WO2019222252A1 - Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects - Google Patents

Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects Download PDF

Info

Publication number
WO2019222252A1
WO2019222252A1 PCT/US2019/032271 US2019032271W WO2019222252A1 WO 2019222252 A1 WO2019222252 A1 WO 2019222252A1 US 2019032271 W US2019032271 W US 2019032271W WO 2019222252 A1 WO2019222252 A1 WO 2019222252A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
tgf
protein
polypeptide
formulation
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/032271
Other languages
English (en)
French (fr)
Inventor
Laureen OJALVO
Samer El Bawab
Isabelle Dussault
Yulia Vugmeyster
Akash Khandelwal
Olaf Christensen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merck Patent GmbH
Original Assignee
Merck Patent GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2020556807A priority Critical patent/JP2021523096A/ja
Priority to MX2020011638A priority patent/MX2020011638A/es
Priority to CN201980032533.9A priority patent/CN112118858A/zh
Priority to CA3096844A priority patent/CA3096844A1/en
Priority to EP19804320.0A priority patent/EP3813868A4/en
Priority to BR112020021082-0A priority patent/BR112020021082A2/pt
Priority to AU2019271065A priority patent/AU2019271065A1/en
Priority to KR1020207035552A priority patent/KR20210009339A/ko
Priority to SG11202011148VA priority patent/SG11202011148VA/en
Application filed by Merck Patent GmbH filed Critical Merck Patent GmbH
Publication of WO2019222252A1 publication Critical patent/WO2019222252A1/en
Priority to US17/095,377 priority patent/US20210061899A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/179Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/86Lung
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction

Definitions

  • the present disclosure relates generally to dosage regimens for targeted TGF- inhibition with a bi-functional fusion protein for use in a method of treating cancer or inhibiting tumor growth in treatment na ⁇ ve patients.
  • the programmed death 1 (PD-1)/PD-L1 axis is an important mechanism for tumor immune evasion. Effector T cells chronically sensing antigen take on an exhausted phenotype marked by PD-1 expression, a state under which tumor cells engage by upregulating PD-L1. Additionally, in the tumor microenvironment, myeloid cells, macrophages, parenchymal cells and T cells upregulate PD-L1. Blocking the axis restores the effector function in these T cells.
  • US patent application publication number US 20150225483 A1 incorporated herein by reference, describes a bi-functional fusion protein that combines an anti-programmed death ligand 1 (PD-L1) antibody with the soluble extracellular domain of tumor growth factor beta receptor type II (TGF RII) as a TGF neutralizing“Trap,” into a single molecule.
  • the protein is a heterotetramer, consisting of the two immunoglobulin light chains of anti-PD- L1, and two heavy chains comprising the heavy chain of anti-PD-L1 genetically fused via a flexible glycine-serine linker to the extracellular domain of the human TGF RII (see Fig.1).
  • This anti-PD-L1/ TGF Trap molecule is designed to target two major mechanisms of immunosuppression in the tumor microenvironment.
  • US patent application publication number US 20150225483 A1 describes administration of the Trap molecule at doses based on the patient’s weight.
  • Lung cancer is the leading cause of cancer death in the USA and results in more cancer deaths than breast cancer, prostate cancer, and colorectal cancer combined.
  • Non-small cell lung cancer accounts for approximately 80% of all cases of lung cancer. It is estimated in 2018 there would be 234,030 new cases of lung and bronchus cancer and 154,050 people would die from their lung cancers in the USA alone (Siegel, 2018). In the EU, 275,700 deaths due to lung cancer were predicted in 2017 (Malvezzi, 2017).
  • the present disclosure provides improved dosing regimens for administration of bifunctional proteins targeting PD-L1 and TGF .
  • body weight independent (BW- independent) dosing regimens and related dosage forms involving administration of at least 500 mg (e.g., 1200 mg, 2400 mg) of the bifunctional protein administered at various dosing frequencies can be used as an anti-tumor and anti-cancer therapeutic.
  • the BW-independent dosing regimen ensures that all patients, irrespective of their body weight, will have adequate drug exposure at the tumor site.
  • the bifunctional protein of the present disclosure includes a first and a second polypeptide.
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor Receptor II (TGF RII), or a fragment thereof, capable of binding Transforming Growth Factor (TGF ) (e.g., a soluble fragment).
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, in which the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1 (e.g., any of the antibodies or antibody fragments described herein).
  • the bifunctional protein of the present disclosure binds to two targets, (1) PD-L1, which is largely membrane bound, and (2) TGF , which is soluble in blood and interstitium, the BW-independent dosing regimen requires a dose that is effective not only to inhibit PD-L1 at the tumor site but also sufficient to inhibit TGF .
  • the disclosure provides a method of treating cancer or inhibition of a tumor, e.g., non-small cell lung cancer (e.g., advanced non-small cell lung cancer), melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck in a treatment na ⁇ ve patient.
  • the present invention provides a method of treating NSCLC with high PD-L1 expression, by administering an anti-PD-L1/TGF Trap molecule described in the present disclosure to a patient in need thereof.
  • the present invention provides a method of treating advanced non-small cell lung cancer (NSCLC) (e.g., NSCLC with high PD-L1 expression) or inhibiting tumor growth in a treatment na ⁇ ve patient in need thereof by administering 1200 mg of an anti-PD-L1/TGF Trap molecule of the present disclosure once every two weeks to the patient.
  • NSCLC advanced non-small cell lung cancer
  • the present invention provides a method of treating advanced non-small cell lung cancer (NSCLC) (e.g., NSCLC with high PD-L1 expression) or inhibiting tumor growth in a treatment na ⁇ ve patient in need thereof by administering 2400 mg of an anti-PD-L1/TGF Trap molecule of the present disclosure once every three weeks to the patient.
  • the disclosure also features a method of promoting local depletion of TGF .
  • the method includes administering a protein described above, where the protein binds TGF in solution, binds PD-L1 on a cell surface, and carries the bound TGF into the cell (e.g., a cancer cell).
  • the disclosure also features a method of inhibiting SMAD3 phosphorylation in a cell (e.g., a cancer cell or an immune cell), the method including exposing the cell in the tumor microenvironment to a protein described above.
  • Other embodiments and details of the disclosure are presented herein below. BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG.1 is a schematic drawing of an anti-PD-L1/TGF Trap molecule including one anti-PD-L1 antibody fused to two extracellular domain (ECD) of TGF Receptor II via a (Gly 4 Ser) 4 Gly (SEQ ID NO: 11) linker.
  • FIG.2 shows a graph of a two-step ELISA demonstrating that anti-PD-L1/TGF Trap simultaneously binds to both PD-L1 and TGF .
  • FIG.3 is a graph showing anti-PD-L1/TGF Trap induces a dramatic increase in IL- 2 levels.
  • FIG.4A is a graph showing in vivo depletion of TGF 1 in response to the anti-PD- L1/TGF Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG.4B is a graph showing in vivo depletion of TGF 2 in response to the anti-PD-L1/TGF Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG. 4C is a graph showing in vivo depletion of TGF 3 in response to the anti-PD-L1/TGF Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG. 4D is a graph showing that occupancy of PD- L1 by the anti-PD-L1/TGF Trap supports a receptor binding model in the EMT-6 tumor system.
  • FIG.5 is a graph showing anti-tumor efficacy of anti-PD-L1/TGF Trap control (anti-PD-L1(mut)/TGF ) in Detroit 562 xenograft model.
  • FIG.6A is a box-plot of C avg distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.6B is a box-plot of exposure AUC distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG. 6C is a box-plot of C trough distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG. 6D is a box-plot of C max distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.6E is a box-plot of C avg distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.6F is a box-plot of exposure AUC distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG. 6G is a box-plot of C trough distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIGs.7A–7C are graphs showing the predicted PK and PD-L1 receptor occupancy (“RO”) of ant-PD-L1/TGF Trap molecules at doses and schedules associated with tumor stasis in mice.
  • FIG.7A is a graph showing the predicted plasma concentration vs. time.
  • FIG. 7B is a graph showing the predicted PD-L1 RO vs. time in PBMC.
  • FIG.7C is a graph showing the predicted PD-L1 RO vs. time in tumor.
  • FIG.8 is a schematic diagram of the therapeutic regimen.
  • NSCLC non-small cell lung cancer
  • Q2W every 2 weeks
  • Q3W every 3 weeks
  • BOR best overall response
  • DOR duration of response
  • OS overall survival
  • R* randomization.
  • PD-L1 high represents 80% PD-L1 positive tumor cells as determined by the PD-L1 IHC 73-10 assay (Dako), or TPS 50% as determined by the Dako IHC 22C3
  • TGF RII or“TGF Receptor II” is meant a polypeptide having the wild-type human TGF Receptor Type 2 Isoform A sequence (e.g., the amino acid sequence of NCBI Reference Sequence (RefSeq) Accession No. NP_001020018 (SEQ ID NO: 8)), or a polypeptide having the wild-type human TGF Receptor Type 2 Isoform B sequence (e.g., the amino acid sequence of NCBI RefSeq Accession No.
  • NP_003233 (SEQ ID NO: 9) or having a sequence substantially identical to the amino acid sequence of SEQ ID NO: 8 or of SEQ ID NO: 9.
  • the TGF RII may retain at least 0.1%, 0.5%, 1%, 5%, 10%, 25%, 35%, 50%, 75%, 90%, 95%, or 99% of the TGF -binding activity of the wild-type sequence.
  • the polypeptide of expressed TGF RII lacks the signal sequence.
  • a“fragment of TGF RII capable of binding TGF” is meant any portion of NCBI RefSeq Accession No. NP_001020018 (SEQ ID NO: 8) or of NCBI RefSeq Accession No.
  • NP_003233 (SEQ ID NO: 9), or a sequence substantially identical to SEQ ID NO: 8 or SEQ ID NO: 9 that is at least 20 (e.g., at least 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 175, or 200) amino acids in length that retains at least some of the TGF -binding activity (e.g., at least 0.1%, 0.5%, 1%, 5%, 10%, 25%, 35%, 50%, 75%, 90%, 95%, or 99%) of the wild-type receptor or of the corresponding wild-type fragment.
  • TGF -binding activity e.g., at least 0.1%, 0.5%, 1%, 5%, 10%, 25%, 35%, 50%, 75%, 90%, 95%, or 99%
  • such fragment is a soluble fragment.
  • TGF RII extra-cellular domain having the sequence of SEQ ID NO: 10.
  • Certain other exemplary fragments of human TGF RII capable of binding TGF are represented by the sequence of SEQ ID NOs: 50, 51, 52, 53, or 54.
  • “Treatment na ⁇ ve” refers to patients who have not received prior systemic treatment for their advanced/Stage IV NSCLC.
  • treatment na ⁇ ve patients have not received prior therapy with an anti-PD-1, anti-PD-L1, anti- PD-L2, anti-CD137, or anti-Cytotoxic T-lymphocyte-associated antigen-4 (CTLA-4) antibody (including ipilimumab), or any other antibody or drug specifically targeting T-cell co- stimulation or checkpoint pathways.
  • CTLA-4 antibody including ipilimumab
  • treatment na ⁇ ve patients are selected for first-line (1L) treatment of the present invention.
  • PD-L1 positive or“PD-L1+” indicates 1% PD-L1 positive tumor cells as determined, for example, by the Dako IHC 22C3 PharmDx assay, or by the VENTANA PD-L1 (SP263) assay.
  • PD-L1 high or“high PD-L1” refers to 80% PD-L1 positive tumor cells as determined by the PD-L1 IHC 73-10 assay (Dako), or tumor proportion score (TPS) 50% as determined by the Dako IHC 22C3 PharmDx assay (TPS is a term of art related to the IHC 22C3 PharmDx assay, which describes the percentage of viable tumor cells with partial or complete membrane staining (e.g., staining for PD-L1)). Both IHC 73-10 and IHC 22C3 assays select a similar patient population at their respective cutoffs. In certain embodiments,
  • VENTANA PD-L1 (SP263) assay which has high concordance with 22C3 PharmDx assay (see Sughayer et al., Appl. Immunohistochem. Mol. Morphol., (2016)), can also be used for determining PD-L1 high expression level.
  • substantially identical is meant a polypeptide exhibiting at least 50%, desirably 60%, 70%, 75%, or 80%, more desirably 85%, 90%, or 95%, and most desirably 99% amino acid sequence identity to a reference amino acid sequence.
  • the length of comparison sequences will generally be at least 10 amino acids, desirably at least 15 contiguous amino acids, more desirably at least 20, 25, 50, 75, 90, 100, 150, 200, 250, 300, or 350 contiguous amino acids, and most desirably the full-length amino acid sequence.
  • patient is meant either a human or non-human animal (e.g., a mammal).
  • Patient “Patient,”“subject,”“patient in need thereof,” and“subject in need thereof” are used interchangeably in this disclosure, and refer to a living organism suffering from or prone to a disease or condition that can be treated by administration using the methods and compositions provided in this disclosure.
  • the terms“treat,”“treating,” or“treatment,” and other grammatical equivalents as used in this disclosure, include alleviating, abating, ameliorating, or preventing a disease, condition or symptoms, preventing additional symptoms, ameliorating or preventing the underlying metabolic causes of symptoms, inhibiting the disease or condition, e.g., arresting the development of the disease or condition, relieving the disease or condition, causing regression of the disease or condition, relieving a condition caused by the disease or condition, or stopping the symptoms of the disease or condition, and are intended to include prophylaxis.
  • the terms further include achieving a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder.
  • the term“cancer” is meant advanced/Stage IV non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • Advanced/Stage IV NSCLC is used according to its plain and ordinary meaning, and refers to stages IVA or IVB of NSCLC, characterized by, for example, metastasis to one or more sites.
  • the cancer is a metastatic NSCLC.
  • the word“comprise” and other forms of the word, such as“comprising” and“comprises,” means including but not limited to, and is not intended to exclude, for example, other components.
  • “co-administer” it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of additional therapies.
  • the protein and the composition of the present disclosure can be administered alone or can be co- administered with a second, third, or fourth therapeutic agent(s) to a patient. Co-administration is meant to include simultaneous or sequential administration of the protein or composition individually or in combination (more than one therapeutic agent).
  • the term“a” is not meant to limit as a singular.
  • A“reconstituted” formulation is one which has been prepared by dissolving a lyophilized formulation in an aqueous carrier such that the bifunctional molecule is dissolved in the reconstituted formulation.
  • the reconstituted formulation is suitable for intravenous administration (IV) to a patient in need thereof.
  • the term“about” refers to any minimal alteration in the concentration or amount of an agent that does not change the efficacy of the agent in preparation of a formulation and in treatment of a disease or disorder.
  • the term“about” may include ⁇ 15% of a specified numerical value or data point.
  • Ranges can be expressed in this disclosure as from“about” one particular value, and/or to“about” another particular value. When such a range is expressed, another aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent“about,” it is understood that the particular value forms another aspect.
  • each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed in this disclosure, and that each value is also disclosed as“about” that particular value in addition to the value itself. It is also understood that throughout the application, data are provided in a number of different formats and that this data represent endpoints and starting points and ranges for any combination of the data points. For example, if a particular data point“10” and a particular data point“15” are disclosed, it is understood that greater than, greater than or equal to, less than, less than or equal to, and equal to 10 and 15 are considered disclosed as well as between 10 and 15. It is also understood that each unit between two particular units are also disclosed.
  • An“isotonic” formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsmol/KgH 2 O. The term "hypertonic" is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice- freezing type osmometer, for example.
  • the term“buffering agent” refers to one or more components that when added to an aqueous solution is able to protect the solution against variations in pH when adding acid or alkali, or upon dilution with a solvent.
  • phosphate buffers there can be used glycinate, carbonate, citrate buffers and the like, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • An“acid” is a substance that yields hydrogen ions in aqueous solution.
  • a “pharmaceutically acceptable acid” includes inorganic and organic acids which are nontoxic at the concentration and manner in which they are formulated.
  • A“base” is a substance that yields hydroxyl ions in aqueous solution.
  • “Pharmaceutically acceptable bases” include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated.
  • A“lyoprotectant” is a molecule which, when combined with a protein of interest, prevents or reduces chemical and/or physical instability of the protein upon lyophilization and subsequent storage.
  • A“preservative” is an agent that reduces bacterial action and may be optionally added to the formulations herein. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • preservatives examples include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • Other types of preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3pentanol, and m-cresol.
  • A“surfactant” is a surface active molecule containing both a hydrophobic portion (e.g., alkyl chain) and a hydrophilic portion (e.g., carboxyl and carboxylate groups). Surfactant may be added to the formulations of the invention.
  • Surfactants suitable for use in the formulations of the present invention include, but are not limited to, polysorbates (e.g.
  • Body Weight-Independent Dosing regimens involving the administration to treatment na ⁇ ve patients of at least 500 mg of the bifunctional anti-PD-L1/TGF Trap molecules described herein have been developed, informed by the results of a variety of pre-clinical and clinical assessments of the molecules. Two studies investigated the safety, tolerability, and pharmacokinetics of the molecules, and included assessments of PD-L1 target occupancy on peripheral blood mononuclear cells obtained from the blood of treated patients and measurements of the concentrations of TGF 1, TGF 2, and TGF 3.
  • PK/Efficacy Model (Mouse Model) [0045] Experiments were also conducted to determine the efficacy of the anti-PD-L1/TGF Trap molecule in a tumor model. Efficacy results from EMT-6 xenografts were used to establish the PK/Efficacy model. The established PK model in mice was used to simulate anti- PD-L1/TGF Trap plasma exposure for the efficacy experiment settings. The estimated parameters are reported in Table 1.
  • the estimated KC50 value was 55.3 ⁇ g/mL. This value represents the average plasma concentrations for which 50% of the maximal anti-tumor activity of the anti-PD-L1/TGF Trap molecule could be achieved.
  • Basic diagnostics plots of the model revealed no model misspecification. The model predictions are able to capture the tumor volume distributions. Conditional weighted residuals are normally distributed with a 0 mean and 1 variance without a trend. The PK/Efficacy model was then used to simulate tumor growth inhibition (TGI) using the human predicted concentration-time profiles at different doses.
  • Table 1 Mouse PK/Efficacy model parameters for anti-PD-L1/TGF Trap molecule in EMT-6 xenograft mice
  • FIGs. 7A-7C which summarize the PK/RO/Efficacy for the anti-PD-L1/TGF Trap molecule in mice.95% of PD- L1 RO is achieved at a plasma concentration of 40 ⁇ g/mL with an expected/estimate TGI of only about 65%. Increasing the concentration above 40 ⁇ g/mL results in an additional increase in tumor growth inhibition. 95% of tumor growth inhibition is achieved at average plasma concentration of about 100 ⁇ g/mL.
  • a flat dose of at least 500 mg administered once every two weeks is required to maintain an average concentration of about 100 ⁇ g/mL
  • a flat dose of about 1200 mg administered once every two weeks is required to maintain a C trough of about 100 ⁇ g/mL.
  • about 1200 mg to about 3000 mg e.g., about 1200, about 1300, about 1400, about 1500, about 1600, about 1700, about 1800, about 1900, about 2000, about 2100, about 2200, about 2300, about 2400, etc.
  • a protein product of the present disclosure e.g., anti-PD-L1/TGF Trap
  • about 1200 mg of anti-PD-L1/TGF Trap molecule is administered to a subject once every two weeks. In certain embodiments, about 2400 mg of anti-PD-L1/TGF Trap molecule is administered to a subject once every three weeks.
  • about 1200 mg to about 3000 mg e.g., about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, etc.
  • a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 is administered to a subject.
  • about 1200 mg to about 3000 mg e.g., about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, etc.
  • a first polypeptide that includes a first polypeptide comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37
  • a second polypeptide comprising the amino acid sequences of SEQ ID NOs: 38, 39, and 40 is administered to a subject.
  • about 1200 mg of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every two weeks.
  • about 2400 mg of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every three weeks.
  • about 1200 mg of the protein product that includes a first polypeptide comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide comprising the amino acid sequences of SEQ ID NOs: 38, 39, and 40 is administered to a subject once every two weeks.
  • about 2400 mg of the protein product that includes a first polypeptide comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide comprising the amino acid sequences of SEQ ID NOs: 38, 39, and 40 is administered to a subject once every three weeks.
  • a new, body weight-independent dosing regimen for the administration of anti-PD-L1/TGF Trap molecules has been created to achieve less variability in exposure, reduce dosing errors, reduce the time necessary for dose preparation, and reduce drug wastage compared to the mg/kg dosing, thus facilitating favorable treatment outcomes.
  • a flat dose of at least 500 mg can be administered, regardless of the patient’s body weight.
  • a flat dose of at least 1200 mg can be administered, regardless of the patient’s body weight.
  • a flat dose of 2400 mg can be administered, regardless of the patient’s body weight.
  • such doses would be administered repeatedly, such as once every two weeks or once every 3 weeks, for example.
  • a flat dose of 1200 mg can be administered once every two weeks, or a flat dose of 2400 mg can be administered once every three weeks.
  • Pharmacokinetic (PK) Analysis Sampling in Humans [0054] An example of pharmacokinetic analysis to determine the optimal flat dose of the anti-PD-L1/TGF Trap is provided by the experiments described below.
  • Serum samples for pharmacokinetic (PK) data analysis were collected before the start of the first dose and at the following time points after the first dose: on Day 1 immediately after the infusion and 4 hours after the start of the infusion; on Day 2 at least 24 hours after the Day 1 end of infusion; and on Days 8 and 15.
  • pre-dose samples were or were to be collected followed by once every 6 weeks PK sampling until 12 weeks, then once every 12 weeks PK sampling. In the expansion phase sparse PK sampling was conducted.
  • Body weight was a relevant covariate on both CL and V1.
  • the impact of the dosing strategy on the exposure variability of the protein of the present disclosure was explored. Specifically, simulations were performed to compare the exposure distribution using a flat dosing approach of 1200 mg once every two weeks versus a BW-adjusted dosing approach of either 17.65 mg/kg once every two weeks (corresponding to 1200 mg once every two weeks for a 68 kg subject or 15 mg/kg once every two weeks (corresponding to 1200 mg for a 80 kg subject).
  • ORR overall response rate
  • PR partial responses
  • CR complete response
  • Table 2 clinical activity was observed across PD-L1 expression levels: ORR was 37.0% in PD-L1+ and 85.7% in PD-L1–high patients at 1200 mg.
  • a flat dose of at least 500 mg administered once every two weeks is required to maintain an average concentration of about 100 ⁇ g/mL for a typical subject, while a flat dose of about 1200 mg administered once every two weeks is required to maintain a C trough of about 100 ⁇ g/mL.
  • a flat dose of about 1200 mg once every two weeks is equivalent to 1800 mg once every three weeks, while for C trough , 1200 mg once every two weeks is equivalent to 2800 mg once every three weeks.
  • TGF as a Cancer Target
  • TGF RII soluble cytokine receptor
  • An example of an antibody moiety of the disclosure to an immune checkpoint protein is anti-PD-L1.
  • This bifunctional molecule sometimes referred to in this document as an“antibody-cytokine Trap,” is effective precisely because the anti-receptor antibody and cytokine Trap are physically linked.
  • the resulting advantage (over, for example, administration of the antibody and the receptor as separate molecules) is partly because cytokines function predominantly in the local environment through autocrine and paracrine functions.
  • the antibody moiety directs the cytokine Trap to the tumor microenvironment where it can be most effective, by neutralizing the local immunosuppressive autocrine or paracrine effects. Furthermore, in cases where the target of the antibody is internalized upon antibody binding, an effective mechanism for clearance of the cytokine/cytokine receptor complex is provided. Antibody-mediated target internalization was shown for PD-L1, and anti-PD-L1/TGF Trap was shown to have a similar internalization rate as anti-PD-L1. This is a distinct advantage over using an anti-TGF antibody because first, an anti-TGF antibody might not be completely neutralizing; and second, the antibody can act as a carrier extending the half-life of the cytokine.
  • This depletion is achieved by (1) anti-PD-L1 targeting of tumor cells; (2) binding of the TGF autocrine/paracrine in the tumor microenvironment by the TGF Trap; and (3) destruction of the bound TGF through the PD-L1 receptor-mediated endocytosis.
  • TGF RII fused to the C-terminus of Fc fragment of crystallization of IgG was several-fold more potent than the TGF RII-Fc that places the TGF RII at the N-terminus of Fc.
  • TGF had been a somewhat questionable target in cancer immunotherapy because of its paradoxical roles as the molecular Jekyll and Hyde of cancer (Bierie et al., Nat. Rev.
  • TGF activity is developmental stage and context dependent. Indeed TGF can act as either a tumor promoter or a tumor suppressor, affecting tumor initiation, progression and metastasis.
  • the mechanisms underlying this dual role of TGF remain unclear (Yang et al., Trends Immunol.2010; 31:220–227).
  • Smad-dependent signaling mediates the growth inhibition of TGF signaling, while the Smad independent pathways contribute to its tumor-promoting effect, there are also data showing that the Smad-dependent pathways are involved in tumor progression (Yang et al., Cancer Res.2008; 68:9107-11).
  • TGF RI is the signaling chain and cannot bind ligand.
  • TGF RII binds the ligand TGF 1 and 3, but not TGF 2, with high affinity. The TGF RII/TGF complex recruits TGF RI to form the signaling complex (Won et al., Cancer Res.
  • TGF RIII is a positive regulator of TGF binding to its signaling receptors and binds all 3 TGF isoforms with high affinity. On the cell surface, the TGF /TGF RIII complex binds TGF RII and then recruits TGF RI, which displaces
  • TGF RIII to form the signaling complex.
  • the three different TGF- isoform knockout mice have distinct phenotypes, indicating numerous non-compensated functions (Bujak et al., Cardiovasc Res. 2007; 74:184-95). While TGF 1 null mice have hematopoiesis and vasculogenesis defects and TGF 3 null mice display pulmonary development and defective palatogenesis, TGF 2 null mice show various developmental abnormalities, the most prominent being multiple cardiac deformities (Bartram et al., Circulation. 2001; 103:2745-52; Yamagishi et al., Anat Rec. 2012; 295:257-67).
  • TGF is implicated to play a major role in the repair of myocardial damage after ischemia and reperfusion injury.
  • cardiomyocytes secrete TGF , which acts as an autocrine to maintain the spontaneous beating rate.
  • TGF 2 70-85% of the TGF secreted by cardiomyocytes is TGF 2 (Roberts et al., J Clin Invest.1992; 90:2056-62).
  • TGF RI kinase inhibitors present applicants have observed a lack of toxicity, including cardiotoxicity, for anti-PD-L1/TGF Trap in monkeys.
  • TGF RIII may seem the obvious choice since it binds all the three TGF ligands.
  • TGF RIII which occurs naturally as a 280-330 kD glucosaminoglycan (GAG)-glycoprotein, with extracellular domain of 762 amino acid residues, is a very complex protein for biotherapeutic development.
  • GAG glucosaminoglycan
  • the soluble TGF RIII devoid of GAG could be produced in insect cells and shown to be a potent TGF neutralizing agent (Vilchis-Landeros et al, Biochem J 355:215, 2001).
  • TGF RIII The two separate binding domains (the endoglin-related and the uromodulin-related) of TGF RIII could be independently expressed, but they were shown to have affinities 20 to 100 times lower than that of the soluble TGF RIII, and much diminished neutralizing activity (Mendoza et al., Biochemistry. 2009; 48:11755-65).
  • the extracellular domain of TGF RII is only 136 amino acid residues in length and can be produced as a glycosylated protein of 25-35 kD.
  • the recombinant soluble TGF RII was further shown to bind TGF 1 with a K D of 200 pM, which is fairly similar to the K D of 50 pM for the full length TGF RII on cells (Lin et al., J Biol Chem.1995; 270:2747-54). Soluble TGF RII-Fc was tested as an anti-cancer agent and was shown to inhibit established murine malignant mesothelioma growth in a tumor model (Suzuki et al., Clin. Cancer Res., 2004; 10:5907-18).
  • TGF RII does not bind TGF 2
  • TGF RIII binds TGF 1 and 3 with lower affinity than TGF RII
  • a fusion protein of the endoglin domain of TGF RIII and extracellular domain of TGF RII was produced in bacteria and was shown to inhibit the signaling of TGF 1 and 2 in cell based assays more effectively than either TGF RII or RIII (Verona et al., Protein Eng Des Sel.2008; 21:463-73).
  • Still another approach to neutralize all three isoforms of the TGF ligands is to screen for a pan-neutralizing anti-TGF antibody, or an anti-receptor antibody that blocks the receptor from binding to TGF 1, 2 and 3.
  • GC1008 a human antibody specific for all isoforms of TGF , was in a Phase I/II study in patients with advanced malignant melanoma or renal cell carcinoma (Morris et al., J Clin Oncol 2008; 26:9028 (Meeting abstract)). Although the treatment was found to be safe and well tolerated, only limited clinical efficacy was observed, and hence it was difficult to interpret the importance of anti-TGF therapy without further characterization of the immunological effects (Flavell et al., Nat Rev Immunol.2010; 10:554- 67). There were also TGF -isoform-specific antibodies tested in the clinic.
  • Metelimumab an antibody specific for TGF 1 was tested in Phase 2 clinical trial as a treatment to prevent excessive post-operative scarring for glaucoma surgery; and Lerdelimumab, an antibody specific for TGF 2, was found to be safe but ineffective at improving scarring after eye surgery in a Phase 3 study (Khaw et al., Ophthalmology 2007; 114:1822–1830).
  • Anti-TGF RII antibodies that block the receptor from binding to all the three TGF isoforms have also shown some therapeutic efficacy against primary tumor growth and metastasis in mouse models (Zhong et al., Clin Cancer Res.2010; 16:1191-205).
  • TGF RII antibody TR1 anti-mouse TGF RII antibody MT1
  • LY3022859 Phase I study of antibody TR1
  • dose escalation beyond 25 mg was considered unsafe due to uncontrolled cytokine release, despite prophylactic treatment (Tolcher et al., Cancer Chemother Pharmacol 2017; 79:673-680).
  • the antibody-TGF Trap of the disclosure is a bifunctional protein containing at least portion of a human TGF Receptor II (TGF RII) that is capable of binding TGF .
  • the TGF Trap polypeptide is a soluble portion of the human TGF Receptor Type 2 Isoform A (SEQ ID NO: 8) that is capable of binding TGF .
  • TGF Trap polypeptide contains at least amino acids 73-184 of SEQ ID NO: 8.
  • the TGF Trap polypeptide contains amino acids 24-184 of SEQ ID NO: 8.
  • the TGF Trap polypeptide is a soluble portion of the human TGF Receptor Type 2 Isoform B (SEQ ID NO: 9) that is capable of binding TGF .
  • the TGF Trap polypeptide contains at least amino acids 48-159 of SEQ ID NO: 9.
  • the TGF Trap polypeptide contains amino acids 24-159 of SEQ ID NO: 9. In certain embodiments, the TGF Trap polypeptide contains amino acids 24-105 of SEQ ID NO: 9. In certain exemplary embodiments, the TGF Trap polypeptide contains the sequence of SEQ ID NOs: 10, 50, 51, 52, 53, or 54. [0075] In another embodiment, the antibody-TGF Trap of the disclosure is one of the fusion proteins disclosed in WO 2018/205985. In some embodiments, the fusion protein is one of the constructs listed in Table 2 of this publication, such as construct 9 or 15 thereof.
  • the antibody having the heavy chain sequence of SEQ ID NO: 11 and the light chain sequence of SEQ ID NO: 12 of this publication is fused via a linking sequence (G 4 S) x G, wherein x is 4-5, to the TGF RII extracellular domain sequence of SEQ ID NO: 14 or SEQ ID NO: 15 of said publication [corresponding to SEQ ID NO: 50 and 51, respectively, of the present disclosure].
  • G 4 S linking sequence
  • x is 4-5
  • the antibody moiety or antigen binding fragment thereof targets T cell inhibition checkpoint receptor proteins on the T cell, such as, for example: CTLA-4, PD-1, BTLA, LAG-3, TIM-3, or LAIR1.
  • the antibody moiety targets the counter-receptors on antigen presenting cells and tumor cells (which co-opt some of these counter-receptors for their own immune evasion), such as for example: PD-L1 (B7-H1), B7-DC, HVEM, TIM-4, B7-H3, or B7-H4.
  • the disclosure contemplates antibody TGF Traps that target, through their antibody moiety or antigen binding fragment thereof, T cell inhibition checkpoints for dis-inhibition.
  • the programmed death 1 (PD-1)/PD-L1 axis is an important mechanism for tumor immune evasion. Effector T cells chronically sensing antigen take on an exhausted phenotype marked by PD-1 expression, a state under which tumor cells engage by upregulating PD-L1. Additionally, in the tumor microenvironment, myeloid cells, macrophages, parenchymal cells and T cells upregulate PD-L1. Blocking the axis restores the effector function in these T cells.
  • TGF 1, 2, and 3 isoforms
  • TGF is an inhibitory cytokine produced in the tumor microenvironment by cells including apoptotic neutrophils, myeloid- derived suppressor cells, T cells and tumor.
  • Inhibition of TGF by soluble TGF RII reduced malignant mesothelioma in a manner that was associated with increases in CD8+ T cell anti- tumor effects.
  • the absence of TGF 1 produced by activated CD4+ T cells and Treg cells has been shown to inhibit tumor growth, and protect mice from spontaneous cancer. Thus, TGF appears to be important for tumor immune evasion.
  • TGF has growth inhibitory effects on normal epithelial cells, functioning as a regulator of epithelial cell homeostasis, and it acts as a tumor suppressor during early carcinogenesis. As tumors progress toward malignancy, the growth inhibitory effects of TGF on the tumor are lost via mutation in one or more TGF pathway signaling components or through oncogenic reprogramming. Upon loss of sensitivity to TGF inhibition, the tumor continues to produce high levels of TGF , which then serve to promote tumor growth. The TGF cytokine is overexpressed in various cancer types with correlation to tumor stage.
  • TGF tumor growth factor
  • TGF signaling contributes to tumor progression by promoting metastasis, stimulating angiogenesis, and suppressing innate and adaptive anti-tumor immunity.
  • TGF directly down-regulates the effector function of activated cytotoxic T cells and NK cells and potently induces the differentiation of na ⁇ ve CD4+ T cells to the immunosuppressive regulatory T cells (Treg) phenotype.
  • TGF polarizes macrophages and neutrophils to a wound-healing phenotype that is associated with production of immunosuppressive cytokines.
  • neutralization of TGF activity has the potential to control tumor growth by restoring effective anti-tumor immunity, blocking metastasis, and inhibiting angiogenesis.
  • Combining these pathways, PD-1 or PD-L1, and TGF is attractive as an antitumor approach. Concomitant PD-1 and TGF blockade can restore pro-inflammatory cytokines.
  • Anti-PD-L1/TGF Trap includes, for example, an extracellular domain of the human TGF receptor TGF RII covalently joined via a glycine/serine linker to the C terminus of each heavy chain of the fully human IgG1 anti-PD-L1 antibody.
  • TGF-targeting agent fresolimumab, which is a monoclonal antibody targeting TGF 1, 2 and 3, showed initial evidence of tumor response in a Phase I trial in subjects with melanoma.
  • the present disclosure provides experiments, which demonstrated that the TGF RII portion of anti-PD-L1/TGF Trap (the Trap control“anti-PDL- 1(mut)/ TGF Trap”) elicited antitumor activity.
  • the Trap control“anti-PDL- 1(mut)/ TGF Trap” elicited antitumor activity.
  • anti-PDL-1(mut)/ TGF Trap elicited a dose-dependent reduction in tumor volume when administered at 25 ⁇ g, 76 ⁇ g, or 228 ⁇ g (FIG. 5).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure simultaneously bound to both PD-L1 and TGF (FIG. 2).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure (e.g. anti-PD-L1/TGF Trap) inhibited PD-L1 and TGF dependent signaling in vitro.
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure enhanced T cell effector function in vitro via blockade of PD-L1-mediated immune inhibition as measured by an IL-2 induction assay following superantigen stimulation (FIG.3).
  • FOG.3 superantigen stimulation
  • the protein of the present disclosure induced a dramatic increase in IL-2 levels in vitro (FIG. 3).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure (e.g.
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure occupied the PD-L1 target, supporting the notion that that the protein of the present disclosure fit to a receptor binding model in the EMT-6 tumor system (FIG. 4D). [0085] In certain embodiments, the present disclosure provides experiments, which demonstrated that the protein of the present disclosure efficiently, specifically, and
  • PD-L1/TGF Trap molecule intravenously administered at 5 dose levels of about 0.3, about 1, about 3, about 10, or about 20 mg/kg once every two weeks, PK analyses were performed from samples for up to day 85.
  • PD-L1 target occupancy was measured in CD3+ PBMCs by flow cytometry from patient blood collected at pre-dose, Day 2 (D2), D15, and D43. Further, the blood levels of TGFb1-3 and pro- inflammatory cytokines were measured at these time points with an additional time point at D8 using analytically validated Luminex bead- and ECLIA-based multiplex immunoassays.
  • patients can be treated with anti-PD-L1/TGF Trap molecule intravenously administered at 6 dose levels, including the ones described above, at a dose of about 30 mg/kg or about 40 mg/kg every two weeks.
  • PK analyses of patients treated at 6 dose levels may be performed from samples for up to after the 6 th dose.
  • PD-L1 target occupancy may also be measured in CD3+ PBMCs by flow cytometry from patient blood collected at pre-dose, Day 2 (D2), D15, D43, and up to D85.
  • Anti-PD-L1 Antibodies can include any anti-PD-L1 antibody, or antigen-binding fragment thereof, described in the art.
  • Anti-PD-L1 antibodies are commercially available, for example, the 29E2A3 antibody (Biolegend, Cat. No. 329701).
  • Antibodies can be monoclonal, chimeric, humanized, or human.
  • Antibody fragments include Fab, F(ab’)2, scFv and Fv fragments, which are described in further detail below.
  • Exemplary antibodies are described in PCT Publication WO 2013/079174.
  • These antibodies can include a heavy chain variable region polypeptide including an HVR-H1, HVR- H2, and HVR-H3 sequence, where: (a) the HVR-H1 sequence is X 1 YX 2 MX 3 (SEQ ID NO: 21); (b) the HVR-H2 sequence is SIYPSGGX 4 TFYADX 5 VKG (SEQ ID NO: 22); (c) the HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO: 23); further where: X 1 is K, R, T, Q, G, A, W, M, I, or S; X 2 is V, R, K, L, M, or I; X 3 is H, T, N, Q, A, V, Y, W, F, or M; X 4 is F or I; X 5 is S or T; X 6 is E or D.
  • X 1 is M, I, or S; X 2 is R, K, L, M, or I; X 3 is F or M; X 4 is F or I; X 5 is S or T; X 6 is E or D.
  • X 1 is M, I, or S; X 2 is L, M, or I; X 3 is F or M; X 4 is I; X 5 is S or T; X 6 is D.
  • the polypeptide further includes variable region heavy chain framework sequences juxtaposed between the HVRs according to the formula: (HC-FR1)- (HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)-(HC-FR4).
  • the framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24);
  • HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26);
  • HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the heavy chain polypeptide is further combined with a variable region light chain including an HVR-L1, HVR-L2, and HVR-L3, where: (a) the HVR-L1 sequence is TGTX 7 X 8 DVGX 9 YNYVS (SEQ ID NO: 28); (b) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO: 29); (c) the HVR-L3 sequence is SSX13TX14X15X16X17RV (SEQ ID NO: 30); further where: X 7 is N or S; X 8 is T, R, or S; X 9 is A or G; X 10 is E or D; X 11 is I, N or S; X 12 is D, H or N; X 13 is F or Y; X 14 is N or S; X 15 is R, T or S; X 16 is G or S; X 17 is I or T.
  • HVR-L1 sequence is TGTX 7 X 8 DVGX
  • the light chain further includes variable region light chain framework sequences juxtaposed between the HVRs according to the formula: (LC- FR1MHVR-L1)-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the light chain framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • the light chain framework sequences are lambda light chain sequences.
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31); LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32); LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34).
  • the disclosure provides an anti-PD-L1 antibody or antigen binding fragment including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, HVR-H2, and HVR-H3, wherein further: (i) the HVR-H1 sequence is X 1 YX 2 MX 3 (SEQ ID NO: 21); (ii) the HVR-H2 sequence is
  • the light chain includes an HVR-L1, HVR-L2, and HVR-L3, wherein further: (iv) the HVR-L1 sequence is TGTX 7 X 8 DVGX 9 YNYVS (SEQ ID NO: 28); (v) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO: 29); (vi) the HVR-L3 sequence is
  • X 1 is K, R, T, Q, G, A, W, M, I, or S
  • X 2 is V, R, K, L, M, or I
  • X 3 is H, T, N, Q, A, V, Y, W, F, or M
  • X 4 is F or I
  • X 5 is S or T
  • X 6 is E or D
  • X 7 is N or S
  • X 8 is T, R, or S
  • X 9 is A or G
  • X 10 is E or D
  • X 11 is I, N, or S
  • X 12 is D, H, or N
  • X 13 is F or Y
  • X 14 is N or S
  • X 15 is R, T, or S
  • X 16 is G or S
  • X 17 is I or T.
  • X 1 is M, I, or S;
  • X 2 is R, K, L, M, or I;
  • X 3 is F or M;
  • X 4 is F or I;
  • X 5 is S or T;
  • X 6 is E or D;
  • X 7 is N or S;
  • X 8 is T, R, or S;
  • X 9 is A or G;
  • X 10 is E or D;
  • X 11 is N or S;
  • X 12 is N;
  • X 13 is F or Y;
  • X 14 is S;
  • X 15 is S;
  • X 16 is G or S;
  • X 17 is T.
  • X 1 is M, I, or S;
  • X 2 is L, M, or I;
  • X 3 is F or M;
  • X 4 is I;
  • X 5 is S or T;
  • X 6 is D;
  • X 7 is N or S;
  • X 8 is T, R, or S;
  • X 9 is A or G;
  • X 10 is E or D;
  • X 11 is N or S;
  • X 12 is N;
  • X 13 is F or Y;
  • X 14 is S;
  • X 15 is S;
  • X 16 is G or S;
  • X 17 is T.
  • the heavy chain variable region includes one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC- FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions include one or more framework sequences juxtaposed between the HVRs as: (LC-FR1 MHVR-L1 )-(LC-FR2)- (HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the framework sequences are derived from human consensus framework sequences or human germline sequences.
  • one or more of the heavy chain framework sequences is the following:
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24);
  • HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26); HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the light chain framework sequences are lambda light chain sequences.
  • one or more of the light chain framework sequences is the following:
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31);
  • LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32);
  • LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34).
  • the heavy chain variable region polypeptide, antibody, or antibody fragment further includes at least a C H 1 domain.
  • the heavy chain variable region polypeptide, antibody, or antibody fragment further includes a C H 1, a C H 2, and a C H 3 domain.
  • variable region light chain, antibody, or antibody fragment further includes a C L domain.
  • the antibody further includes a C H 1, a C H 2, a C H 3, and a C L domain.
  • the antibody further includes a human or murine constant region.
  • the human constant region is selected from the group consisting of IgG1, IgG2, IgG2, IgG3, IgG4.
  • the human or murine constant region is lgG1.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGITFYADTVKG (SEQ ID NO: 36), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, and (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 38), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGITFYADTVKG (SEQ ID NO:
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO: 41), SIYPSGGITFYADSVKG (SEQ ID NO: 42), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, and (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGAYNYVS (SEQ ID NO: 43), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO: 41), SIYPSGGITFYADSVKG (SEQ ID NO:
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • the heavy chain variable region includes one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC- FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions include one or more framework sequences juxtaposed between the HVRs as: (LC-FR1)-(HVR-L1)-(LC-FR2)- (HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the framework sequences are derived from human germline sequences.
  • one or more of the heavy chain framework sequences is the following: HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24); HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25); HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26); HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the light chain framework sequences are derived from a lambda light chain sequence.
  • one or more of the light chain framework sequences is the following: LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31); LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32); LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34).
  • the antibody further includes a human or murine constant region.
  • the human constant region is selected from the group consisting of IgG1, IgG2, IgG2, IgG3, IgG4.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMVWRQAPGKGLEWVSSIYPSGGITF YADWKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLV TVSS (SEQ ID NO: 44), and (b) the light chain sequence has at least 85% sequence identity to the light chain sequence: QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSN RPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 45; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 45; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 45; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 45; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 90% sequence identity to SEQ ID NO:45; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 44 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 45; the heavy chain sequence has at least 92% sequence identity to SEQ ID NO: 44 and
  • the disclosure provides for an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSMYMMMWVRQAPGKGLEVWSSIYPSGGI TFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARIKLGTVTTVDYWG QGTLVTVSS (SEQ ID NO: 46), and (b) the light chain sequence has at least 85% sequence identity to the light chain sequence: QSALTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQQHPGKAPKLMIYDVSNR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVL (SEQ ID NO: 47).
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 47; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 47; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 47; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 47; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 90% sequence identity to SEQ ID NO:47; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 46 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 47; the heavy chain sequence has at least 92% sequence identity to SEQ ID NO: 46 and
  • the antibody binds to human, mouse, or cynomolgus monkey PD-L1.
  • the antibody is capable of blocking the interaction between human, mice, or cynomolgus monkey PD-L1 and the respective human, mouse, or cynomolgus monkey PD-1 receptors.
  • the antibody binds to human PD-L1 with a KD of 5x10 -9 M or less, preferably with a KD of 2x10 -9 M or less, and even more preferred with a KD of 1x10 -9 M or less.
  • the disclosure relates to an anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope including residues Y56 and D61 of human PD-L1.
  • the functional epitope further includes E58, E60, Q66, R113, and M115 of human PD-L1.
  • the antibody binds to a conformational epitope, including residues 54-66 and 112-122 of human PD-L1.
  • the disclosure is related to an anti-PD-L1 antibody, or antigen binding fragment thereof, which cross-competes for binding to PD-L1 with an antibody according to the disclosure as described herein.
  • the disclosure features proteins and polypeptides including any of the above described anti-PD-L1 antibodies in combination with at least one
  • the disclosure features an isolated nucleic acid encoding a polypeptide, or light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, or antigen binding fragment thereof, as described herein.
  • the disclosure provides for an isolated nucleic acid encoding a light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, wherein: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGITFYADTVKG (SEQ ID NO: 36), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, or (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 38), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGIT
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • nucleic acid sequence for the heavy chain is:
  • nucleic acid sequence for the light chain is:
  • the disclosure features an anti-PD-L1 antibody moiety including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least87% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least89% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 12 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 92% sequence identity to SEQ ID NO: 12 and
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 14 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 13; the heavy chain sequence has at least 92% sequence identity to SEQ ID NO: 14 and
  • anti-PD-L1 antibodies that can be used in an anti-PD-L1/TGF Trap are described in US patent application publication US 2018/0334504.
  • the disclosure features an anti-PD-L1 antibody moiety including a heavy chain and a light chain variable region sequence, where (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 55 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 56; the heavy chain sequence has at least 92% sequence identity to SEQ ID NO: 55 and
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 57 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 58; the heavy chain sequence has at least
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 59 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 60; the heavy chain sequence has at least 92% sequence identity to S
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the heavy chain sequence has at least 86% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 86% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least 87% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 87% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least 88% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 88% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least 89% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 89% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least, 90% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 90% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least 91% sequence identity to SEQ ID NO: 61 and the light chain sequence has at least 91% sequence identity to SEQ ID NO: 62; the heavy chain sequence has at least
  • anti-PD-L1 antibodies that can be used in an anti-PD- L1/TGF Trap are described in US patent publication US 7,943,743.
  • the anti-PD-L1 antibody is MDX-1105.
  • the anti-PD-L1 antibody is MEDI-4736.
  • Constant Region The proteins and peptides of the disclosure can include a constant region of an immunoglobulin or a fragment, analog, variant, mutant, or derivative of the constant region.
  • the constant region is derived from a human immunoglobulin heavy chain, for example, IgG1, IgG2, IgG3, IgG4, or other classes.
  • the constant region includes a CH2 domain. In certain embodiments, the constant region includes CH2 and CH3 domains or includes hinge-CH2-CH3. Alternatively, the constant region can include all or a portion of the hinge region, the CH2 domain and/or the CH3 domain. [0165] In one embodiment, the constant region contains a mutation that reduces affinity for an Fc receptor or reduces Fc effector function. For example, the constant region can contain a mutation that eliminates the glycosylation site within the constant region of an IgG heavy chain.
  • the constant region contains mutations, deletions, or insertions at an amino acid position corresponding to Leu234, Leu235, Gly236, Gly237, Asn297, or Pro331 of IgG1 (amino acids are numbered according to EU nomenclature).
  • the constant region contains a mutation at an amino acid position corresponding to Asn297 of IgG1.
  • the constant region contains mutations, deletions, or insertions at an amino acid position corresponding to Leu281, Leu282, Gly283, Gly284, Asn344, or Pro378 of IgG1.
  • the constant region contains a CH2 domain derived from a human IgG2 or IgG4 heavy chain.
  • the CH2 domain contains a mutation that eliminates the glycosylation site within the CH2 domain.
  • the mutation alters the asparagine within the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence within the CH2 domain of the IgG2 or IgG4 heavy chain.
  • the mutation changes the asparagine to a glutamine.
  • the mutation alters both the phenylalanine and the asparagine within the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence.
  • the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence is replaced with a Gln-Ala-Gln-Ser (SEQ ID NO: 16) amino acid sequence.
  • the asparagine within the Gln-Phe- Asn-Ser (SEQ ID NO: 15) amino acid sequence corresponds to Asn297 of IgG1.
  • the constant region includes a CH2 domain and at least a portion of a hinge region.
  • the hinge region can be derived from an immunoglobulin heavy chain, e.g., IgG1, IgG2, IgG3, IgG4, or other classes.
  • the hinge region is derived from human IgG1, IgG2, IgG3, IgG4, or other suitable classes. More preferably the hinge region is derived from a human IgG1 heavy chain.
  • the cysteine in the Pro- Lys-Ser-Cys-Asp-Lys (SEQ ID NO: 17) amino acid sequence of the IgG1 hinge region is altered.
  • the Pro-Lys-Ser-Cys-Asp-Lys (SEQ ID NO: 17) amino acid sequence is replaced with a Pro-Lys-Ser-Ser-Asp-Lys (SEQ ID NO: 18) amino acid sequence.
  • the constant region includes a CH2 domain derived from a first antibody isotype and a hinge region derived from a second antibody isotype.
  • the CH2 domain is derived from a human IgG2 or IgG4 heavy chain, while the hinge region is derived from an altered human IgG1 heavy chain.
  • the junction region of a protein or polypeptide of the present disclosure can contain alterations that, relative to the naturally-occurring sequences of an immunoglobulin heavy chain and erythropoietin, preferably lie within about 10 amino acids of the junction point. These amino acid changes can cause an increase in hydrophobicity.
  • the constant region is derived from an IgG sequence in which the C-terminal lysine residue is replaced.
  • the C-terminal lysine of an IgG sequence is replaced with a non-lysine amino acid, such as alanine or leucine, to further increase serum half-life.
  • the constant region is derived from an IgG sequence in which the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence near the C-terminus of the constant region is altered to eliminate potential junctional T-cell epitopes.
  • the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence is replaced with an Ala-Thr-Ala-Thr (SEQ ID NO: 20) amino acid sequence.
  • the amino acids within the Leu-Ser-Leu-Ser (SEQ ID NO: 19) segment are replaced with other amino acids such as glycine or proline.
  • Suitable hinge regions for the present disclosure can be derived from IgG1, IgG2, IgG3, IgG4, and other immunoglobulin classes.
  • the IgG1 hinge region has three cysteines, two of which are involved in disulfide bonds between the two heavy chains of the immunoglobulin.
  • a hinge region of the present disclosure is derived from IgG1, e.g., human IgG1.
  • the first cysteine within the human IgG1 hinge region is mutated to another amino acid, preferably serine.
  • the IgG2 isotype hinge region has four disulfide bonds that tend to promote oligomerization and possibly incorrect disulfide bonding during secretion in recombinant systems.
  • a suitable hinge region can be derived from an IgG2 hinge; the first two cysteines are each preferably mutated to another amino acid.
  • the hinge region of IgG4 is known to form interchain disulfide bonds inefficiently.
  • a suitable hinge region for the present disclosure can be derived from the IgG4 hinge region, preferably containing a mutation that enhances correct formation of disulfide bonds between heavy chain- derived moieties (Angal S, et al. (1993) Mol. Immunol., 30:105-8).
  • the constant region can contain CH2 and/or CH3 domains and a hinge region that are derived from different antibody isotypes, i.e., a hybrid constant region.
  • the constant region contains CH2 and/or CH3 domains derived from IgG2 or IgG4 and a mutant hinge region derived from IgG1.
  • a mutant hinge region from another IgG subclass is used in a hybrid constant region.
  • a mutant form of the IgG4 hinge that allows efficient disulfide bonding between the two heavy chains can be used.
  • a mutant hinge can also be derived from an IgG2 hinge in which the first two cysteines are each mutated to another amino acid. Assembly of such hybrid constant regions has been described in U.S. Patent Publication No. 20030044423, the disclosure of which is hereby incorporated by reference.
  • the constant region can contain one or more mutations described herein. The combinations of mutations in the Fc portion can have additive or synergistic effects on the prolonged serum half-life and increased in vivo potency of the bifunctional molecule.
  • the constant region can contain (i) a region derived from an IgG sequence in which the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence is replaced with an Ala-Thr-Ala-Thr (SEQ ID NO: 20) amino acid sequence; (ii) a C-terminal alanine residue instead of lysine; (iii) a CH2 domain and a hinge region that are derived from different antibody isotypes, for example, an IgG2 CH2 domain and an altered IgG1 hinge region; and (iv) a mutation that eliminates the glycosylation site within the IgG2-derived CH2 domain, for example, a Gln-Ala-Gln-Ser (SEQ ID NO: 16) amino acid sequence instead of the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence within the IgG2-derived CH2 domain.
  • the proteins and polypeptides of the disclosure can also include antigen-binding fragments of antibodies.
  • Exemplary antibody fragments include scFv, Fv, Fab, F(ab’) 2 , and single domain VHH fragments such as those of camelid origin.
  • Single-chain antibody fragments also known as single-chain antibodies (scFvs) are recombinant polypeptides which typically bind antigens or receptors; these fragments contain at least one fragment of an antibody variable heavy-chain amino acid sequence (V H ) tethered to at least one fragment of an antibody variable light-chain sequence (V L ) with or without one or more interconnecting linkers.
  • Such a linker may be a short, flexible peptide selected to assure that the proper three-dimensional folding of the V L and V H domains occurs once they are linked so as to maintain the target molecule binding-specificity of the whole antibody from which the single-chain antibody fragment is derived.
  • the carboxyl terminus of the V L or V H sequence is covalently linked by such a peptide linker to the amino acid terminus of a complementary V L and V H sequence.
  • Single-chain antibody fragments can be generated by molecular cloning, antibody phage display library or similar techniques. These proteins can be produced either in eukaryotic cells or prokaryotic cells, including bacteria.
  • Single-chain antibody fragments contain amino acid sequences having at least one of the variable regions or CDRs of the whole antibodies described in this specification, but are lacking some or all of the constant domains of those antibodies. These constant domains are not necessary for antigen binding, but constitute a major portion of the structure of whole antibodies. Single-chain antibody fragments may therefore overcome some of the problems associated with the use of antibodies containing part or all of a constant domain. For example, single-chain antibody fragments tend to be free of undesired interactions between biological molecules and the heavy-chain constant region, or other unwanted biological activity.
  • single-chain antibody fragments are considerably smaller than whole antibodies and may therefore have greater capillary permeability than whole antibodies, allowing single- chain antibody fragments to localize and bind to target antigen-binding sites more efficiently.
  • antibody fragments can be produced on a relatively large scale in prokaryotic cells, thus facilitating their production.
  • the relatively small size of single-chain antibody fragments makes them less likely than whole antibodies to provoke an immune response in a recipient.
  • Fragments of antibodies that have the same or comparable binding characteristics to those of the whole antibody may also be present. Such fragments may contain one or both Fab fragments or the F(ab’) 2 fragment.
  • compositions may contain all six CDRs of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five CDRs, are also functional.
  • Pharmaceutical Compositions [0176] The present disclosure also features pharmaceutical compositions that contain a therapeutically effective amount of a protein described herein.
  • the composition can be formulated for use in a variety of drug delivery systems.
  • One or more physiologically acceptable excipients or carriers can also be included in the composition for proper formulation. Suitable formulations for use in the present disclosure are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985.
  • Langer Science 249:1527-1533, 1990).
  • the present disclosure provides an intravenous drug delivery formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient that includes 500 mg– 2400 mg of a protein including a first polypeptide and a second polypeptide
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor Receptor II (TGF RII), or a fragment thereof, capable of binding Transforming Growth Factor (TGF )
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, and the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • a protein product of the present disclosure includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • a protein product of the present disclosure includes a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40.
  • the intravenous drug delivery formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 500 mg to about 2400 mg dose (e.g., about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg, about 500 mg to about 1600 mg, about 500 mg to about 1500 mg, about 500 mg to about 1400 mg, about 500 mg to about 1300 mg, about 500 mg to about 1200 mg, about 500 mg to about 1100 mg, about 500 mg to about 1000 mg, about 500 mg to about 900 mg, about 500 mg to about 800 mg, about 500 mg to about 700 mg, about 500 mg to about 600 mg, about 600 mg to 2400 mg, about 700 mg to 2400 mg, about 800 mg to 2400 mg, about 500 mg to about 700 mg, about 500
  • the intravenous drug delivery formulation may include about 500 to about 2000 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 500 mg dose of a protein product of the present disclosure with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include 500 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 1200 mg dose of a protein product of the present disclosure with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 2400 mg dose of a protein product of the present disclosure with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include 2400 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • a protein of the present disclosure e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include 2400 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide comprising the amino acid sequences of SEQ ID NOs: 38, 39, and 40)).
  • a protein of the present disclosure e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide comprising the amino acid sequences of SEQ ID NOs: 38, 39, and 40)).
  • the intravenous drug delivery formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg
  • the intravenous drug delivery formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 3000
  • the intravenous drug delivery formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, about 1500 mg
  • the intravenous drug delivery formulation of the present disclosure for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may be contained in a bag, a pen, or a syringe.
  • the bag may be connected to a channel comprising a tube and/or a needle.
  • the formulation may be a lyophilized formulation or a liquid formulation.
  • the formulation may be freeze-dried (lyophilized) and contained in about 12-60 vials.
  • the formulation may be freeze-dried and about 45 mg of the freeze-dried formulation may be contained in one vial.
  • the about 40 mg– about 100 mg of freeze-dried formulation may be contained in one vial.
  • freeze dried formulation from 12, 27, or 45 vials are combined to obtained a therapeutic dose of the protein in the intravenous drug formulation.
  • the formulation may be a liquid formulation of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40, and stored as about 250 mg/vial to about 2000 mg/vial (e.g., about 250 mg/vial to about 2000 mg/vial, about 250 mg/vial to about 1900 mg/vial, about 250 mg/vial to about 1800 mg/vial, about 250 mg/vial to about
  • the formulation may be a liquid formulation and stored as about 600 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 1200 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 1800 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 250 mg/vial.
  • This disclosure provides a liquid aqueous pharmaceutical formulation including a therapeutically effective amount of the protein of the present disclosure (e.g., anti-PD-L1/TGF Trap) in a buffered solution forming a formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient.
  • a treatment na ⁇ ve cancer e.g., NSCLC with high PD-L1 expression
  • These compositions for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may be sterilized by conventional sterilization techniques, or may be sterile filtered.
  • the resulting aqueous solutions may be packaged for use as-is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
  • the pH of the preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 7 and 8, such as 7 to 7.5.
  • the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents.
  • the composition in solid form can also be packaged in a container for a flexible quantity.
  • the present disclosure provides for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient, a formulation with an extended shelf life including a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)), in combination with mannitol, citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.
  • a protein of the present disclosure e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)
  • an aqueous formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient is prepared including a protein of the present disclosure (e.g., anti-PD- L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40) in a pH-buffered solution.
  • a protein of the present disclosure e.g., anti-PD- L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the
  • the buffer of this invention may have a pH ranging from about 4 to about 8, e.g., from about 4 to about 8, from about 4.5 to about 8, from about 5 to about 8, from about 5.5 to about 8, from about 6 to about 8, from about 6.5 to about 8, from about 7 to about 8, from about 7.5 to about 8, from about 4 to about 7.5, from about 4.5 to about 7.5, from about 5 to about about 7.5, from about 5.5 to about 7.5, from about 6 to about 7.5, from about 6.5 to about 7.5, from about 4 to about 7, from about 4.5 to about 7, from about 5 to about 7, from about 5.5 to about 7, from about 6 to about 7, from about 4 to about 6.5, from about 4.5 to about 6.5, from about 5 to about 6.5, from about 5.5 to about 6.5, from about 4 to about 6.0, from about 4.5 to about 6.0, from about 5 to about 6, or from about 4.8 to about 5.5, or may have a pH of about 5.0 to about 5.2.
  • Ranges intermediate to the above recited pH's are also intended to be part of this disclosure. For example, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included.
  • buffers that will control the pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers.
  • the formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient includes a buffer system which contains citrate and phosphate to maintain the pH in a range of about 4 to about 8.
  • the pH range may be from about 4.5 to about 6.0, or from about pH 4.8 to about 5.5, or in a pH range of about 5.0 to about 5.2.
  • the buffer system includes citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, and/or sodium dihydrogen phosphate dihydrate.
  • the buffer system includes about 1.3 mg/ml of citric acid (e.g., 1.305 mg/ml), about 0.3 mg/ml of sodium citrate (e.g., 0.305 mg/ml), about 1.5 mg/ml of disodium phosphate dihydrate (e.g., 1.53 mg/ml), about 0.9 mg/ml of sodium dihydrogen phosphate dihydrate (e.g., 0.86), and about 6.2 mg/ml of sodium chloride (e.g., 6.165 mg/ml).
  • citric acid e.g., 1.305 mg/ml
  • sodium citrate e.g. 0.305 mg/ml
  • 1.5 mg/ml of disodium phosphate dihydrate e.g., 1.53 mg/ml
  • about 0.9 mg/ml of sodium dihydrogen phosphate dihydrate e.g., 0.86
  • about 6.2 mg/ml of sodium chloride e.g., 6.165 mg/ml
  • the buffer system includes about 1-1.5 mg/ml of citric acid, about 0.25 to about 0.5 mg/ml of sodium citrate, about 1.25 to about 1.75 mg/ml of disodium phosphate dihydrate, about 0.7 to about 1.1 mg/ml of sodium dihydrogen phosphate dihydrate, and 6.0 to 6.4 mg/ml of sodium chloride.
  • the pH of the formulation is adjusted with sodium hydroxide.
  • a polyol which acts as a tonicifier and may stabilize the antibody, may also be included in the formulation. The polyol is added to the formulation in an amount which may vary with respect to the desired isotonicity of the formulation.
  • the aqueous formulation may be isotonic.
  • the amount of polyol added may also alter with respect to the molecular weight of the polyol. For example, a lower amount of a monosaccharide (e.g. mannitol) may be added, compared to a disaccharide (such as trehalose).
  • a monosaccharide e.g. mannitol
  • a disaccharide such as trehalose
  • the polyol which may be used in the formulation as a tonicity agent is mannitol.
  • the mannitol concentration may be about 5 to about 20 mg/ml.
  • the concentration of mannitol may be about 7.5 to about 15 mg/ml.
  • the concentration of mannitol may be about 10– about 14 mg/ml.
  • the concentration of mannitol may be about 12 mg/ml.
  • the polyol sorbitol may be included in the formulation.
  • a detergent or surfactant may also be added to the formulation.
  • Exemplary detergents include nonionic detergents such as polysorbates (e.g.
  • the formulation may include a surfactant which is a polysorbate.
  • the formulation may contain the detergent polysorbate 80 or Tween 80. Tween 80 is a term used to describe polyoxyethylene (20) sorbitanmonooleate (see Fiedler, Lexikon der Hilfsstoffe, Editio Cantor Verlag Aulendorf, 4th edi., 1996).
  • the formulation may contain between about 0.1 mg/mL and about 10 mg/mL of polysorbate 80, or between about 0.5 mg/mL and about 5 mg/mL. In certain embodiments, about 0.1% polysorbate 80 may be added in the formulation.
  • Lyophilized Formulation [0190] The lyophilized formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient of the present disclosure includes the anti-PD-L1/TGF Trap molecule and a lyoprotectant.
  • the lyoprotectant may be sugar, e.g., disaccharides.
  • the lycoprotectant may be sucrose or maltose.
  • the lyophilized formulation may also include one or more of a buffering agent, a surfactant, a bulking agent, and/or a preservative.
  • the amount of sucrose or maltose useful for stabilization of the lyophilized drug product may be in a weight ratio of at least 1:2 protein to sucrose or maltose.
  • the protein to sucrose or maltose weight ratio may be of from 1:2 to 1:5.
  • the pH of the formulation, prior to lyophilization may be set by addition of a pharmaceutically acceptable acid and/or base.
  • the pharmaceutically acceptable acid may be hydrochloric acid.
  • the pharmaceutically acceptable base may be sodium hydroxide.
  • the pH of the solution containing the protein of the present disclosure may be adjusted between about 6 to about 8. In certain embodiments, the pH range for the lyophilized drug product may be from about 7 to about 8.
  • a salt or buffer components may be added in an amount of about 10 mM– about 200 mM.
  • the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with“base forming” metals or amines.
  • the buffer may be phosphate buffer.
  • the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • a“bulking agent” may be added.
  • A“bulking agent” is a compound which adds mass to a lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g., facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
  • Illustrative bulking agents include mannitol, glycine, polyethylene glycol and sorbitol. The lyophilized formulations of the present invention may contain such bulking agents.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action.
  • the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • the lyophilized drug product for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may be constituted with an aqueous carrier.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, after lyophilization.
  • Illustrative diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • SWFI Sterile Water for Injection
  • BWFI Bacteriostatic water for injection
  • a pH buffered solution e.g. phosphate-buffered saline
  • sterile saline solution e.g. phosphate-buffered saline
  • Ringer's solution sterile saline solution
  • dextrose solution e.g. phosphate-buffered saline
  • the lyophilized drug product of the current disclosure is reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP.
  • SWFI Sterile Water for Injection
  • USP 0.9% Sodium Chlor
  • the lyophilized protein product of the instant disclosure is constituted to about 4.5 mL water for injection and diluted with 0.9% saline solution (sodium chloride solution).
  • Liquid Formulation [0200]
  • the protein product of the present disclosure is formulated as a liquid formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient.
  • the liquid formulation may be presented at a 10 mg/mL concentration in either a USP / Ph Eur type I 50R vial closed with a rubber stopper and sealed with an aluminum crimp seal closure.
  • the stopper may be made of elastomer complying with USP and Ph Eur.
  • vials may be filled with about 61.2 mL of the protein product solution in order to allow an extractable volume of 60 mL.
  • the liquid formulation may be diluted with 0.9% saline solution.
  • vials may contain about 61.2 mL of the protein product (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)) solution of about 20 mg/mL to about 50 mg/mL (e.g., about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL or about 50 mg/mL) in order to allow an extractable volume of 60 mL for delivering about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1
  • vials may contain about 61.2 mL of the protein product solution (protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40) of about 20 mg/mL to about 50 mg/mL (e.g., about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL or about 50 mg/mL) in order to allow an extractable volume of 60 mL for delivering about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to
  • the liquid formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient of the disclosure may be prepared as a 10 mg/mL concentration solution in combination with a sugar at stabilizing levels.
  • the liquid formulation may be prepared in an aqueous carrier.
  • a stabilizer may be added in an amount no greater than that which may result in a viscosity undesirable or unsuitable for intravenous administration.
  • the sugar may be disaccharides, e.g., sucrose.
  • the liquid formulation may also include one or more of a buffering agent, a surfactant, and a preservative.
  • the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
  • the pharmaceutically acceptable acid may be hydrochloric acid.
  • the base may be sodium hydroxide.
  • deamidation is a common product variant of peptides and proteins that may occur during fermentation, harvest/cell clarification, purification, drug substance/drug product storage and during sample analysis. Deamidation is the loss of NH 3 from a protein forming a succinimide intermediate that can undergo hydrolysis.
  • the succinimide intermediate results in a 17 u mass decrease of the parent peptide.
  • the subsequent hydrolysis results in an 18 u mass increase.
  • Isolation of the succinimide intermediate is difficult due to instability under aqueous conditions. As such, deamidation is typically detectable as 1 u mass increase.
  • Deamidation of an asparagine results in either aspartic or isoaspartic acid.
  • the parameters affecting the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation and tertiary structure.
  • the amino acid residues adjacent to Asn in the peptide chain affect deamidation rates. Gly and Ser following an Asn in protein sequences results in a higher susceptibility to deamidation.
  • the liquid formulation for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient of the present disclosure may be preserved under conditions of pH and humidity to prevent deamination of the protein product.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
  • Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g.
  • IV formulations may be the preferred administration route in particular instances, such as when a patient is in the hospital after transplantation receiving all drugs via the IV route.
  • the liquid formulation is diluted with 0.9% Sodium Chloride solution before administration.
  • the diluted drug product for injection is isotonic and suitable for administration by intravenous infusion.
  • a salt or buffer components may be added in an amount of 10 mM - 200 mM.
  • the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with“base forming” metals or amines.
  • the buffer may be phosphate buffer.
  • the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
  • Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • the present disclosure provides a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve subject in need thereof, the method including administering to the subject a dose of at least 500 mg of a protein including a first polypeptide and a second polypeptide.
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor Receptor II (TGF RII), or a fragment thereof, capable of binding Transforming Growth Factor (TGF ).
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, and the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • the method of treating cancer or inhibiting tumor growth of the present disclosure involves administering to a treatment na ⁇ ve subject a protein including two peptides in which the first polypeptide includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide includes the amino acid sequence of SEQ ID NO: 1.
  • the protein is an anti-PD-L1/TGF Trap molecule.
  • the treatment na ⁇ ve subject treated in accordance with the methods disclosed herein has not received prior therapy with the the bifunctional protein of the present disclosure (anti-PD-L1/TGF Trap molecule).
  • the treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient to be treated in accordance with the methods of the present disclosure does not have a mutation selected from epidermal growth factor receptor (EGFR) sensitizing (activating) mutation, anaplastic lymphoma kinase (ALK) translocation, ROS1 mutation, and BRAF V600E mutation.
  • EGFR epidermal growth factor receptor
  • ALK anaplastic lymphoma kinase
  • the method of treating cancer or inhibiting tumor growth of the present disclosure involves administering to a treatment na ⁇ ve subject a protein (e.g., an anti-PD-L1/TGF Trap molecule (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40)) at a dose of about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400
  • a protein e.
  • about 1200 mg of anti-PD-L1/TGF Trap molecule is administered to a treatment na ⁇ ve subject once every two weeks. In certain embodiments, about 2400 mg of anti-PD-L1/TGF Trap molecule is administered to a treatment na ⁇ ve subject once every three weeks. In certain embodiments, about 1200 mg of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a treatment na ⁇ ve subject once every two weeks.
  • about 2400 mg of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a treatment na ⁇ ve subject once every three weeks.
  • about 2400 mg of a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40 is administered to a treatment na ⁇ ve subject once every three weeks.
  • the dose administered to a treatment na ⁇ ve subject may be about 500 mg, about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, about 1500 mg, about 1525 mg, about 1550 mg, about 1575 mg, about 1600 mg, about 1625 mg, about 1650 mg, about 1675
  • the dose administered to a treatment na ⁇ ve subject may be administered once every two weeks. In certain embodiments, the dose administered to a treatment na ⁇ ve subject may be administered once every three weeks.
  • the protein may be administered by intravenous administration, e.g., with a prefilled bag, a prefilled pen, or a prefilled syringes. In certain embodiments, the protein is administered intravenously from a 250 ml saline bag, and the intravenous infusion may be for about one hour (e.g., 50 to 80 minutes). In certain embodiments, the bag is connected to a channel comprising a tube and/or a needle.
  • the NSCLC exhibits squamous or non-squamous histology.
  • the method treats squamous NSCLC. In some embodiments, the method treats non-squamous NSCLC.
  • treatment na ⁇ ve subjects or patients with advanced NSCLC are treated by intravenously administering at least 500 mg (e.g., about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, or more) of anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • treatment na ⁇ ve subjects or patients with advanced NSCLC are treated by intravenously administering at least 500 mg (e.g., about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, or more) of anti-PD-L1/TGF Trap, which includes a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40.
  • first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37
  • second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40.
  • treatment na ⁇ ve subjects or patients with advanced NSCLC are treated by intravenously administering about 1200 mg– about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2
  • treatment na ⁇ ve subjects or patients with advanced NSCLC are treated by intravenously administering about 1200 mg– about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg,
  • treatment na ⁇ ve subjects or patients with advanced NSCLC are treated by intravenously administering anti-PD-L1/TGF Trap at a dose of about 1200 mg once every 2 weeks.
  • treatment na ⁇ ve subjects or patients with advanced NSCLC e.g., NSCLC (e.g., squamous or non-squamous NSCLC) with high PD-L1 expression
  • the cancer to be treated is PD-L1 positive.
  • the cancer to be treated exhibits high PD-L1 expression (“high PD-L1” or “PD-L1 high”).
  • Methods of detecting a biomarker, such as PD-L1 for example, on a cancer or tumor are routine in the art and are contemplated herein. Non-limiting examples include
  • treatment na ⁇ ve subjects or patients with PD-L1 high, advanced NSCLC e.g., squamous or non-squamous advanced NSCLC
  • advanced NSCLC e.g., squamous or non-squamous advanced NSCLC
  • treatment na ⁇ ve subjects or patients with PD-L1 high, advanced NSCLC are treated by intravenously administering anti-PD-L1/TGF Trap at a dose of about 1200 mg once every 2 weeks.
  • treatment na ⁇ ve subjects or patients with with PD-L1 high, advanced NSCLC are treated by intravenously administering anti-PD-L1/TGF Trap at a dose of about 2400 mg once every 3 weeks.
  • the treatment na ⁇ ve subject or patient to be treated does not have a mutation selected from EGFR sensitizing mutation, ALK translocation, ROS1 mutation, and BRAF V600E mutation.
  • treatment na ⁇ ve subjects or patients with PD-L1 high, advanced NSCLC e.g., squamous or non-squamous advanced NSCLC
  • a mutation selected from EGFR sensitizing mutation, ALK translocation, ROS1 mutation, and BRAF V600E mutation are treated by intravenously administering anti-PD-L1/TGF Trap at a dose of at least 500 mg (e.g., about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200
  • 500 mg e.g., about 500 mg, about 600 mg, about
  • treatment na ⁇ ve subjects or patients with PD-L1 high, advanced NSCLC e.g., squamous or non-squamous advanced NSCLC
  • a mutation selected from EGFR sensitizing mutation, ALK translocation, ROS1 mutation, and BRAF V600E mutation are treated by intravenously administering anti-PD- L1/TGF Trap at a dose of about 1200 mg once every 2 weeks.
  • treatment na ⁇ ve subjects or patients with PD-L1 high, advanced NSCLC e.g., squamous or non-squamous NSCLC
  • advanced NSCLC e.g., squamous or non-squamous NSCLC
  • the methods of treatment disclosed herein result in a disease response or improved survival of the subject or patient.
  • the disease response may be a complete response, a partial response, or a stable disease.
  • the improved survival could be progression-free survival (PFS) or overall survival.
  • improvement e.g., in PFS
  • improvement is determined relative to a period prior to initiation of treatment with an anti-PD-L1/TGF Trap of the present disclosure.
  • Methods of determining disease response e.g, complete response, partial response, or stable disease
  • patient survival e.g, PFS, overall survival
  • disease response is evaluated according to RECIST 1.1 after subjecting the treated patient to contrast-enhanced computed tomography (CT) or magnetic resonance imaging (MRI) of the affected area
  • CT computed tomography
  • MRI magnetic resonance imaging
  • the present disclosure provides a drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient, wherein the device includes a formulation comprising about 500 mg– about 3000 mg of a protein including a first polypeptide and a second polypeptide, the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor Receptor II (TGF RII), or a fragment thereof, capable of binding Transforming Growth Factor (TGF ), the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1,
  • a treatment na ⁇ ve cancer e.g., NSCLC with high PD-L1 expression
  • the device includes a formulation comprising about 500 mg– about 3000 mg of a protein including
  • the device may be a bag, a pen, or a syringe.
  • the bag may be connected to a channel comprising a tube and/or a needle.
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 500 mg to about 3000 mg (e.g., about 500 mg to about 3000 mg, about 500 mg to about 2900 mg, about 500 mg to about 2800 mg, about 500 mg to about 2700 mg, about 500 mg to about 2600 mg, about 500 mg to about 2500 mg, about 500 mg to about 2400 mg, about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg,
  • the drug delivery device may include about 500 to about 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1).
  • a protein of the present disclosure e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the drug delivery device may include about 500 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40).
  • the protein of the present disclosure e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ
  • the drug delivery device includes about 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40).
  • a protein of the present disclosure e.g., anti-PD-L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient includes about 2400 mg dose of a protein of the present disclosure (e.g., anti-PD- L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40).
  • a protein of the present disclosure e.g., anti-PD- L1/TGF Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient includes about 1200 mg or about 2400 mg dose of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40.
  • a treatment na ⁇ ve cancer e.g., NSCLC with high PD-L1 expression
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient includes about 1200 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40)).
  • the protein of the present disclosure e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO:
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient includes about 2400 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1; or a protein product with a first polypeptide that comprises the amino acid sequences of SEQ ID NOs: 35, 36, and 37, and a second polypeptide that comprises the amino acid sequences of SEQ ID NOs: 38, 39, and 40)).
  • the protein of the present disclosure e.g., anti-PD-L1/TGF Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO:
  • the drug delivery device for use in a method of treating cancer or inhibiting tumor growth in a treatment na ⁇ ve cancer (e.g., NSCLC with high PD-L1 expression) patient may include about 500 mg, about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, about 1500 mg, about 15
  • the antibody-cytokine Trap proteins are generally produced recombinantly, using mammalian cells containing a nucleic acid engineered to express the protein.
  • a suitable cell line and protein production method is described in Examples 1 and 2 of US 20150225483 A1, a wide variety of suitable vectors, cell lines and protein production methods have been used to produce antibody-based biopharmaceuticals and could be used in the synthesis of these antibody-cytokine Trap proteins.
  • the anti-PD-L1/TGF Trap proteins described in the application can be used to treat cancer or reduce tumor growth in a treatment na ⁇ ve patient.
  • Exemplary cancers include non-small cell lung cancer (NSCLC), melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck.
  • the treated cancer is advanced NSCLC (e.g., squamous or non-squamous advanced NSCLC).
  • the cancer or tumor to be treated with an anti-PD-L1/ TGF Trap may be selected based on the expression or elevated expression of PD-L1 and/or TGF in the tumor, the correlation of their expression levels with prognosis or disease progression, and preclinical and clinical experience on the sensitivity of the tumor to treatments targeting PD-L1 and TGF .
  • Such cancers or tumors include but are not limited to colorectal, breast, ovarian, pancreatic, gastric, prostate, renal, cervical, bladder, head and neck, liver, non-small cell lung cancer, advanced non-small cell lung cancer, melanoma, Merkel cell carcinoma, and mesothelioma.
  • a treatment na ⁇ ve patient with a PD-L1 positive (e.g., PD-L1 high) advanced NSCLC is treated in accordance with the methods of the present disclosure.
  • the treatment na ⁇ ve cancer e.g., advanced NSCLC (i.e., metastatic NSCLC)
  • the treatment na ⁇ ve cancer with high PD-L1 expression does not have a mutation selected from epidermal growth factor receptor (EGFR) sensitizing (activating) mutation, anaplastic lymphoma kinase (ALK) translocation, ROS1 mutation, and BRAF V600E mutation.
  • EGFR epidermal growth factor receptor
  • ALK anaplastic lymphoma kinase
  • the treatment na ⁇ ve cancer e.g., advanced NSCLC (i.e., metastatic NSCLC)
  • EGFR epidermal growth factor receptor
  • the treatment na ⁇ ve cancer e.g., advanced NSCLC (i.e., metastatic NSCLC)
  • ALK anaplastic lymphoma kinase
  • the treatment na ⁇ ve cancer e.g., advanced NSCLC (i.e., metastatic NSCLC)
  • the treatment na ⁇ ve cancer with high PD-L1 expression
  • the treatment na ⁇ ve cancer e.g., advanced NSCLC (i.e., metastatic NSCLC)
  • the treatment na ⁇ ve cancer with high PD-L1 expression
  • patient to be treated in accordance with the methods of the present disclosure does not have BRAF V600E mutation.
  • EXAMPLE 1 Packaging of Intravenous Drug Formulation
  • the formulation of anti-PD-L1/TGF Trap is prepared as a lyophilized formulation or a liquid formulation.
  • freeze-dried anti-PD- L1/TGF Trap is sterilized and stored in single-use glass vials.
  • Several such glass vials are then packaged in a kit for delivering a specific body weight independent dose to a subject diagnosed with a cancer or a tumor.
  • the kit contains 12-60 vials.
  • the formulation is prepared and packaged as a liquid formulation and stored as 250 mg/vial to 1000 mg/vial.
  • the formulation is a liquid formulation and stored as 600 mg/vial, or stored as 250 mg/vial.
  • the anti-PD-L1/TGF Trap is formulated as a 10mg/mL solution and is supplied in USP/Ph Eur type I vials filled to allow an extractable volume of 60 mL (600 mg/60 mL) and closed with rubber stoppers in serum format complying with USP and Ph Eur with an aluminum crimpseal closure.
  • a subject diagnosed with advanced NSCLC is intravenously administered a formulation containing 500 mg to 2400 mg of anti-PD-L1/TGF Trap.
  • the subject is intravenously administered 1200 mg of anti-PD-L1/TGF Trap once in two weeks or 2400 mg of anti-PD-L1/TGF Trap once in three weeks.
  • the intravenous administration is from a saline bag.
  • the amount of the anti-PD-L1/TGF Trap administered to a subject is independent of the subject’s body weight.
  • the BW-independent dose of 1200 mg is administered to cancer patients with advanced non-small cell lung cancer (NSCLC) once every two weeks. The administration is performed intravenously for about an hour (-10 minutes / +20 minutes, i.e., 50 minutes to 80 minutes).
  • the BW- independent dose of 2400 mg is administered to cancer patients with advanced non-small cell lung cancer (NSCLC) once every three weeks. The administration is performed intravenously for about an hour (-10 minutes / +20 minutes, i.e., 50 minutes to 80 minutes).
  • premedication with an antihistamine and with paracetamol (acetaminophen) for example, 25-50 mg diphenhydramine and 500-650 mg paracetamol [acetaminophen] IV or oral equivalent
  • acetaminophen for example, 25-50 mg diphenhydramine and 500-650 mg paracetamol [acetaminophen] IV or oral equivalent
  • ANC absolute neutrophil count
  • ⁇ ⁇ ULN a total bilirubin level the upper limit of normal
  • AST aspartate aminotransferase
  • ALT alanine aminotransferase
  • bilirubin 3.0 ⁇ ULN is acceptable
  • EXAMPLE 3 Treatment of Advanced NSCLC Patients with anti-PD-L1/TGF Trap [0242] Objective: The purpose of this study is to evaluate whether anti-PD-L1/TGF Trap improves progression-free survival (PFS) time and/or best overall response (BOR) as a first- line (1L) treatment for patients with, advanced non-small cell lung cancer (NSCLC) with PD- L1 tumor expression.
  • PFS progression-free survival
  • BOR best overall response
  • anti-PD-L1/TGF Trap targets PD-L1 and TGF , two major mechanisms of immunosuppression in the tumor microenvironment.
  • Preclinical data suggest that anti-PD- L1/TGF Trap strongly enhances antitumor activity and prolongs survival in mouse tumor models above the effect of either the anti PD-L1 antibody avelumab or the TGF Trap control alone.
  • simultaneous neutralization of TGF- a molecule known to inhibit tumor immune activation, might stimulate clinical response in patients.
  • Study Design This study evaluates disease response and survival primary endpoints to assess clinical benefit of an anti-PD-L1/TGF Trap as first line treatment for patients with advanced NSCLC with high PD-L1-tumor expression.
  • PD-L1 high is 80% PD-L1 positive tumor cells as determined by the Dako 73-10 assay.
  • Patients with tumor proportion score (TPS) 50% as determined by the PD-L1 Dako IHC 22C3 PharmDx assay performed according to local laboratory regulations prior to study enrollment are also eligible. Both Dako 73-10 assay and Dako IHC 22C3 PharmDx assay select a similar patient population at their respective cutoffs.
  • Approximately 300 patients who have not received previous treatment for their advanced NSCLC are enrolled in this study.
  • the patients in this study meet the inclusion criteria of patients described in Example 2, have not received prior systemic therapy treatment for their advanced NSCLC (patients are treatment na ⁇ ve), and do not have epidermal growth factor receptor (EGFR) sensitizing (activating) mutation, anaplastic lymphoma kinase (ALK) translocation, ROS1 mutation, or BRAF V600E mutation, where targeted therapy is locally approved.
  • EGFR epidermal growth factor receptor
  • ALK anaplastic lymphoma kinase
  • the patients are stratified according to tumor histology (squamous versus nonsquamous) and smoking history as follows: squamous history, nonsquamous history and never smoked, nonsquamous history and ever smoker.
  • the patients are intravenously administered an anti-PD-L1/TGF Trap dose of 1200 mg once every two weeks, or 2400 mg once every three weeks.
  • Treatment is continued until confirmed progressive disease (PD) per Response Evaluation Criteria in Solid Tumors version 1.1 (RECIST 1.1), unacceptable toxicity, or for up to 24 months.
  • PD progressive disease
  • RECIST 1.1 Solid Tumors version 1.1
  • treatment may continue past the initial determination of PD or confirmed PD if the patient's Eastern Cooperative Oncology Group Performance Status (ECOG PS) remains stable, and if the participant will benefit from continued treatment.
  • ECG PS Eastern Cooperative Oncology Group Performance Status
  • Efficacy Assessments Tumor response to anti-PD-L1/TGF Trap is assessed by CT scan or MRI. Scans performed at baseline are repeated at subsequent visits. In general, lesions detected at baseline are followed using the same imaging methodology and preferably the same imaging equipment at subsequent tumor evaluation visits.
  • Skin metastasis can be used as target lesions according to RECIST 1.1 using measurements by caliper, if they fulfill RECIST 1.1 for target lesions.
  • Results Objective tumor response is evaluated by the overall response rate (ORR), defined as the number of participants having reached a best overall response (BOR) of complete response (CR) or partial response (PR) divided by the number of participants in the analysis population.
  • ORR overall response rate
  • Progression-free survival is defined as the time from randomization to the date of the first documentation of objective progression of disease (PD) as assessed according to RECIST 1.1 or death due to any cause, whichever occurs first.
  • treatment with anti-PD-L1/TGF Trap results in initial clinical activity in treatment na ⁇ ve, advanced NSCLC patients with PD-L1 high status.
  • Tumor biomarkers are evaluated before and after treatment from blood and tumor samples obtained from the patients who are administered the anti-PD-L1/TGF Trap.
  • Treated patients exhibit disease response (e.g., partial response, complete response, stable disease) and/or improved survival (e.g., progression-free survival and/or overall survival).
  • disease response e.g., partial response, complete response, stable disease
  • improved survival e.g., progression-free survival and/or overall survival.
  • SEQ ID NO: 2 Peptide sequence of the secreted H chain of anti-PDL1
  • SEQ ID NO: 4 DNA sequence from the translation initiation codon to the translation stop codon of the anti- PD-L1 lambda light chain (the leader sequence preceding the VL is the signal peptide from urokinase plasminogen activator)
  • SEQ ID NO: 6 Polypeptide sequence of the secreted lambda light chain of anti-PD-L1(mut)/ TGF Trap, with mutations A31G, D52E, R99Y
  • SEQ ID NO: 7 Polypeptide sequence of the secreted heavy chain of anti-PD-L1(mut)/ TGF Trap
  • SEQ ID NO: 12 Polypeptide sequence of the secreted heavy chain variable region of anti-PD-L1 antibody MPDL3289A
  • SEQ ID NO: 13 Polypeptide sequence of the secreted light chain variable region of anti-PD-L1 antibody MPDL3289A
  • SEQ ID NO: 14 Polypeptide sequence of the secreted heavy chain variable region of anti-PD-L1 antibody YW243.55S70
  • SEQ ID NO: 55 Polypeptide sequence of the heavy chain variable region of anti-PD-L1 antibody
  • SEQ ID NO: 56 Polypeptide sequence of the light chain variable region of anti-PD-L1 antibody

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2019/032271 2018-05-15 2019-05-14 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects Ceased WO2019222252A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020207035552A KR20210009339A (ko) 2018-05-15 2019-05-14 치료 나이브 대상체의 암 치료에 사용하기 위한 표적화된 TGF-β 억제를 위한 투약 레지멘
MX2020011638A MX2020011638A (es) 2018-05-15 2019-05-14 Regimenes de dosificacion para una inhibicion dirigida del factor de crecimiento transformante beta (tgf-beta) en el tratamiento del cancer en sujetos no tratados previamente.
CN201980032533.9A CN112118858A (zh) 2018-05-15 2019-05-14 用于未经治疗对象中癌症治疗的靶向tgf-β抑制的给药方案
CA3096844A CA3096844A1 (en) 2018-05-15 2019-05-14 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects
EP19804320.0A EP3813868A4 (en) 2018-05-15 2019-05-14 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects
JP2020556807A JP2021523096A (ja) 2018-05-15 2019-05-14 未治療対象において癌を治療する際に使用するための標的tgf−β阻害のための投与計画
AU2019271065A AU2019271065A1 (en) 2018-05-15 2019-05-14 Dosing regimens for targeted TGF-B inhibition for use in treating cancer in treatment naive subjects
BR112020021082-0A BR112020021082A2 (pt) 2018-05-15 2019-05-14 regimes de dosagem para inibição de tgf-b direcionada para uso no tratamento de câncer em indivíduos sem tratamento prévio
SG11202011148VA SG11202011148VA (en) 2018-05-15 2019-05-14 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects
US17/095,377 US20210061899A1 (en) 2018-05-15 2020-11-11 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naïve subjects

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862671963P 2018-05-15 2018-05-15
US62/671,963 2018-05-15
US201962804931P 2019-02-13 2019-02-13
US62/804,931 2019-02-13

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/095,377 Continuation US20210061899A1 (en) 2018-05-15 2020-11-11 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naïve subjects

Publications (1)

Publication Number Publication Date
WO2019222252A1 true WO2019222252A1 (en) 2019-11-21

Family

ID=68540945

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/032271 Ceased WO2019222252A1 (en) 2018-05-15 2019-05-14 Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects

Country Status (12)

Country Link
US (1) US20210061899A1 (https=)
EP (1) EP3813868A4 (https=)
JP (1) JP2021523096A (https=)
KR (1) KR20210009339A (https=)
CN (1) CN112118858A (https=)
AU (1) AU2019271065A1 (https=)
BR (1) BR112020021082A2 (https=)
CA (1) CA3096844A1 (https=)
MX (1) MX2020011638A (https=)
SG (1) SG11202011148VA (https=)
TW (1) TW202003577A (https=)
WO (1) WO2019222252A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021115456A1 (en) * 2019-12-11 2021-06-17 Wuxi Biologics (Shanghai) Co., Ltd. BI-FUNCTIONAL ANTIBODY AGAINST PD-L1 AND TGFβ
EP4144764A4 (en) * 2020-04-28 2024-07-17 Sinocelltech Ltd. TRUNCATED EXTRACELLULAR DOMAIN MOLECULE TGFßR2, FUSION PROTEIN OF TRUNCATED EXTRACELLULAR DOMAIN MOLECULE TGFßR2 AND ANTI-EGFR ANTIBODY, AND ANTITUMORAL USE OF FUSION PROTEIN

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230365653A1 (en) * 2020-07-24 2023-11-16 Mabwell (shanghai) Bioscience Co., Ltd. Tgf-beta rii mutant and fusion protein thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160009807A1 (en) * 2013-03-12 2016-01-14 Biocon Ltd. Fusion immunomodulatory proteins and methods for making same
US20180002436A1 (en) * 2014-02-10 2018-01-04 Merck Patent Gmbh TARGETED TGFß INHIBITION

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201216649D0 (en) * 2012-09-18 2012-10-31 Univ Birmingham Agents and methods
US20170145103A1 (en) * 2015-11-23 2017-05-25 Five Prime Therapeutics, Inc. Predicting response to cancer treatment with fgfr2 inhibitors
EP3497130B1 (en) * 2016-08-12 2021-10-27 Merck Patent GmbH Combination therapy for cancer

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160009807A1 (en) * 2013-03-12 2016-01-14 Biocon Ltd. Fusion immunomodulatory proteins and methods for making same
US20180002436A1 (en) * 2014-02-10 2018-01-04 Merck Patent Gmbh TARGETED TGFß INHIBITION

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3813868A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021115456A1 (en) * 2019-12-11 2021-06-17 Wuxi Biologics (Shanghai) Co., Ltd. BI-FUNCTIONAL ANTIBODY AGAINST PD-L1 AND TGFβ
EP4144764A4 (en) * 2020-04-28 2024-07-17 Sinocelltech Ltd. TRUNCATED EXTRACELLULAR DOMAIN MOLECULE TGFßR2, FUSION PROTEIN OF TRUNCATED EXTRACELLULAR DOMAIN MOLECULE TGFßR2 AND ANTI-EGFR ANTIBODY, AND ANTITUMORAL USE OF FUSION PROTEIN

Also Published As

Publication number Publication date
CA3096844A1 (en) 2019-11-21
TW202003577A (zh) 2020-01-16
MX2020011638A (es) 2022-02-10
JP2021523096A (ja) 2021-09-02
EP3813868A4 (en) 2022-03-02
EP3813868A1 (en) 2021-05-05
US20210061899A1 (en) 2021-03-04
SG11202011148VA (en) 2020-12-30
AU2019271065A1 (en) 2020-11-05
KR20210009339A (ko) 2021-01-26
CN112118858A (zh) 2020-12-22
BR112020021082A2 (pt) 2021-02-17

Similar Documents

Publication Publication Date Title
EP3565599A1 (en) Dosing regimens and dosage forms for targeted tgf-b inhibition
JP7448552B2 (ja) がんの併用療法
CA3103245A1 (en) Treatment of stage iii nsclc and mitigation of pathological conditions associated with the treatment
US20210061899A1 (en) Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naïve subjects
US20210115145A1 (en) Combination therapy with targeted tgf-b inhibition for treatment of advanced non-small cell lung cancer
EP3810654A1 (en) Dosing regimens for targeted tgf-b inhibition for use in treating biliary tract cancer
HK40042110A (en) Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects
HK40050239A (en) Treatment of stage iii nsclc and mitigation of pathological conditions associated with the treatment

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19804320

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3096844

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020556807

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020021082

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019271065

Country of ref document: AU

Date of ref document: 20190514

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20207035552

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019804320

Country of ref document: EP

Effective date: 20201215

ENP Entry into the national phase

Ref document number: 112020021082

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20201015