 1/10 dilutions, using a commercial IVIg preparation as a standard. Intact IgG were then revealed using a secondary HRP-conjugated mouse anti-human IgG-Fc antibody and the o-phenylenediamine dihydrochloride (OPD) substrate.
  • BSA bovine serum albumin
  • AAV antibody assay was performed as previously described (Mingozzi el al. (2013) Sci Transl Med. 5, l94ra92). Briefly, recombinant AAV empty capsids were diluted in coating buffer (35 mM bicarbonate, 13 mM carbonate, pH> 9.2) to a final concentration of 2x10 10 vector particles per mL. Fifty microliters were added to each well in a 96-well Nunc Maxisorp Immunoplate (Thermofisher, Waltham, USA). A standard curve made from purified human IgG (Tegeline, LFB, France) was added directly to the plates. Plates were coated overnight at 4 °C.
  • the NAb assay was performed as previously described (Meliani et al. (2015) Hum Gene Ther Methods. 26, 45-53). Briefly, on day 1 , 96-well plates were seeded with 2xl0 4 of 2V6.1 1 cells/well for 24 hr in the presence of ponasterone A (Life Technologies, Carlsbad, USA). Recombinant AAV8-CMV-Luciferase was diluted in serum-free DMEM (Life Technologies, Carlsbad, USA) and incubated with semi-log-fold serial dilutions of the serum samples, and then incubated for 1 hr at 37 °C. Subsequently, the serum- vector mixtures were added in the cells.
  • mice Male C57BL/6 mice aged 6-8 weeks or male and female factor IX (FlX)-deficient Hemophilia B (HB) mice were used. In all experiments, animals were passively immunized by intravenous injection with 9 mg of IVIg (PRIVIGEN, CSL Behring, ETS-PA) in a final volume of 100 pL. After 30 minutes, mice received 250 Eft, 500 Eft or 1250 Eft of IdeS (Pro mega, Madison, ETS-WI) by retro-orbital injection.
  • IVIg PRIVIGEN, CSL Behring, ETS-PA
  • mice were injected with an AAV8 vector at the dose of lxlO 12 vg/kg (2x10 10 vg/mouse) by tail vein route.
  • Blood samples D-7, D+7, D+14 and D+28
  • D-7, D+7, D+14 and D+28 were collected from the retro-orbital plexus in heparin coated capillary tubes (Sarstedt, Numbrecht, Germany) or from mandibular way for samples D-l+l5mn and DO.
  • whole livers were collected and snap-frozen for subsequent vector genome copy number assessment.
  • AAV8 seropositive monkeys were infused with 5xl0 12 vg/kg of AAV8-hFIX vector (DO).
  • DO AAV8-hFIX vector
  • one monkey received a single injection of IdeS (500 pg/kg) at day D-l .
  • both monkeys received double injections of IdeS (500 pg/kg) at days D80 and D81 , and 5x10 12 vg/kg of AAV8-hFIX vector at D82.
  • Blood samples were collected at different time points during the experiment.
  • At euthanasia (D105) liver biopsies were collected from 4 lobes for a VGCN assessment.
  • Monkey IgG levels were measured by sandwich enzyme linked immunoassay (ELISA). Briefly, we used a goat anti-human IgG F(ab')2 (Thermo Scientific) and a goat anti-monkey IgG- HRP (Fitzgerald) as capture and detection antibodies, respectively. OPD Peroxidase Substrate System (SIGMAFASTTM-OPD, Sigma) was used for revelation.
  • ELISA sandwich enzyme linked immunoassay
  • FIX protein levels in mouse plasma were measured following manufacturer’s instructions.
  • the capture and secondary HRP-antibodies for the ELISA assay were purchased from Affinity Biological (Ancaster, Canada).
  • an anti-hFIX antibody MAI-43012, Thermo Fisher Scientific, Waltham, MA
  • an anti-hFIX-HRP antibody CL20040APHP, Tebu-bio, France
  • the hFIX antigen levels were determined by adding SIGMAFASTTM OPD substrate (Sigma-Aldrich) following the manufacturer’s instructions and measuring OD at an absorbance of 492 nm.
  • VCN Vector genome copy number
  • Liver vector genome copy number was determined using a qPCR assay with primers and probes specific for the liver promoter and the mouse Titin or eGlobin genes.
  • the promoter-specific primers and the probe were synthesized by Thermo Scientific (Waltham, MA, USA).
  • Mouse Titin and eGlobin were used as a normalizing gene in mice and NHP studies, respectively, synthesized by Thermo Scientific (Waltham, MA, USA)).
  • DNA from tissues was extracted after whole-organ (mouse) or biopsies (NHP) homogenization using FastPrep machine (MP Biomedicals) and Gentra Puregen Blood Kit (Qiagen, ref 158467). Each sample was tested in triplicate and genome copy number per diploid genome was determined against a standard curve made of linearized plasmid.
  • Gaussia luciferase activity was measured on a lumino meter (ENSPIRETM, Perkin Elmer, Waltham, ETSA). The measurement was done over 1 second after automatic injection of 50 pL of substrate solution (Coelenterazine, Sigma Aldrich). Signal background was subtracted from each value. The Gaussia luciferase activity is expressed as RLU/sec and the values are the means +/- SD of duplicates from repeated assays.
  • IVIg contained substantial levels of functionally relevant anti-AAV8 IgG, as detected both by ELISA ( Figure 3A, 2.56 ⁇ 0.2l pg/mL and 2.83 ⁇ 0.22 pg/mL, means ⁇ SD, for Groups 1 and 2, respectively) and by neutralization assays ( Figure 3B, 1 :22.6 [range: 1 : 10 to 31.6] titer and 1 : 19 [range: 1 : 10 to 31.6], respectively).
  • the injection of IdeS resulted in a drastic decrease in circulating levels of anti-AAV8 IgG.
  • IdeS hydrolyses IgG from different species including non-human primates.
  • AAV8-seropositive human and non-human primate (NHP, monkey) serum samples hydrolyses neutralizing anti-AAV8 IgG.
  • HIP non-human primate
  • IdeS indeed hydrolyzed anti-AAV8 IgG in both the human serum and the monkey serum, with a 15-fold reduction in anti-AAV8 IgG levels in the monkey serum over 22 hr of incubation (0.42 ⁇ 0.0l pg/mL and 6.29 ⁇ 0.l0 pg/mL upon treatment with IdeS or PBS, respectively).
  • the anti-AAV8 NAb titer was also reduced in the human serum incubated with IdeS (Figure 5B). No reduction in anti-AAV8 NAb titer was observed upon incubation of monkey serum with IdeS, but there was a decrease of the neutralizing capacity of these antibodies from 76% to 64% after IdeS incubation ( Figure 5B). The lack of reduced anti-AAV NAb titer may be due to the fact that functional F(ab’)2 fragments of high affinity monkey anti-AAV8 IgG remaining in the incubation mixture.
  • Anti-AAV2 and anti-AAV9 IgG and NAbs were measured in serum prepared from blood collected after the reconstitution of wild-type mice with 9 mg human IgG (D-l+l5min) and after the injection of IdeS (250 IU or 500 IU, for AAV2 or AAV9 respectively) or PBS (DO) ( Figure 2).
  • IVIg contained substantial levels of functionally relevant anti-AAV2 and anti-AAV9 IgG, as detected both in ELISA ( Figure 3C, anti-AAV2 IgG 9.05 ⁇ l .20 mg/mL and 8.92 ⁇ 0.63 mg/mL, means ⁇ SD; Figure 3E, anti-AAV9 IgG 5.5 l ⁇ 0.492 mg/mL and 5.l45 ⁇ 0.69l mg/mL, for Groups 1 and 2, respectively) and in a neutralization assay (Figure 3D, 1 :886 and 1 :772 [range: 1 :316 to 1000] anti-AAV2 NAb titer; Figure 3F, 1 : 15.4 and 1 :24.4 [range: 1 : 10 to 31.6] anti-AAV9 NAb titer, for Groups 1 and 2 respectively).
  • the injection of IdeS resulted in a drastic decrease in circulating levels of anti-AAV2 and AAV9 IgG.
  • the decrease in anti-AAV2 IgG was 6 fold (1.51 ⁇ 0.31 pg/mL and 4.58 ⁇ 0.45 pg/mL, for Groups 1 and 2, respectively) and in anti-AAV2 NAb was 28 fold, after 24 hr.
  • the decrease in anti-AAV9 IgG was 36 fold (0.153 ⁇ 0.074 pg/mL and 2.92 ⁇ 0.50 pg/mL, for Groups 1 and 2, respectively) and in anti-AAV9 NAb was 20 fold, after 24 hr.
  • the reduced levels of anti-AAV2 and AAV9 IgG over time in the PBS-treated mice represents the natural elimination of the human IgG in mice.
  • HB mice Factor IX-deficient hemophilia B mice, reconstituted with IVIg or PBS, were treated with IdeS (1250 Ul/mouse) or PBS, injected with hFIX-encoding AAV8 vectors, and the hFIX plasma levels were measured after 7 and 14 days.
  • Non-reconstituted HB mice that lack anti- AAV8 IgG demonstrated production and accumulation of hFIX in the blood over 2 weeks ( Figure 6A).
  • mice reconstituted with human IgG that contain anti-AAV8 neutralizing IgG failed to produce hFIX ( Figure 6A).
  • mice treated with IdeS recovered complete efficiency of gene therapy and achieved circulating hFIX levels identical to those observed in the case of control non-reconstituted mice ( Figure 6A).
  • the levels of endogenously produced hFIX that were achieved following combined IdeS/AAV8 treatment protected mice from acute hemorrhage in a tail clipping assay. Indeed, the volume of blood loss was not statistically significant from that of non-immunized mice treated with AAV8 and of wild- type C57BL/6 mice (dotted line). In contrast, passively immunized mice that did not receive IdeS lost significantly more blood than the mice in the other groups.
  • Anti-AAV8 IgG levels in the treated monkey were 2.7-fold reduced after the second injection of IdeS (from 2.86 to 1.05 pg/mL) as measured by ELISA ( Figure 8B).
  • the anti-AAV8 NAb titer was reduced by 3 folds (titer from 17.2 to 5.4) as measured in a neutralization assay ( Figure 8C).
  • NHP2 and the control monkey (NHP1) that was not treated with IdeS received hFIX- encoding AAV8 (2xl0 12 vg/kg) and the levels of hFIX in plasma were measured over time for 50 days.
  • the monkey having received IdeS treatment (NHP2) had significantly higher hFIX expression levels over time and until sacrifice ( Figure 9A). This result is consistent with the assessment of liver VGCN. Indeed, the treated monkey (NHP2) showed more efficient liver transduction than the control non-treated monkey (NHP1) ( Figure 9B, 10.1 ⁇ 1.6 vs. 1 6 ⁇ 0.2).
  • NHP3 failed to produce endogenous hFIX, which was associated with elevated levels of neutralizing anti-AAV8 IgG, poor liver transduction efficiency, as well as development of anti- hFIX antibodies (data not shown).
  • NHP4 experienced increased production of hFIX following a second treatment with IdeS/AAV8, which was consistent with the low lewels of anti- AAV8 IgG and NAb.
  • hFIX levels were more stable after vector re-administration than after the first injection of the vector.
  • the data show that IdeS treatment is effective to reduce neutralizing antibodies that inhibit gene therapy in the context of hemophilia B with an AAV8 vector encoding factor IX (see Examples 1 , 4 and 5).
  • the data support use of IdeS treatment for gene therapy to other AAV serotypes (see Example 2).
  • Anti-AAV Capsid Neutralizing Antibody (NAb) Titer Neutralizing antibodies to AAV- Spkl or AAV-Spk2 capsid were quantified using a cell-based, in vitro assay and either an AAV- Spkl or AAV-Spk2, respectively, reporter-vector encapsidating a Renilla luciferase transgene.
  • early passage passage less than #26
  • 293E4 cells were thawed and plated in a flat-bottom white 96-well plate at 2x10 4 cells/200 pF/well.
  • Ponasterone A Invitrogen; cat.
  • # H101-01 was added to a final concentration of 1 pg/mL to each well in order to induce expression of the helper virus protein, human adenovirus E4.
  • Cells were then cultured overnight in a 37 °C/5% CO2 incubator. The following day, samples were heat-inactivated at 56 °C for 30 min, then a 4-point dilution (from 1 : 1 to 1 :5) was prepared using FBS as the diluent.
  • Factor Assay Control Plasma (FACT; King George Bio-Medical, Inc.) was prepared in a 3.16-fold (half-log) serial dilution to assess assay performance.
  • AAV-luciferase vector was diluted to 7.5x10 7 vg/mL in DMEM and then added to FACT controls and samples. Vector and controls/samples were incubated at 37 °C for 60 min. Volumes 7.5 pF per well of the“neutralized” controls/samples were transferred to each well of the plate seeded with cells, and the cells were returned to the incubator for overnight incubation. The next day cells were washed once in PBS, lysed in Renilla Assay Fysis Buffer, and luciferase activity was measured with the Renilla Fuciferase Assay System (Promega) and read on a SpectraMax F microplate reader.
  • IVIg intravenous immune globulin
  • IP intraperitoneally
  • IVIg was treated with 125 units of IdeZ (Promega) overnight at 37 °C prior to IP dosing. Cleavage of total IgG was assessed by SDS-PAGE and Coomassie stain.
  • vector AAV- Spkl-GAA
  • mouse plasma samples were collected weekly, and samples were analyzed for activity of the transgene (GAA enzyme).
  • GAA Activity Assay GAA activity was assessed by measurement of cleavage of the substrate 4-methyl-umbelliferyl-a-D-glucoside at pH 4 (Galjaard el al., Clin Chim Acta 1973; 49(3):36l-75). Briefly, the reaction was initiated by addition of 20 pL of substrate to 10 pL plasma sample diluted 1 :250 in MilliQ water. The reaction mixture was incubated at 37 °C for 1 hr and then subsequently stopped by carbonate buffer at pH 10.5. The standard curve was plated thereafter with 4-methylumbelliferone, the blue fluorescent dye liberated from 4-methyl-umbelliferyl-a-D- glucoside, which produces a fluorescent emission at 440 nm when excited at 370 nm.
  • Anti- AAV Capsid IgG antibodies Anti-AAV capsid total IgG formation was measured with a capture assay. ELISA plate wells were coated with 50 pL of a solution containing 1 pg/mL of AAV-Spkl capsid particles. Total human IgG (Southern Biotech, 0150-01) was diluted to generate a 10-point standard curve ranging from 10,000 ng/mL to 0.5 ng/mL and added to the plate. The limit of quantitation of the assay was 460 ng/mL after back-calculation. Three levels of quality control samples were prepared and included on each plate to assess assay performance.
  • HRP horseradish peroxidase
  • IdeS cleaves IgG from human, NHP and hamster samples in vitro
  • the immunoglobulin G (IgG)-degrading enzyme from Streptococcus pyogenes is a cysteine protease that cleaves all four human subclasses of IgG with high specificity. IdeS hydrolyzes human IgG at Gly236 in the lower hinge region of the IgG heavy chains.
  • IdeS is a highly efficient and specific protease of human IgG, rhesus IgG and hamster IgG.
  • Cleavage of IgG by IdeS results in a reduced NAb titer in vitro
  • AAV vector transduction efficiency was assayed in vitro.
  • serum or plasma samples from various species can be assessed for the presence of neutralizing antibodies to the AAV capsid by pre-incubating AAV vectors encoding Renilla luciferase with plasma or sera, transducing human cells in culture with these mixtures, and subsequently assessing levels of luciferase activity.
  • Anti-Spk2 NAb titer analysis following treatment with IdeS endopeptidase Human patient samples (designated by Spark ID) were pretreated with and without IdeS. NAb titers were later assessed by in vitro vector transduction assay.
  • IgG antibodies The effector functions of IgG antibodies, such as cytotoxicity and complement fixation, are mediated by the Fc portion. eutralization relies on the variable regions of the heavy and light chains for specificity to antigen. While the F(ab’)2 fragment still contains intact antigen-binding regions, data suggest that liberation of the F(ab’)2 fragment by IdeS or IdeZ, a similar endopeptidase in Streptococcus equi, which has improved activity against mouse IgG2a and IgG3, causes reduced stability without the Fc portion and therefore quicker clearance of the F(ab’)2 fragment from circulation than intact IgG. This assay tested whether administration of neutralizing antibodies that were pre-cleaved by IdeS or IdeZ should result in a reduction of neutralizing activity to AAV in the in vivo setting.
  • mice were immunized with IVIg, a pool of human IgGs that includes anti-AAV capsid neutralizing antibodies that were pretreated with or without 0.1 mg/kg IdeZ. Mice were then administered 2xl0 12 vg/kg AAV-Spkl-GAA. Mice treated with 1.0 mg or 5.0 mg IVIg resulted in reduced GAA activity levels in plasma (10,951 ⁇ 1 ,554 nmol/hr/mL and 1 ,041 ⁇ 553 nmol/hr/mL respectively) compared with control mice (33,551 ⁇ 13,635 nmol/hr/mL) showing that vector neutralization by IVIg is dose dependent (Figure 15).
  • IVIg Pretreatment of 40 mg/kg IVIg with IdeZ rescued transduction efficiency, resulting in GAA activity levels (37,707 ⁇ 11,449 nmol/hr/mL) that were comparable to control.
  • IdeZ pretreatment of 200 mg/kg IVIg partially alleviated vector neutralization (13,440 nmol/hr/mL ⁇ 15,543) with one animal completely recovering activity (41,025 nmol/hr/mL).
  • IdeZ itself did not interfere with AAV vector transduction efficiency.
  • IVIg dose retains were analyzed by SDS-PAGE with Coomassie stain to confirm cleavage of IgG.
  • mice were first infused with intact IVIg to create an artificial titer of human anti-capsid neutralizing IgGs. After 24 hours, mice were infused with IdeS at two concentrations (0.4 mg/kg or 4 mg/kg), and then 24 hours after IdeS infusion, all mice were administered 2x10 12 vg/kg AAV-Spkl-GAA. Both anti-Spkl NAb titers and IgG levels were analyzed pre-IdeS infusion and post-IdeS infusion (immediately prior to vector administration).
  • IdeS infusion induced a dose-dependent decrease in both NAb (Figure 16) and IgG levels ( Figure 17).
  • the highest dose of IdeS (4 mg/kg) was capable of reducing NAb titers of at least 1 :40 down to ⁇ 1 : 1.
  • IdeS displayed a dose-dependent rescue of transgene activity levels; 0.4 mg/kg IdeS resulted in a 70% rescue of GAA activity (34,408 ⁇ 10,562 nmoFhr/mL), while 4 mg/kg IdeS rescued 99% GAA activity (48,948 ⁇ 5,322 nmoFhr/mL).
  • IdeS was evaluated for ability to cleave higher titers of anti-capsid IgG in vivo and to rescue AAV transduction in the context of a higher degree of AAV vector neutralization.
  • Mice male C57BL/6 were infused with varying doses of intact human IVIg (300 mg/kg (low), 800 mg/kg (mid), or 1600 mg/kg (high)) to create an artificial titer of human anti-capsid neutralizing IgGs. After 24 hours, mice were infused with IdeS at three concentrations (0.4 mg/kg (low), 1 mg/kg (mid), or 2 mg/kg (high)).
  • mice 24 hours after IdeS infusion, mice were administered AAV- Spkl-GAA at 2x10 12 vg/kg.
  • Anti- Spkl NAb titers were determined at both pre-IdeS infusion and post-IdeS infusion (immediately prior to vector administration), using the Anti-AAV Capsid NAb Titer assay described in Example 1.
  • AAV transduction was assessed by measurement of transgene product (GAA) activity in plasma using the GAA Activity Assay, as described in Example 1 , two weeks post vector administration.
  • GAA transgene product
  • AAV NAb titer For all doses of IVIg, pre-treatment with IdeS yielded a dose-dependent decrease in AAV NAb titer (Table 2).
  • Table 2 presents the neutralizing anti-Spkl antibody (NAb) titer pre- and post-IdeS infusion for each animal in each group.
  • AAV NAb titers are designated as low ( ⁇ 1 : 1, 1 : 1-1 :2.5), low-to-mid range (1 :2.5-1 :5), mid-to-high range (1 :5-1 : 10) and high (>1 : 10-1 :20).
  • IdeS pre -treatment resulted in a dose-dependent rescue of AAV vector transduction, as measured by GAA activity levels in plasma: 0.4 mg/kg IdeS resulted in GAA activity levels of 7,702 ⁇ 4,710 nmol/hr/mL, 1 mg/kg IdeS resulted in GAA activity levels of 15,444 ⁇ 4,226 nmol/hr/mL, and 2 mg/kg IdeS resulted in GAA activity levels of 14,375 ⁇ 2,572 nmol/hr/mL.
  • IVIg With 1600 mg/kg IVIg, 0.4 mg/kg IdeS resulted in GAA activity levels of 580 ⁇ 217 nmol/hr/mL, 1 mg/kg IdeS resulted in GAA activity levels of 12,511 ⁇ 1,602 nmol/hr/mL and 2 mg/kg IdeS resulted in GAA activity levels of 11 ,573 ⁇ 1,313 nmol/hr/mL. At the highest dose of IVIg (1600 mg/kg), the lowest IdeS dose (0.4 mg/kg) failed to rescue vector transduction.
  • IdeS treatment in vivo reduces neutralizing antibody titers and allows for dosing and transduction of viral vectors in animals that are refractory to viral vector gene therapy treatment methods.
  • Hamsters are infused with rAAV vector particles carrying a transgene of interest, are dosed with IdeS after the development of anti-AAV NAb (e.g., 4 weeks), and infused with additional rAAV particles carrying another transgene.
  • This model allows for analysis of transduction efficacy at varying stages, including before and after IdeS treatment and before and after redosing with rAAV.
  • mice are monitored for expression of the transgene product (i.e., FVIII, FIX, etc.) in plasma, in addition to measurement of the development of NAbs to the Spkl capsid by anti-Spkl IgG ELISA or a cell-based neutralizing antibody assay.
  • the transgene product i.e., FVIII, FIX, etc.
  • animals are infused by intravenous, subcutaneous, intraperitoneal or other route of administration with single or multiple ascending doses of IdeS of 0, 0.5, 1 , and 2 mg/kg (and higher doses).
  • animals are followed by measuring anti-Spkl capsid IgG and/or NAbs to Spkl .
  • mice are dosed with 2x10 12 vg/kg Spkl -FIX, or other Spkl encapsidated vector. Animals are monitored for expression of the transgene product (i.e., FIX or other) in plasma, in addition to measurement of the development of NAbs to the Spkl capsid by anti-Spkl IgG ELISA or a cell-based NAb assay.
  • transgene product i.e., FIX or other
  • mice are infused by intravenous, subcutaneous, intraperitoneal or other route of administration with single or multiple ascending doses of IdeS of 0, 0.5, 1 , and 2 mg/kg, and higher doses.
  • IdeS administration animals are followed by measuring anti-Spkl capsid IgG and/or NAbs to Spkl .
  • animals display a sufficient decrease in NAb levels, they are infused with 2x10 12 vg/kg Spkl-GAA.
  • GAA expression is measured in plasma by GAA activity assay and/or GAA antigen level assessment to determine the level of transduction attained.
  • a separate arm of the study evaluates the ability of IdeS to overcome pre-existing NAb titers.
  • Animals displaying different NAb titer levels are grouped based on titer and infused by intravenous, subcutaneous, intraperitoneal or other route of administration with single or multiple ascending doses of IdeS of 0, 0.5, 1, and 2 mg/kg (and higher doses).
  • animals are followed by measuring anti-Spkl capsid IgG and/or NAbs to Spkl and, when animals display a sufficient decrease in NAb levels, they are infused with 2xl0 12 vg/kg Spkl-GAA.
  • GAA expression is measured in plasma by GAA activity assay and/or GAA antigen level measurement to determine the level of transduction attained.
  • IdeS Two different preparations of IdeS (Lot 1 and Lot 2) were tested in mice having an artificial titer of human anti-capsid neutralizing IgGs.
  • C57BL/6 mice were injected with 300 mg/kg of IVIg at Day -2, followed by 1 mg/kg IdeS at Day -1 (pre-dosing with AAV), and finally with 5x10 10 vector genomes of an AAV-Spkl vector encoding a human Factor VIII (AAV-Spkl- hFVIII) at Day 0 (post-dose).
  • Negative control animals received no IVIg or IdeS treatment, and the“No IdeS” group received only IVIg and AAV-Spkl-hFVIII vector.
  • Neutralizing antibody titers in plasma were determined pre- and post-IdeS administration, using an anti- AAV capsid neutralizing assay similar to that described in Example 7, using an 8-point titer (1 : 1 to 1 : 160) on the samples, and luminescence was read on a GloMax ® Discover Microplate Reader (Promega). Titer was determined as the highest dilution or range where luminescence was inhibited by > 50%.
  • NAb titers pre- and post-IdeS treatment shows that both lots of IdeS were effective in decreasing the NAb titer in the mice (Fig. 20).
  • Human FVIII antigen levels were measured by ELISA pre -vector infusion and at one and two weeks post vector infusion (Fig. 21). Both lots of IdeS treatment in vivo reduced neutralizing antibody titers and to allow for dosing with an AAV vector and expression of the transgene.
  • C57BL/6 mice were given IVIg to induce an artificial titer of human anti-capsid neutralizing IgG.
  • Three concentrations of IVIg 300 mg/kg (low), 800 mg/kg (mid), and 1600 mg/kg (high) were used, and within each IVIg group, animals were treated with increasing doses of IdeS (0, 0.4, 1.0, 2.0 mg/kg).
  • Anti-Spkl capsid IgG levels were assessed by ELISA. Briefly, 96-well plates were coated with Spkl empty capsid, then blocked with BSA, washed, and incubated with plasma, diluted 1 : 100, for 2 hours.
  • Luminescence was compared to a standard curve of human IgG to determine antibody concentrations. All three concentrations of IdeS (0.4, 1.0, 2.0 mg/kg) eliminated or significantly reduced serum levels of anti-Spkl capsid IgG for all three concentrations (low, mid and high) of IVIg (Fig. 22).
  • SEQ ID NOs:5 to 18 are the sequences of exemplary IdeS polypeptides from Table C of WO 2016/128558.
  • SEQ ID NO:8 DSFSANQEIRYSEVTPYHVTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFN
  • SEQ ID NO: 12 DSFSANQEIRYSEVTPYHVTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFN
  • IgdE of S. agalactiae is specific for human IgGl (WO2017134274) (SEQ ID NO: l9,):
  • IgdE of S. pseudoporcinus degrades both human IgGl and porcine IgG
  • IdeZ The full sequence of IdeZ is available as NCBI Reference Sequence No. WP 014622780.1 (SEQ ID NO:2l). This sequence includes an N-terminal methionine followed by a 33 amino acid secretion signal sequence. The N terminal methionine and the signal sequence (a total of 34 amino acids at the N terminus) are typically removed to form the mature IdeZ protein: MKTIAYPNKPHSLS AGLLT AIAIF SLAS SNITYADDYQR ATE AYAKEVPHQITS VWTKG VTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKAFDGKDNLLCGAATAGNMLHWWFDQ NKTEIEAYLSKHPEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQL GVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARH DLKNKGLNDISTIIKQELTEGRAL
  • SEQ ID NOs:24-43 correspond to peptides with modifications relative to IdeZ of SEQ ID NO:22.
  • SEQ ID NO:39 DDYQRNATEAYAKEVPHQITSVWTKGVTPLTPEQFTQGEDVFHAPYVANQGWYDITKA
  • SEQ ID NO:43 DDYQRNATEAYAKEVPHQITSVWTKGVTPPEQFTQGEDVIHAPYVANQGWYDITKAFD
  • SEQ ID NOs: 49-51 are amino acid sequences of signal sequences that can be fused at the N-terminus of any of the proteases or glycosidases disclosed herein.
  • references to“a”,“and,” and“the” include plural referents unless the context clearly indicates otherwise.
  • reference to“a nucleic acid” includes a plurality of such nucleic acids
  • reference to“a vector” includes a plurality of such vectors
  • reference to“a virus” or“particle” includes a plurality of such viruses/particles.
  • the term“about” as used herein refers to a value within 10% of the underlying parameter (i.e., plus or minus 10%). For example,“about 1 : 10” means 1.1 : 10.1 or 0.9:9.9, and about 5 hours means 4.5 hours or 5.5 hours, etc.
  • the term“about” at the beginning of a string of values modifies each of the values by 10%.
  • a dosage of about“0.01 mg/kg to about 10 mg/kg” body weight of a subject includes 0.011 mg/kg, 0.012 mg/kg, 0.013 mg/kg, 0.014 mg/kg, 0.015 mg/kg etc., as well as 9.5 mg/kg, 9.6 mg/kg, 9.7 mg/kg, 9.8 mg/kg, 9.9 mg/kg etc., and so forth.
  • Reference to an integer with more (greater) or less than includes any number greater or less than the reference number, respectively.
  • reference to more than 2 includes 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, etc., and so forth.
  • administration of a recombinant viral vector, protease and/or glycosidase“two or more” times includes 3, 4, 5, 6, 7,
  • “1 to 90” includes 1.1, 1.2, 1.3, 1.4, 1.5, etc., as well as 81, 82, 83, 84, 85, etc., and so forth.
  • “between about 1 minute to about 90 days” includes 1.1 minutes, 1.2 minutes, 1.3 minutes, 1.4 minutes, 1.5 minutes, etc., as well as one day, 2 days, 3 days, 4 days, 5 days .... 81 days, 82 days, 83 days, 84 days, 85 days, etc., and so forth.
  • the instant invention is generally disclosed herein using affirmative language to describe the numerous embodiments of the instant invention.
  • the instant invention also specifically includes embodiments in which particular subject matter is excluded, in full or in part, such as substances or materials, method steps and conditions, protocols, or procedures.
  • materials and/or method steps are excluded.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Hematology (AREA)
  • Virology (AREA)
  • Urology & Nephrology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Mycology (AREA)
PCT/EP2019/069280 2017-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins Ceased WO2020016318A1 (en)

Priority Applications (31)

Application Number Priority Date Filing Date Title
US17/050,911 US20210228738A1 (en) 2017-07-17 2017-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
AU2019306121A AU2019306121B2 (en) 2018-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
FIEP19740384.3T FI3768304T3 (fi) 2018-07-17 2019-07-17 Koostumuksia ja menetelmiä geeniterapiavektoreiden transduktion lisäämiseksi tai tehostamiseksi ja immunoglobuliinien poistamiseksi tai vähentämiseksi
MX2021000580A MX2021000580A (es) 2018-07-17 2019-07-17 Composiciones y metodos para aumentar o mejorar la transduccion de vectores de terapia genetica y para eliminar o reducir las inmunoglobulinas.
CN201980048115.9A CN112689515A (zh) 2018-07-17 2019-07-17 用于增加或增强基因治疗载体的转化以及用于去除或减少免疫球蛋白的组合物和方法
DK19740384.3T DK3768304T3 (da) 2018-07-17 2019-07-17 Sammensætninger og fremgangsmåder til forøgelse eller forbedring af transduktion af genterapivektorer og til fjernelse eller reduktion af immunoglobuliner
PL19740384.3T PL3768304T3 (pl) 2018-07-17 2019-07-17 Kompozycje i sposoby zwiększania lub wzmacniania transdukcji wektorów terapii genowej oraz usuwania lub redukcji immunoglobulin
SG11202100306VA SG11202100306VA (en) 2018-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
KR1020217001502A KR20210042308A (ko) 2018-07-17 2019-07-17 유전자 치료요법 벡터의 형질도입을 증가시키거나 증진시키고 면역글로불린을 제거하거나 감소시키기 위한 조성물 및 방법
BR112021000807A BR112021000807A8 (pt) 2018-07-17 2019-07-17 Usos de um polipeptídeo da enzima de degradação de imunoglobulina g, uso de uma sequência de ácido nucleico, uso de um vetor de expressão, embalagem ou kit e uso de uma embalagem ou kit
JP2021502435A JP2021529821A (ja) 2018-07-17 2019-07-17 イムノグロブリンを除去又は減少させるための遺伝子治療ベクターの形質導入を増加または増強するための組成物および方法
PE2021000066A PE20211859A1 (es) 2018-07-17 2019-07-17 Composiciones y metodos para aumentar o mejorar la transduccion de vectores de terapia genetica y para eliminar o reducir las inmunoglobulinas
EP19740384.3A EP3768304B1 (en) 2018-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
CA3106368A CA3106368A1 (en) 2018-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
CN202411396316.7A CN119345338A (zh) 2018-07-17 2019-07-17 用于增加或增强基因治疗载体的转化以及用于去除或减少免疫球蛋白的组合物和方法
EP22198839.7A EP4154904A1 (en) 2018-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
SI201930426T SI3768304T1 (sl) 2018-07-17 2019-07-17 Sestavki in postopki za povečanje ali stopnjevanje transdukcije vektorjev za gensko terapijo in za odstranjevanje ali zmanjšanje imunoglobulinov
UAA202100146A UA130604C2 (uk) 2018-07-17 2019-07-17 Спосіб підвищення або посилення трансдукції вектора для генної терапії й видалення або зниження імуноглобулінів
LTEPPCT/EP2019/069280T LT3768304T (lt) 2018-07-17 2019-07-17 Kompozicijos ir būdai, skirti padidinti arba sustiprinti genų terapijos vektorių transdukciją ir pašalinti imunoglobulinus arba sumažinti jų kiekį
RS20221191A RS63878B1 (sr) 2018-07-17 2019-07-17 Kompozicije i postupci za povećanje ili pojačanje transdukcije vektora genske terapije i za uklanjanje ili smanjenje imunoglobulina
HRP20221542TT HRP20221542T1 (hr) 2018-07-17 2019-07-17 Pripravci i postupci za povećanje ili pojačanje transdukcije vektora genske terapije i za uklanjanje ili smanjenje imunoglobulina
ES19740384T ES2935970T3 (es) 2018-07-17 2019-07-17 Composiciones y procedimientos para aumentar o potenciar la transducción de vectores de terapia génica y para eliminar o reducir inmunoglobulinas
SM20230005T SMT202300005T1 (it) 2018-07-17 2019-07-17 Composizioni e metodi per aumentare o potenziare la trasduzione dei vettori di terapia genica e per rimuovere o ridurre le immunoglobuline
IL280099A IL280099A (en) 2018-07-17 2021-01-11 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
ZA2021/00202A ZA202100202B (en) 2018-07-17 2021-01-12 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
CONC2021/0000326A CO2021000326A2 (es) 2018-07-17 2021-01-15 Composiciones y métodos para aumentar o mejorar la transducción de vectores de terapia genética y para eliminar o reducir las inmunoglobulinas
PH12021550115A PH12021550115A1 (en) 2018-07-17 2021-01-15 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
US17/224,367 US20210246469A1 (en) 2018-07-17 2021-04-07 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
US17/862,622 US20230142731A1 (en) 2018-07-17 2022-07-12 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
JP2024051529A JP2024075765A (ja) 2018-07-17 2024-03-27 イムノグロブリンを除去又は減少させるための遺伝子治療ベクターの形質導入を増加または増強するための組成物および方法
AU2025217293A AU2025217293A1 (en) 2018-07-17 2025-08-13 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP18305971 2018-07-17
EP18305971.6 2018-07-17
US201862768731P 2018-11-16 2018-11-16
US62/768,731 2018-11-16

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17050911 A-371-Of-International 2020-10-27
US17/224,367 Continuation US20210246469A1 (en) 2018-07-17 2021-04-07 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins

Publications (1)

Publication Number Publication Date
WO2020016318A1 true WO2020016318A1 (en) 2020-01-23

Family

ID=67303476

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2019/069280 Ceased WO2020016318A1 (en) 2017-07-17 2019-07-17 Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins

Country Status (28)

Country Link
US (3) US20210228738A1 (https=)
EP (2) EP3768304B1 (https=)
JP (2) JP2021529821A (https=)
KR (1) KR20210042308A (https=)
CN (2) CN112689515A (https=)
AU (2) AU2019306121B2 (https=)
BR (1) BR112021000807A8 (https=)
CA (1) CA3106368A1 (https=)
CL (1) CL2021000112A1 (https=)
CO (1) CO2021000326A2 (https=)
DK (1) DK3768304T3 (https=)
ES (1) ES2935970T3 (https=)
FI (1) FI3768304T3 (https=)
HR (1) HRP20221542T1 (https=)
HU (1) HUE060720T2 (https=)
IL (1) IL280099A (https=)
LT (1) LT3768304T (https=)
MX (1) MX2021000580A (https=)
PE (1) PE20211859A1 (https=)
PH (1) PH12021550115A1 (https=)
PL (1) PL3768304T3 (https=)
RS (1) RS63878B1 (https=)
SG (1) SG11202100306VA (https=)
SI (1) SI3768304T1 (https=)
SM (1) SMT202300005T1 (https=)
UA (1) UA130604C2 (https=)
WO (1) WO2020016318A1 (https=)
ZA (1) ZA202100202B (https=)

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111621506A (zh) * 2020-05-09 2020-09-04 华中农业大学 牛支原体分泌蛋白MbovP0145及其应用
WO2021067598A1 (en) 2019-10-04 2021-04-08 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant aav
WO2021152314A1 (en) 2020-01-28 2021-08-05 Freeline Therapeutics Limited Improved assay for determining neutralising antibody titre to a viral vektor
WO2021163322A1 (en) 2020-02-14 2021-08-19 Ultragenyx Pharmaceutical Inc. Gene therapy for treating cdkl5 deficiency disorder
WO2021233911A1 (en) * 2020-05-19 2021-11-25 Hansa Biopharma AB Cysteine protease
WO2022005338A1 (ru) * 2020-07-03 2022-01-06 Максим Петрович НИКИТИН Способ лечения генотерапевтическим агентом
WO2022067080A1 (en) * 2020-09-28 2022-03-31 Scout Bio, Inc. Composition and uses thereof
WO2022076556A2 (en) 2020-10-07 2022-04-14 Asklepios Biopharmaceutical, Inc. Therapeutic adeno-associated virus delivery of fukutin related protein (fkrp) for treating dystroglycanopathy disorders including limb girdle 2i (lgmd2i)
JP2022523679A (ja) * 2019-01-28 2022-04-26 デューク ユニバーシティ 体液性免疫を回避する組成物および方法
WO2022192193A1 (en) * 2021-03-09 2022-09-15 The Board Of Regents Of The University Of Texas System Methods and compositions for mutagenesis screening in mammalian cells
CN115066261A (zh) * 2020-06-05 2022-09-16 上海宝济药业有限公司 一种酶和病毒的药物组合及其应用
EP3768304B1 (en) 2018-07-17 2022-10-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
WO2022221529A1 (en) 2021-04-16 2022-10-20 Asklepios Biopharmaceutical, Inc. Rational polyploid aav virions that cross the blood brain barrier and elicit reduced humoral response
US11524057B2 (en) * 2015-02-12 2022-12-13 Hansa Biopharma AB Cysteine protease
WO2023019168A1 (en) 2021-08-11 2023-02-16 Ultragenyx Pharmaceutical Inc. Compositions and methods for treating a muscular dystrophy
US11649273B2 (en) 2019-12-06 2023-05-16 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
JP2023532219A (ja) * 2020-06-18 2023-07-27 上海宝済薬業有限公司 免疫グロブリン分解酵素IdeEの突然変異体
US11905523B2 (en) 2019-10-17 2024-02-20 Ginkgo Bioworks, Inc. Adeno-associated viral vectors for treatment of Niemann-Pick Disease type-C
US11976096B2 (en) 2018-04-03 2024-05-07 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US11981914B2 (en) 2019-03-21 2024-05-14 Ginkgo Bioworks, Inc. Recombinant adeno-associated virus vectors
US12060390B2 (en) 2018-04-03 2024-08-13 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US12104163B2 (en) 2020-08-19 2024-10-01 Sarepta Therapeutics, Inc. Adeno-associated virus vectors for treatment of Rett syndrome
US12103960B2 (en) 2020-05-08 2024-10-01 Regeneron Pharmaceuticals, Inc. VEGF traps and mini-traps and methods for treating ocular disorders and cancer
US12116384B2 (en) 2018-04-03 2024-10-15 Ginkgo Bioworks, Inc. Virus vectors for targeting ophthalmic tissues
USRE50288E1 (en) 2008-09-15 2025-02-04 Uniqure Biopharma B.V. Factor IX polypeptide mutant, its uses and a method for its production
RU2840475C2 (ru) * 2021-05-03 2025-05-26 Ажероникс Са Альфа-1-антитрипсин (ААТ) в лечении и (или) профилактике неврологических нарушений
WO2025155923A1 (en) 2024-01-17 2025-07-24 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with the transferrin receptor
WO2025217174A1 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with carbonic anhydrase iv
WO2025217163A2 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Novel aav capsids binding to human cd59
WO2025256977A1 (en) 2024-06-13 2025-12-18 Bayer Aktiengesellschaft Novel igm and igg cleaving enzymes
WO2025256978A1 (en) 2024-06-13 2025-12-18 Bayer Aktiengesellschaft Variants of igm and igg cleaving enzymes
WO2026041758A1 (en) * 2024-08-22 2026-02-26 Genethon Modified aav capsid with enhanced transduction efficiency
WO2026074173A1 (en) 2024-10-04 2026-04-09 Hansa Biopharma AB Regimen for vector-based therapies
US12611436B2 (en) 2019-10-17 2026-04-28 Sarepta Therapeutics, Inc. AAV transfer cassette

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TW202005978A (zh) 2018-05-14 2020-02-01 美商拜奧馬林製藥公司 新穎肝靶向腺相關病毒載體
US20200165608A1 (en) * 2018-11-23 2020-05-28 Florida State University Research Foundation, Inc. Inhibition of vascular endothelial cell-mediated phagocytic processes for treatment of demyelinating conditions
CN114681472B (zh) * 2019-03-13 2023-06-30 中国人民解放军军事科学院军事医学研究院 氨基葡萄糖及其衍生物作为抗病毒药物的应用
TW202104592A (zh) * 2019-05-14 2021-02-01 美商拜奧馬林製藥公司 重複投予基因療法載體之方法
US20230265455A1 (en) * 2020-07-29 2023-08-24 University Of Florida Research Foundation, Incorporated Improved aav-mediated x-linked retinoschisis therapies
EP4304662A4 (en) * 2021-03-08 2025-06-18 The Regents of the University of California Lentivirus protection via fc overexpression
WO2023280175A1 (en) * 2021-07-06 2023-01-12 National Institute Of Biological Sciences, Beijing Methods for treating complex i deficiencies or cancers by modulating gro3p biosynthesis
EP4349365A1 (en) * 2022-10-07 2024-04-10 Hansa Biopharma AB Co-treatment for gene therapy
CN115558021B (zh) * 2022-12-01 2023-03-17 山东大学 一种转录因子、重组细胞及其在制备肿瘤治疗药物的应用
CN116425873B (zh) * 2023-06-02 2023-09-05 苏州百道医疗科技有限公司 一种抗ck6重组兔单克隆抗体及其应用
CN117126270B (zh) * 2023-10-25 2024-02-13 首都儿科研究所 一种2型人博卡病毒型别特异性抗体及其应用
CN118217443B (zh) * 2024-01-15 2026-04-03 国科温州研究院(温州生物材料与工程研究所) 一种人发角蛋白止血海绵及其制备方法与应用

Citations (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0367566A1 (en) 1988-10-31 1990-05-09 Immunex Corporation Interleukin-4 receptors
WO1991018982A1 (en) 1990-06-05 1991-12-12 Immunex Corporation Type ii interleukin-1 receptors
WO1992001070A1 (en) 1990-07-09 1992-01-23 The United States Of America, As Represented By The Secretary, U.S. Department Of Commerce High efficiency packaging of mutant adeno-associated virus using amber suppressions
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993003769A1 (en) 1991-08-20 1993-03-04 THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES Adenovirus mediated transfer of genes to the gastrointestinal tract
US5720720A (en) 1993-08-27 1998-02-24 The United States Of America As Represented By The Department Of Health And Human Services Convection-enhanced drug delivery
US5820873A (en) 1994-09-30 1998-10-13 The University Of British Columbia Polyethylene glycol modified ceramide lipids and liposome uses thereof
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US6043344A (en) 1995-07-19 2000-03-28 Genetics Institute, Inc. Human CTLA-8 and uses of CTLA-8-related proteins
US6569645B2 (en) 1999-05-14 2003-05-27 Genentech, Inc. IL-17 homologous polypeptides and therapeutic uses thereof
US6579520B2 (en) 1998-05-15 2003-06-17 Genentech, Inc. IL-17 related mammalian cytokine polypeptides (IL-17E)
US20100117125A1 (en) 2006-11-06 2010-05-13 International Business Machines Corporation Semiconductor structures incorporating multiple crystallographic planes and methods for fabrication thereof
US7745651B2 (en) 2004-06-07 2010-06-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods of use
US7803397B2 (en) 2003-09-15 2010-09-28 Protiva Biotherapeutics, Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
US20110177156A1 (en) 2007-11-14 2011-07-21 Szoka Jr Francis C Sterol-Modified Amphiphilic Lipids
US20120172411A1 (en) 2010-09-17 2012-07-05 Protiva Biotherapeutics, Inc. Novel trialkyl cationic lipids and methods of use thereof
US20130059732A1 (en) 2011-08-24 2013-03-07 The Board Of Trustees Of The Leland Stanford Junior University Aav capsid proteins for nucleic acid transfer
US20130064894A1 (en) 2011-08-31 2013-03-14 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
US20130116307A1 (en) 2010-05-12 2013-05-09 Protiva Biotherapeutics Inc. Novel cyclic cationic lipids and methods of use
US20130123338A1 (en) 2010-05-12 2013-05-16 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
WO2013158879A1 (en) 2012-04-18 2013-10-24 The Children's Hospital Of Philadelphia Composition and methods for highly efficient gene transfer using aav capsid variants
US8569256B2 (en) 2009-07-01 2013-10-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US8642076B2 (en) 2006-10-03 2014-02-04 Tekmira Pharmaceuticals Corporation Lipid containing formulations
US8722082B2 (en) 2008-11-10 2014-05-13 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US8889128B2 (en) 2006-12-13 2014-11-18 Hansa Medical Ab Use of the endoglycosidase endos for treating immunoglobulin G mediated diseases
WO2015013313A2 (en) 2013-07-22 2015-01-29 The Children's Hospital Of Philadelphia Variant aav and compositions, methods and uses for gene transfer to cells, organs and tissues
US8999351B2 (en) 2008-11-10 2015-04-07 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US9018187B2 (en) 2009-07-01 2015-04-28 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US9139554B2 (en) 2008-10-09 2015-09-22 Tekmira Pharmaceuticals Corporation Amino lipids and methods for the delivery of nucleic acids
WO2016012285A2 (en) 2014-07-25 2016-01-28 Hansa Medical Ab Method
US20160123990A1 (en) 2013-07-12 2016-05-05 The Children's Hospital Of Philadelphia Aav vector and assay for anti-aav (adeno-associated virus) neutralizing antibodies
US9352042B2 (en) 2012-02-24 2016-05-31 Protiva Biotherapeutics, Inc. Trialkyl cationic lipids and methods of use thereof
WO2016128559A1 (en) 2015-02-12 2016-08-18 Hansa Medical Ab Cysteine protease
WO2016128558A1 (en) 2015-02-12 2016-08-18 Hansa Medical Ab Cysteine protease
US9493752B2 (en) 2011-09-13 2016-11-15 Genovis Ab Endoglycosidase from Streptococcus pyogenes and methods using it
US9707279B2 (en) 2011-03-04 2017-07-18 Hansa Medical Ab Treatment for IgE-mediated disease
WO2017134274A1 (en) 2016-02-04 2017-08-10 Ulrich Von Pawel-Rammingen New streptococcal proteases
WO2018093868A1 (en) 2016-11-16 2018-05-24 University Of Florida Research Foundation, Inc. Immunoglobulin proteases, compositions, and uses thereof
US20180169273A1 (en) 2016-12-16 2018-06-21 Uniqure Ip B.V. Immunoadsorption
WO2018158397A1 (en) 2017-03-02 2018-09-07 Genethon Method for removing anti-aav antibodies from a blood-derived composition

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US414A (en) 1837-09-28 Moetise-latch foe
US941A (en) 1838-09-22 Machine for sawing shingles and staves
US5139A (en) 1847-06-05 Cajsfkles
US5173A (en) 1847-06-26 Machinery for
PL1901773T3 (pl) * 2005-06-09 2012-09-28 Hansa Medical Ab Zastosowanie proteinazy IDES (Z S. Pyogenes) do leczenia chorób autoimmunologicznych oraz odrzutów przeszczepu
GB201201314D0 (en) * 2012-01-26 2012-03-07 Isis Innovation Composition
TWI698240B (zh) 2012-05-15 2020-07-11 澳大利亞商艾佛蘭屈澳洲私營有限公司 使用腺相關病毒(aav)sflt-1治療老年性黃斑部退化(amd)
RU2625771C2 (ru) 2012-05-23 2017-07-18 Дженентек, Инк. Способ отбора терапевтических средств
SI3402491T1 (sl) * 2016-01-11 2022-05-31 Rubius Therapeutics, Inc. Sestavki in postopki v zvezi z multimodalnimi terapevtskimi celičnimi sistemi za indikacije raka
US20210228738A1 (en) 2017-07-17 2021-07-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins

Patent Citations (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
EP0367566A1 (en) 1988-10-31 1990-05-09 Immunex Corporation Interleukin-4 receptors
WO1991018982A1 (en) 1990-06-05 1991-12-12 Immunex Corporation Type ii interleukin-1 receptors
WO1992001070A1 (en) 1990-07-09 1992-01-23 The United States Of America, As Represented By The Secretary, U.S. Department Of Commerce High efficiency packaging of mutant adeno-associated virus using amber suppressions
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993003769A1 (en) 1991-08-20 1993-03-04 THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES Adenovirus mediated transfer of genes to the gastrointestinal tract
US5720720A (en) 1993-08-27 1998-02-24 The United States Of America As Represented By The Department Of Health And Human Services Convection-enhanced drug delivery
US5820873A (en) 1994-09-30 1998-10-13 The University Of British Columbia Polyethylene glycol modified ceramide lipids and liposome uses thereof
US6043344A (en) 1995-07-19 2000-03-28 Genetics Institute, Inc. Human CTLA-8 and uses of CTLA-8-related proteins
US6074849A (en) 1995-07-19 2000-06-13 Genetics Institute, Inc. Polynucleotides encoding human CTLA-8 related proteins
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US6579520B2 (en) 1998-05-15 2003-06-17 Genentech, Inc. IL-17 related mammalian cytokine polypeptides (IL-17E)
US6569645B2 (en) 1999-05-14 2003-05-27 Genentech, Inc. IL-17 homologous polypeptides and therapeutic uses thereof
US7803397B2 (en) 2003-09-15 2010-09-28 Protiva Biotherapeutics, Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
US8936942B2 (en) 2003-09-15 2015-01-20 Protiva Biotherapeutics, Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
US7745651B2 (en) 2004-06-07 2010-06-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods of use
US8642076B2 (en) 2006-10-03 2014-02-04 Tekmira Pharmaceuticals Corporation Lipid containing formulations
US20100117125A1 (en) 2006-11-06 2010-05-13 International Business Machines Corporation Semiconductor structures incorporating multiple crystallographic planes and methods for fabrication thereof
US8889128B2 (en) 2006-12-13 2014-11-18 Hansa Medical Ab Use of the endoglycosidase endos for treating immunoglobulin G mediated diseases
US20110177156A1 (en) 2007-11-14 2011-07-21 Szoka Jr Francis C Sterol-Modified Amphiphilic Lipids
US9139554B2 (en) 2008-10-09 2015-09-22 Tekmira Pharmaceuticals Corporation Amino lipids and methods for the delivery of nucleic acids
US8722082B2 (en) 2008-11-10 2014-05-13 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US8999351B2 (en) 2008-11-10 2015-04-07 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US20150265708A1 (en) 2008-11-10 2015-09-24 Tekmira Pharmaceuticals Corporation Novel lipids and compositions for the delivery of therapeutics
US9220683B2 (en) 2008-11-10 2015-12-29 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US9186325B2 (en) 2008-11-10 2015-11-17 Tekmira Pharmaceuticals Corporation Lipids and compositions for the delivery of therapeutics
US20160199485A1 (en) 2008-11-10 2016-07-14 Tekmira Pharmaceuticals Corporation Novel lipids and compositions for the delivery of therapeutics
US20160213785A1 (en) 2008-11-10 2016-07-28 Tekmira Pharmaceuticals Corporation Novel lipids and compositions for the delivery of therapeutics
US9018187B2 (en) 2009-07-01 2015-04-28 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US8569256B2 (en) 2009-07-01 2013-10-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US20130116307A1 (en) 2010-05-12 2013-05-09 Protiva Biotherapeutics Inc. Novel cyclic cationic lipids and methods of use
US20130123338A1 (en) 2010-05-12 2013-05-16 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
US20140288146A1 (en) 2010-09-17 2014-09-25 Protiva Biotherapeutics, Inc. Novel trialkyl cationic lipids and methods of use thereof
US8466122B2 (en) 2010-09-17 2013-06-18 Protiva Biotherapeutics, Inc. Trialkyl cationic lipids and methods of use thereof
US20120172411A1 (en) 2010-09-17 2012-07-05 Protiva Biotherapeutics, Inc. Novel trialkyl cationic lipids and methods of use thereof
US9707279B2 (en) 2011-03-04 2017-07-18 Hansa Medical Ab Treatment for IgE-mediated disease
US20130059732A1 (en) 2011-08-24 2013-03-07 The Board Of Trustees Of The Leland Stanford Junior University Aav capsid proteins for nucleic acid transfer
US20130064894A1 (en) 2011-08-31 2013-03-14 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
US9126966B2 (en) 2011-08-31 2015-09-08 Protiva Biotherapeutics, Inc. Cationic lipids and methods of use thereof
US9493752B2 (en) 2011-09-13 2016-11-15 Genovis Ab Endoglycosidase from Streptococcus pyogenes and methods using it
US9352042B2 (en) 2012-02-24 2016-05-31 Protiva Biotherapeutics, Inc. Trialkyl cationic lipids and methods of use thereof
WO2013158879A1 (en) 2012-04-18 2013-10-24 The Children's Hospital Of Philadelphia Composition and methods for highly efficient gene transfer using aav capsid variants
US20160123990A1 (en) 2013-07-12 2016-05-05 The Children's Hospital Of Philadelphia Aav vector and assay for anti-aav (adeno-associated virus) neutralizing antibodies
WO2015013313A2 (en) 2013-07-22 2015-01-29 The Children's Hospital Of Philadelphia Variant aav and compositions, methods and uses for gene transfer to cells, organs and tissues
WO2016012285A2 (en) 2014-07-25 2016-01-28 Hansa Medical Ab Method
WO2016128559A1 (en) 2015-02-12 2016-08-18 Hansa Medical Ab Cysteine protease
WO2016128558A1 (en) 2015-02-12 2016-08-18 Hansa Medical Ab Cysteine protease
WO2017134274A1 (en) 2016-02-04 2017-08-10 Ulrich Von Pawel-Rammingen New streptococcal proteases
WO2018093868A1 (en) 2016-11-16 2018-05-24 University Of Florida Research Foundation, Inc. Immunoglobulin proteases, compositions, and uses thereof
US20180169273A1 (en) 2016-12-16 2018-06-21 Uniqure Ip B.V. Immunoadsorption
WO2018158397A1 (en) 2017-03-02 2018-09-07 Genethon Method for removing anti-aav antibodies from a blood-derived composition

Non-Patent Citations (55)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. ADF 13949.1
ARRUDA ET AL., BLOOD, vol. 115, 2010, pages 4678 - 88
AYUSO ET AL., GENE THER., vol. 17, 2010, pages 503 - 10
BARASH ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 294, 2002, pages 835 - 42
BAZIN-REDUREAU MARTINE I., RENARD, CATHERINE B.; SCHERRMANN, JEAN-MICHEL G.: "Pharmacokinetics of heterologous and homologous immunoglobulin G, F(ab')2 and Fab after intravenous administration in the rat", J. PHARM. PHARMACOL., vol. 49, no. 16, 1 January 1997 (1997-01-01), pages 277 - 281, XP055907636
BOUTIN ET AL., HUM GENE THER., vol. 21, 2010, pages 704 - 12
CALCEDO ET AL., CLIN VACCINE IMMUNOL., vol. 18, 2011, pages 1586 - 8
CHOI ET AL., J. VIROL., vol. 79, no. 11, 2005, pages 6801 - 7
COVELL DAVID G, BARBET JACQUES, HOLTON OSCAR D, BLACK CHRISTOPHER D V, PARKER R J, WEINSTEIN JOHN N: "Pharmacokinetics of Monoclonal Immunoglobulin G1, F(ab')2, and Fab' in Mice", CANCER RESEARCH, vol. 46, 1 August 1986 (1986-08-01), pages 3969 - 3978, XP055907644
DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIER
DULL ET AL., J VIROL., vol. 72, no. 11, November 1998 (1998-11-01), pages 8463 - 71
ERLES ET AL., J MED VIROL., vol. 59, 1999, pages 406 - 11
GALJAARD ET AL., CLIN CHIM ACTA, vol. 49, no. 3, 1973, pages 361 - 75
GEORGE ET AL., N ENGL J MED., vol. 377, 2017, pages 2215 - 2227
GUIDO ET AL., WORLD J. GASTROENTEROL., vol. 22, 2016, pages 8684 - 8697
HAURIGOT ET AL., MOL THER., vol. 18, 2010, pages 1318 - 29
HULTING ET AL., FEMS MICROBIOL LETT., vol. 298, 2009, pages 44 - 50
JORDAN ET AL., N ENGL. J MED., vol. 377, 2017, pages 5
JULIE R DELLINGER: "A Bacterial IgG-Degrading Enzyme to Unhinge Antibodies", THE NEW ENGLAND JOURNAL OF MEDICINE, - NEJM -, vol. 377, no. 5, 3 August 2017 (2017-08-03), US, pages 487 - 489, XP055527722, ISSN: 0028-4793, DOI: 10.1056/NEJMe1706903 *
KOTIN: "Fundamental Virology", 1994, article "Parvoviridae and their Replication"
KYOKO TOMITA: "Correlation between Adenovirus-neutralizing Antibody Titer and Adenovirus Vector-mediated Transduction Efficiency Following Intratumoral Injection", ANTICANCER RESEARCH, 1 January 2012 (2012-01-01), pages 1145 - 1152, XP055527280, Retrieved from the Internet <URL:http://ar.iiarjournals.org/content/32/4/1145.full.pdf#page=1&view=FitH> [retrieved on 20181127] *
LANNERGARDGUSS, FEMS MICROBIOL LETT., vol. 262, 2006, pages 230 - 235
LI ET AL., GENE THER., vol. 19, 2012, pages 288 - 94
MAGA, J. BIOL. CHEM., 2012
MAHMOOD IFTEKHAR: "Interspecies Scaling of Antibody–Drug Conjugates (ADC) for the Prediction of Human Clearance", ANTIBODIES, vol. 10, no. 1, 1 January 2021 (2021-01-01), pages 1 - 13, XP055907685, DOI: 10.3390/antib10010001
MANNO ET AL., NAT MED., vol. 12, 2006, pages 342 - 7
MANNUCCI ET AL., N ENGL J MED., vol. 344, 2001, pages 1773 - 9
MARTINEZ M., MAHMOOD I., HUNTER R. P.: "Interspecies allometric scaling: prediction of clearance in large animal species: Part II: mathematical considerations", JOURNAL OF VETERINARY PHARMACOLOGY AND THERAPEUTICS, vol. 29, no. 5, 1 October 2006 (2006-10-01), GB , pages 425 - 432, XP055907693, ISSN: 0140-7783, DOI: 10.1111/j.1365-2885.2006.00787.x
MASAT ET AL., DISCOV MED., vol. 15, 2013, pages 379 - 89
MCCARTY D M: "Self-complementary AAV vectors; advances and applications", MOL. THER., vol. 16, no. 10, October 2008 (2008-10-01), pages 1648 - 51, XP002714134, doi:10.1038/mt.2008.171
MCCARTY ET AL., ANNU REV GENET., vol. 38, 2004, pages 819 - 45
MCCARTY ET AL., GENE THER., vol. 8, no. 16, 2001, pages 1248 - 54
MCCARTY, MOL. THER., vol. 16, no. 10, 2008, pages 1648 - 56
MELIANI ET AL., HUM GENE THER METHODS., vol. 26, 2015, pages 45 - 53
MENDELL ET AL., N. ENGL. J. MED., vol. 377, 2017, pages 1713 - 1722
MINGOZZI ET AL., BLOOD, vol. 122, 2013, pages 23 - 36
MINGOZZI ET AL., GENE THER., vol. 20, 2013, pages 417 - 24
MINGOZZI ET AL., SCI TRANSL MED., vol. 5, 2013, pages 194ra92
NALDINI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 11382 - 11388
NATHWANI ET AL., N ENGL J MED., vol. 365, 2011, pages 2357 - 65
NATHWANI ET AL., N ENGL J MED., vol. 371, 2014, pages 1994 - 2004
P COLELLA ET AL: "Emerging Issues in AAV-Mediated In Vivo Gene Therapy.", MOL THER METHODS CLIN DEV., 1 December 2017 (2017-12-01), pages 87 - 104, XP055509603, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5758940/pdf/main.pdf> [retrieved on 20180925], DOI: 10.1016/j.omtm.2017.11.007 *
PENZES ET AL., J. GEN. VIROL., vol. 96, 2015, pages 2769 - 2779
RAHMAN A ET AL: "Specific depletion of human anti-adenovirus antibodies facilitates transduction in an in vivo model for systemic gene therapy", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, ACADEMIC PRESS ; NATURE PUBLISHING GROUP, US, vol. 3, no. 5, 1 May 2001 (2001-05-01), pages 768 - 778, XP002977532, ISSN: 1525-0016, DOI: 10.1006/MTHE.2001.0316 *
ROEKRING ET AL., VIRUS RES., vol. 87, 2002, pages 79 - 87
ROOPENIAN ET AL., J IMMUNOL., vol. 170, 2003, pages 3528 - 33
RYAN ET AL., MOL IMMUNOL., vol. 45, 2008, pages 1837 - 46
SAMBROOK ET AL.: "Molecular Cloning, a laboratory manual", 1989, COLD SPRING HARBOR LABORATORIES
SCALLAN ET AL., BLOOD, vol. 108, 2006, pages 1810 - 27
SCIENCE, vol. 272, 1996, pages 263 - 267
TRAVIS ET AL., BIOCHIM BIOPHYS ACTA, vol. 1477, 2000, pages 35 - 50
TRAVIS ET AL., TRENDS MICROBIOL., vol. 3, 1995, pages 405 - 7
VON PAWEL-RAMMINGEN ET AL., CURR OPIN MICROBIOL., vol. 6, 2003, pages 50 - 5
WEIRONG WANG; THOMAYANT PRUEKSARITANONT: "Prediction of human clearance of therapeutic proteins: simple allometric scaling method revisited", BIOPHARMACEUTICS AND DRUG DISPOSITION, vol. 31, no. 4, 8 April 2010 (2010-04-08), US , pages 253 - 263, XP071467019, ISSN: 0142-2782, DOI: 10.1002/bdd.708
ZUFFEREY ET AL., NAT. BIOTECHNOL., vol. 15, 1997, pages 871 - 875

Cited By (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
USRE50288E1 (en) 2008-09-15 2025-02-04 Uniqure Biopharma B.V. Factor IX polypeptide mutant, its uses and a method for its production
US11524057B2 (en) * 2015-02-12 2022-12-13 Hansa Biopharma AB Cysteine protease
US12116384B2 (en) 2018-04-03 2024-10-15 Ginkgo Bioworks, Inc. Virus vectors for targeting ophthalmic tissues
US12091435B2 (en) 2018-04-03 2024-09-17 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US12060390B2 (en) 2018-04-03 2024-08-13 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
US11976096B2 (en) 2018-04-03 2024-05-07 Ginkgo Bioworks, Inc. Antibody-evading virus vectors
EP3768304B1 (en) 2018-07-17 2022-10-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
AU2020215682B2 (en) * 2019-01-28 2025-12-18 Duke University Compositions and methods for evading humoral immunity
JP7707066B2 (ja) 2019-01-28 2025-07-14 デューク ユニバーシティ 体液性免疫を回避する組成物および方法
JP2022523679A (ja) * 2019-01-28 2022-04-26 デューク ユニバーシティ 体液性免疫を回避する組成物および方法
US11981914B2 (en) 2019-03-21 2024-05-14 Ginkgo Bioworks, Inc. Recombinant adeno-associated virus vectors
WO2021067598A1 (en) 2019-10-04 2021-04-08 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant aav
US12544437B2 (en) 2019-10-04 2026-02-10 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant AAV
US12611436B2 (en) 2019-10-17 2026-04-28 Sarepta Therapeutics, Inc. AAV transfer cassette
US11905523B2 (en) 2019-10-17 2024-02-20 Ginkgo Bioworks, Inc. Adeno-associated viral vectors for treatment of Niemann-Pick Disease type-C
JP2023179531A (ja) * 2019-12-06 2023-12-19 リジェネロン・ファーマシューティカルズ・インコーポレイテッド 抗vegfタンパク質組成物及びその製造方法
US12012444B2 (en) 2019-12-06 2024-06-18 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US11649273B2 (en) 2019-12-06 2023-05-16 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US11732025B2 (en) 2019-12-06 2023-08-22 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US11753459B2 (en) 2019-12-06 2023-09-12 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US12077570B2 (en) 2019-12-06 2024-09-03 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US12054533B2 (en) 2019-12-06 2024-08-06 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
US12054532B2 (en) 2019-12-06 2024-08-06 Regeneron Pharmaceuticals, Inc. Anti-VEGF protein compositions and methods for producing the same
WO2021152314A1 (en) 2020-01-28 2021-08-05 Freeline Therapeutics Limited Improved assay for determining neutralising antibody titre to a viral vektor
WO2021163322A1 (en) 2020-02-14 2021-08-19 Ultragenyx Pharmaceutical Inc. Gene therapy for treating cdkl5 deficiency disorder
US12103960B2 (en) 2020-05-08 2024-10-01 Regeneron Pharmaceuticals, Inc. VEGF traps and mini-traps and methods for treating ocular disorders and cancer
CN111621506A (zh) * 2020-05-09 2020-09-04 华中农业大学 牛支原体分泌蛋白MbovP0145及其应用
CN111621506B (zh) * 2020-05-09 2021-07-30 华中农业大学 牛支原体分泌蛋白MbovP0145及其应用
CN115698279A (zh) * 2020-05-19 2023-02-03 汉莎生物制药股份有限公司 半胱氨酸蛋白酶
JP7770341B2 (ja) 2020-05-19 2025-11-14 ハンサ バイオファーマ エービー システインプロテアーゼ
WO2021233911A1 (en) * 2020-05-19 2021-11-25 Hansa Biopharma AB Cysteine protease
US12460194B2 (en) 2020-05-19 2025-11-04 Hansa Biopharma AB Cysteine protease
JP2023526849A (ja) * 2020-05-19 2023-06-23 ハンサ バイオファーマ エービー システインプロテアーゼ
EP4162951A4 (en) * 2020-06-05 2024-07-10 Shanghai Bao Pharmaceuticals Co., Ltd. PHARMACEUTICAL COMPOSITION OF ENZYMES AND VIRUSES AND ASSOCIATED APPLICATION
JP7795790B2 (ja) 2020-06-05 2026-01-08 上海宝済薬業股▲ふん▼有限公司 酵素とウィルスとの薬物組成物及びその使用
CN115066261A (zh) * 2020-06-05 2022-09-16 上海宝济药业有限公司 一种酶和病毒的药物组合及其应用
JP2023529186A (ja) * 2020-06-05 2023-07-07 上海宝済薬業有限公司 酵素とウィルスとの薬物組成物及びその使用
JP2023532219A (ja) * 2020-06-18 2023-07-27 上海宝済薬業有限公司 免疫グロブリン分解酵素IdeEの突然変異体
WO2022005338A1 (ru) * 2020-07-03 2022-01-06 Максим Петрович НИКИТИН Способ лечения генотерапевтическим агентом
US12104163B2 (en) 2020-08-19 2024-10-01 Sarepta Therapeutics, Inc. Adeno-associated virus vectors for treatment of Rett syndrome
WO2022067080A1 (en) * 2020-09-28 2022-03-31 Scout Bio, Inc. Composition and uses thereof
WO2022076556A2 (en) 2020-10-07 2022-04-14 Asklepios Biopharmaceutical, Inc. Therapeutic adeno-associated virus delivery of fukutin related protein (fkrp) for treating dystroglycanopathy disorders including limb girdle 2i (lgmd2i)
WO2022192193A1 (en) * 2021-03-09 2022-09-15 The Board Of Regents Of The University Of Texas System Methods and compositions for mutagenesis screening in mammalian cells
WO2022221529A1 (en) 2021-04-16 2022-10-20 Asklepios Biopharmaceutical, Inc. Rational polyploid aav virions that cross the blood brain barrier and elicit reduced humoral response
RU2840475C2 (ru) * 2021-05-03 2025-05-26 Ажероникс Са Альфа-1-антитрипсин (ААТ) в лечении и (или) профилактике неврологических нарушений
WO2023019168A1 (en) 2021-08-11 2023-02-16 Ultragenyx Pharmaceutical Inc. Compositions and methods for treating a muscular dystrophy
WO2025155923A1 (en) 2024-01-17 2025-07-24 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with the transferrin receptor
WO2025217163A2 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Novel aav capsids binding to human cd59
WO2025217174A1 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with carbonic anhydrase iv
WO2025256978A1 (en) 2024-06-13 2025-12-18 Bayer Aktiengesellschaft Variants of igm and igg cleaving enzymes
WO2025256977A1 (en) 2024-06-13 2025-12-18 Bayer Aktiengesellschaft Novel igm and igg cleaving enzymes
WO2026041758A1 (en) * 2024-08-22 2026-02-26 Genethon Modified aav capsid with enhanced transduction efficiency
WO2026074173A1 (en) 2024-10-04 2026-04-09 Hansa Biopharma AB Regimen for vector-based therapies

Also Published As

Publication number Publication date
ES2935970T3 (es) 2023-03-13
CO2021000326A2 (es) 2021-04-19
PE20211859A1 (es) 2021-09-21
EP4154904A1 (en) 2023-03-29
US20230142731A1 (en) 2023-05-11
CA3106368A1 (en) 2020-01-23
HUE060720T2 (hu) 2023-04-28
IL280099A (en) 2021-03-01
DK3768304T3 (da) 2023-01-09
SI3768304T1 (sl) 2023-02-28
KR20210042308A (ko) 2021-04-19
AU2019306121A1 (en) 2021-01-28
US20210228738A1 (en) 2021-07-29
JP2024075765A (ja) 2024-06-04
EP3768304B1 (en) 2022-10-12
SG11202100306VA (en) 2021-02-25
PL3768304T3 (pl) 2023-03-13
MX2021000580A (es) 2021-07-15
CL2021000112A1 (es) 2021-09-03
ZA202100202B (en) 2022-01-26
PH12021550115A1 (en) 2021-10-04
SMT202300005T1 (it) 2023-03-17
BR112021000807A8 (pt) 2022-12-06
AU2025217293A1 (en) 2025-09-04
EP3768304A1 (en) 2021-01-27
BR112021000807A2 (pt) 2021-05-11
JP2021529821A (ja) 2021-11-04
UA130604C2 (uk) 2026-04-01
FI3768304T3 (fi) 2023-01-13
CN119345338A (zh) 2025-01-24
HRP20221542T1 (hr) 2023-02-17
AU2019306121B2 (en) 2025-08-28
US20210246469A1 (en) 2021-08-12
LT3768304T (lt) 2023-03-27
CN112689515A (zh) 2021-04-20
RS63878B1 (sr) 2023-02-28

Similar Documents

Publication Publication Date Title
US20230142731A1 (en) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
US12290574B2 (en) Optimized promoter sequences, intron-free expression constructs and methods of use
US20230241247A1 (en) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
WO2020102740A2 (en) Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins
US20240110201A1 (en) Compositions and Methods for Treating Hereditary Angioedema
CA3208153A1 (en) Compositions and methods for treating fabry disease
RU2849598C2 (ru) Композиции и способы для повышения или усиления трансдукции векторов для генной терапии и для удаления или снижения иммуноглобулинов
RU2841237C1 (ru) Композиции и способы для повышения или усиления трансдукции векторов для генной терапии и для удаления или снижения иммуноглобулинов

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19740384

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019740384

Country of ref document: EP

Effective date: 20201021

ENP Entry into the national phase

Ref document number: 3106368

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021502435

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2021/0000326

Country of ref document: CO

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021000807

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019306121

Country of ref document: AU

Date of ref document: 20190717

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2021100780

Country of ref document: RU

WWP Wipo information: published in national office

Ref document number: NC2021/0000326

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112021000807

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210115

WWG Wipo information: grant in national office

Ref document number: 2021100780

Country of ref document: RU