WO2019213434A1 - Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells - Google Patents
Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells Download PDFInfo
- Publication number
- WO2019213434A1 WO2019213434A1 PCT/US2019/030459 US2019030459W WO2019213434A1 WO 2019213434 A1 WO2019213434 A1 WO 2019213434A1 US 2019030459 W US2019030459 W US 2019030459W WO 2019213434 A1 WO2019213434 A1 WO 2019213434A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- seq
- caar
- cell
- pla2r
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- Membranous nephropathy is among the most common primary causes of nephrotic syndrome in adults (up to one-third of cases). About 15-25% of membranous nephropathy cases are secondary membranous nephropathy, caused by drugs, infections, tumors, or immune diseases. The remaining 75-85% of membranous nephropathy cases are idiopathic, also called primary membranous nephropathy. MN is caused by immune complex formation in the glomerulus. The immune complexes are formed by binding of antibodies to antigens on the podocyte. The immune complex serves as an activator that triggers complement-mediated lysis of glomerular epithelial cells and the release of proteases and oxidants damaging capillary walls. Up to 40% of patients with primary membranous nephropathy who do not receive immunosuppressive treatment develop end-stage renal disease requiring dialysis or kidney transplantation.
- the M-type phospholipase A2 receptor (PLA2R) has been described as a major autoantigen in primary membranous nephropathy.
- Autoantibodies to PLA2R are present in 70-80% of cases of primary membranous nephropathy, and can be used for the diagnosis and monitoring of treatment of primary membranous nephropathy both in the native kidneys and after kidney transplant.
- the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- the invention includes a vector comprising any one of the polynucleotides disclosed herein.
- the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof.
- CAAR chimeric autoantibody receptor
- PHA2R phospholipase A2 receptor
- the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- Another aspect of the invention includes a genetically modified cell comprising any one of the CAARs disclosed herein.
- Yet another aspect of the invention includes genetically modified cell comprising: (a) a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- Still another aspect of the invention includes a pharmaceutical composition comprising any one of the polynucleotides disclosed herein, any one of the CAARs disclosed herein or any one of the cells disclosed herein, and a pharmaceutically acceptable excipient.
- the invention includes a method for treating an autoantibody- mediated kidney disease in a subject.
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease, the method comprising: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for treating an
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby treating the autoantibody-mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby preventing or reducing glomerulus damage in the subject.
- CAAR chimeric autoantibody receptor
- PDA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1 and a C-type lectin domain 2; and (b) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2 and a C-type lectin domain 3.
- the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a cysteine rich domain, (b) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1, (c) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3, (d) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7, (e) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 7, or (e) an extra
- the PLA2R extracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 8 or SEQ ID NO: 15 or SEQ ID NO: 47 or SEQ ID NO: 60 or SEQ ID NO: 50 or SEQ ID NO: 62 or SEQ ID NO: 52 or SEQ ID NO: 54 or SEQ ID NO: 56 or SEQ ID NO: 58.
- the transmembrane domain comprises a CD8 alpha chain transmembrane domain.
- the CD8 alpha chain transmembrane domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 20.
- the CD8 alpha chain transmembrane domain comprises the amino acid sequence of SEQ ID NO: 19.
- the CAAR further comprises a hinge domain.
- the hinge domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 10 or SEQ ID NO: 42 or SEQ ID NO: 64.
- the hinge domain comprises the amino acid sequence of SEQ ID NO: SEQ ID NO: 43 or SEQ ID NO: 44.
- the CAAR further comprises a GS linker.
- the GS linker is encoded by a nucleic acid sequence comprising SEQ ID NO: 68. In certain embodiments, the GS linker comprises SEQ ID NO: 69.
- the intracellular domain of a costimulatory molecule comprises 4-1BB.
- the 4-1BB intracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 22 or SEQ ID NO: 66.
- the 4-1BB intracellular domain comprises the amino acid sequence of SEQ ID NO: 21.
- the signaling domain comprises a CD3 zeta signaling domain.
- the CD3 zeta signaling domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 24 or SEQ ID NO: 72.
- the CD3 zeta signaling domain comprises an amino acid sequence of SEQ ID NO: 23 or SEQ ID NO: 45.
- the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39. In certain embodiments, the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, and 40.
- the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain.
- PHA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the vector is a lentiviral vector. In certain embodiments, the vector is a RNA vector.
- the cell expresses the CAAR and has high affinity to autoantibody based BCRs on B cells In certain embodiments the cell expresses the CAAR and induces killing of B cells expressing autoantibodies. In certain embodiments, the cell expresses the CAAR and has limited toxicity toward healthy cells.
- the cell is selected from the group consisting of a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, a cytokine induced killer cell, a cell line thereof, a T memory stem cell, a T cell derived from a pluripotent stem and other effector cell.
- the autoantibody mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous
- the subject is a human.
- the modified T cell targets B cells.
- the KIR is KIRS2 or KIR2DS2.
- the vector comprises an inducible promoter operably linked to the polynucleotide encoding the CAAR.
- the cell comprises a polynucleotide encoding the CAAR operably linked to an inducible promoter.
- FIG. 1 is an illustration showing a schematic of the native PLA2R molecule.
- the N terminal cysteine-rich (CysR) domain (Ricin B type lectin domain) is the immunodominant epitope that is recognized by patient serum antibodies. In non-reducing conditions, serum antibody recognition has been reported to be dependent on the first 3 C-type lectin domains (CTLD). In addition to the cysteine-rich domain, serum antibody immunoreactivity to the C-type lectin domains 1 and 7 has also been reported.
- C-type lectin domains 1 and 7 has also been reported.
- a commercial Novus monoclonal antibody (mAb) and polyclonal Sigma antibody bind to the CTLD2 domain.
- ECD extracellular domain
- TMD transmembrane domain
- BBZ cytoplasmic tandem 41BB (CD137) and CD3-zeta signaling domain
- CysR cysteine rich domain
- FNII fibronectin type II
- Figure 2B depicts construct 4026.CF1 (or construct CF1), consisting of the CysR, FNII, and CTLD1 domains followed by a CD8 hinge domain.
- Figure 2C depicts construct 4027.CF12, consisting of the CysR, FNII, CTLD1, and CTLD2 domains, followed by a CD8 hinge domain.
- Figure 2D depicts construct 4028.CF123 (or construct CF123), consisting of the CysR, FNII, CTLD1, CTLD2, and CTLD3 domains, followed by either a CD8 hinge (4028.CF123) or GS linker (CF123).
- Figure 2E depicts construct CF1237, consisting of the CysR, FNII, CTLD1, CTLD2, CTLD3, and CTLD7 domains followed by a GS linker.
- Figure 2F depicts construct CF17, consisting of the CysR, FNII, CTLD1, and CTLD7 domains, followed by a GS linker.
- Figure 2G depicts construct C17, consisting of the CysR, CTLD1, and CTLD7 domains, followed by a GS linker.
- Figure 3A is an illustration showing a portion of the plasmid map comprising the 4028.CF123 CAAR.
- Figure 3B is a table distinguishing the compositions of the CAAR constructs described in this invention.
- Figure 4 is a series of flow cytometry plots demonstrating surface expression of a subset of PLA2R CAARs (4027.CF12 and 4028.CF123) on Jurkat NFAT-GFP cells.
- the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured (MOI 5:1, 48h) using a commercial Novus monoclonal antibody (mAb) specific for the PLA2R CTLD2 domain.
- Figure 5 is a series of flow cytometry plots showing the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA + ionomycin (bottom, positive control).
- Figure 6 is a series of flow cytometry plots showing the activation of 4027. CF 12 and 4028.
- C as expected as this construct does not contain the CTLD2 domain, and untransduced cells upon exposure to the anti-PLA2R monoclonal antibody (mAh) or the polyclonal anti-PLA2R antibody (Ab).
- mAh anti-PLA2R monoclonal antibody
- Ab polyclonal anti-PLA2R antibody
- Figures 7A-7B are a series of plots illustrating that PLA2R MN patient IgG detects PLA2R CAAR expression on transduced Jurkat NFAT-GFP and primary human T cells.
- Flow cytometry plots demonstrate robust PLA2R CAAR surface expression on Jurkat NFAT-GFP cells (Figure 7A) and primary human T cells (Figure 7B) for all constructs evaluated (4025. C, 4026.CF1, 4027.CF12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17).
- PLA2R CAAR The expression of PLA2R CAAR by Jurkat NFAT-GFP and primary human T cells transduced with different PLA2R lentiviral constructs (72h) was detected by incubation with MN patient IgG followed by APC-conjugated anti-human IgG.
- Figure 8 is a series of plots illustrating that plate-bound MN patient IgG activates PLA2R CAAR transduced Jurkat-NFAT-GFP cells.
- Flow cytometry plots show the activation of PLA2R CAAR T cells by MN patient IgG measured as GFP expression by Jurkat NFAT-GFP cells (6h activation). All evaluated PLA2R CAAR T cells (4025. C, 4026.CF1, 4027. CF 12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17) transduced signal after cross-linking by plate-bound anti-PLA2R IgG.
- Figure 9 is a set of graphs illustrating that plate-bound MN patient IgG stimulates IFN-g secretion from PLA2R CAAR-transduced primary human T cells.
- 5xl0 4 primary human T cells were cultured for 24h in a 96-well plate coated with 10 mg/ml of either MN patient IgG or control human IgG. Culture supernatants were then harvested for detection of IFN- J by ELISA. IFN ⁇ production was detectable in all culture supernatants and was elevated relative to untransduced T cells, or PLA2R CAAR T cells stimulated with control (Ctrl) human IgG. DETAILED DESCRIPTION
- the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- CAAR chimeric autoantibody receptor
- PHA2R anti-phospholipase A2 receptor
- BCR B cell receptor
- compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- the invention also includes methods of making a genetically modified cell, e.g., a genetically modified T cell, expressing a PLA2R-CAAR wherein the expressed CAAR comprises a PLA2R extracellular domain.
- the present invention also relates generally to the use of cells, e.g., T cells, engineered to express a CAAR to treat an autoantibody-mediated kidney disease associated with targeting of self-antigens (e.g. PLA2R).
- the cells e.g., T cells expressing the CAAR of the invention specifically bind to and kill anti- PLA2R BCR-expressing cells, but do not bind to and kill normal BCR-expressing cells.
- antibody refers to an immunoglobulin molecule that binds with an antigen.
- Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules.
- the antibody in the present invention may exist in a variety of forms where the antibody is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) and a humanized antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
- sdAb single domain antibody fragment
- scFv single chain antibody
- humanized antibody Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston
- the term“high affinity,” as used herein, refers to high specificity in binding or interacting or attraction of a binding molecule to a target molecule.
- the binding molecule may have an affinity for the target molecule stronger than 100nM, 50 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM, e.g., as determined by surface plasmon resonance.
- antigen or“Ag,” as used herein, is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically competent cells, or both.
- antigens can be derived from recombinant or genomic DNA.
- any DNA which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an“antigen” as that term is used herein
- an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response.
- an antigen need not be encoded by a“gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
- autoantigen is meant an endogenous antigen that stimulates production of an autoimmune response, such as production of autoantibodies.
- Autoantigen also includes a self-antigen or antigen from a normal tissue that is the target of a cell-mediated or an antibody-mediated immune response that may result in the development of an autoimmune response.
- autoantigens include, but are not limited to, PLA2R, and fragments thereof.
- polynucleotides, cells and/or antibodies of the invention manifesting a lack of substantially negative biological effects, anti-tumor effects, or substantially negative physiological symptoms toward a healthy cell, non-tumor cell, non-diseased cell, non- target cell or population of such cells either in vitro or in vivo.
- Autoantibody refers to an antibody that is specific for an autoantigen.
- autoimmune disease is defined as a disorder or condition that results from an antibody-mediated autoimmune response against autoantigens.
- An autoimmune disease results in the production of autoantibodies that are inappropriately produced and/or excessively produced to a self-antigen or autoantigen.
- autologous is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
- Allogeneic refers to any material derived from a different animal of the same species.
- CAAR Chimeric autoantibody receptor
- the CAAR includes an antigen or fragment thereof that is specific for an autoantibody and/or BCR, e.g., a pathogenic autoantibody and/or BCR.
- the CAAR optionally also includes a transmembrane domain, an intracellular domain and/or a signaling domain.
- conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- one or more amino acid residues within the extracellular regions of the CAAR of the invention can be replaced with other amino acid residues having a similar side chain or charge and the altered CAAR can be tested for the ability to bind autoantibodies using the functional assays described herein.
- Co-stimulatory ligand includes a molecule on an antigen presenting cell (e.g., an aAPC, dendritic cell, B cell, and the like) that specifically binds a cognate co-stimulatory molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- an antigen presenting cell e.g., an aAPC, dendritic cell, B cell, and the like
- A“co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
- Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor.
- Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- results may include, but are not limited to, the inhibition of virus infection as determined by any means suitable in the art.
- effector function refers to a specialized function of a cell.
- endogenous refers to any material from or produced inside an organism, cell, tissue or system.
- exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
- expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
- “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed
- An expression vector comprises sufficient cis acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
- Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes), retrotransposons (e.g.
- viruses e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses that incorporate the recombinant polynucleotide.
- “Homologous,” as used herein, refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position.
- the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
- Identity refers to the subunit sequence identity between two polymeric molecules particularly between two amino acid molecules, such as, between two polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage.
- the identity between two amino acid sequences is a direct function of the number of matching or identical positions; e.g., if half (e.g., five positions in a polymer ten amino acids in length) of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
- an“instructional material” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the invention.
- the instructional material of the kit of the invention may, for example, be affixed to a container which contains the nucleic acid peptide and/or composition of the invention or be shipped together with a container which contains the nucleic acid, peptide, and/or composition. Alternatively, the instructional material may be shipped separately from the container with the intention that the instructional material and the compound be used cooperatively by the recipient.
- “Intracellular domain” refers to a portion or region of a molecule that resides inside a cell.
- intracellular signaling domain is meant to include any full-length or truncated portion of the intracellular domain sufficient to transduce the effector function signal.
- isolated means altered or removed from the natural state.
- a nucleic acid or a peptide naturally present in a living animal is not“isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is“isolated.”
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- nucleic acid bases “A” refers to adenosine,“C” refers to cytosine,“G” refers to guanosine,“T” refers to thymidine, and“U” refers to uridine.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
- A“lentivirus,” as used herein, refers to a genus of the Retroviridae family.
- Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses. Vectors derived from lentiviruses offer the means to achieve significant levels of gene transfer in vivo.
- operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
- parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
- plasma cells refer to a type of white blood cells which can produce and secrete antibodies. Plasma cells are also referred to as plasmocytes, plasmacytes, or effector B cells. In some embodiments, these cells comprise B cell precursors capable of B-cell differentiation or B cells in the early stages of B cell differentiation, expressing a m chain on the cell surface as antigen receptor; B cells in which the transcription process has changed and IgM production has changed from membrane-type IgMs to secreted-type IgMs; mature B cells that have completed class- switching and secrete IgGs, IgAs, and IgMs; and B cells in the final stages of
- PLA2R M-type phospholipase A2 receptor
- MN primary membranous nephropathy
- the anti-PLA2R autoantibodies are predominantly of the IgG4 subclass but subclasses IgG1, IgG2, and IgG3 are also represented. Genetic variants of PLA2R were also shown to be associated with MN (Stanescu et al.2011 N Engl J Med; 364(7):616-26).
- a PLA2R fragment refers to a shortened or truncated PLA2R protein.
- the polypeptide can have N-terminus or C-terminus truncations and/or also internal deletions.
- fragments are fragments comprising the C-type lectin domains (“CTLD”) of PLA2R.
- C-type lectin domains (“CTLD”) of PLA2R.
- a PLA2R fragment includes the external domain of PLA2R, which is the amino acid residues 21-1397 of the human PLA2R (UniProtKB, Q13018) or any shorter portion of the amino acid residues 21-1397.
- the term“polynucleotide,” as used herein, is defined as a chain of nucleotides.
- nucleic acids are polymers of nucleotides.
- nucleic acids and polynucleotides are interchangeable.
- nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric“nucleotides.”
- the monomeric nucleotides can be hydrolyzed into nucleosides.
- polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
- a nucleic acid sequence is considered to have at least 95%, 96%, 97%, 98%, or 99% identity or homology to any nucleic acid sequence disclosed herein.
- polypeptide As used herein, the terms“peptide,”“polypeptide,” and“protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence.
- Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified
- polypeptides derivatives, analogs, fusion proteins, among others.
- the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
- an amino acid sequence is considered to have at 95%, 96%, 97%, 98%, or 99% identity or homology to any amino acid sequence described herein.
- proinflammatory cytokine refers to a cytokine or factor that promotes inflammation or inflammatory responses.
- proinflammatory cytokines include but are not limited to chemokines (CCL CXCL CX3CL XCL) interleukins (such as, IL-1, IL-2, IL-3, IL-5, IL-6, IL-7, IL-9, IL10 and IL-15), interferons (IFN ⁇ ), and tumor necrosis factors (TNF ⁇ and TNF ⁇ ).
- promoter is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
- promoter/regulatory sequence means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence.
- this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
- the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
- A“constitutive” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
- An“inducible” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
- A“tissue-specific” promoter is a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type
- A“signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
- the phrase“cell surface receptor” includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
- “Signaling domain” refers to the portion or region of a molecule that recruits and interacts with specific proteins in response to an activating signal.
- the term“subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals).
- a“substantially purified” cell is a cell that is essentially free of other cell types.
- a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
- a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cells that have been separated from the cells with which they are naturally associated in their natural state.
- the cells are cultured in vitro. In other embodiments, the cells are not cultured in vitro.
- therapeutic means a treatment and/or prophylaxis.
- a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
- transfected or“transformed” or“transduced,” as used herein, refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- A“transfected” or“transformed” or“transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
- the cell includes the primary subject cell and its progeny.
- Transmembrane domain refers to a portion or a region of a molecule that spans a lipid bilayer membrane.
- under transcriptional control or“operatively linked,” as used herein, means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
- A“vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
- the term“vector” includes an autonomously replicating plasmid or a virus.
- the term should also be construed to include non-plasmid and non- viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds liposomes and the like
- viral vectors include but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
- telomere binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
- stimulation is meant a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
- a stimulatory molecule e.g., a TCR/CD3 complex
- Stimulation can mediate altered expression of certain molecules, such as downregulation of TGF- ⁇ , and/or reorganization of cytoskeletal structures, and the like.
- A“stimulatory molecule,” as the term is used herein, means a molecule on a T cell that specifically binds with a cognate stimulatory ligand present on an antigen presenting cell.
- A“stimulatory ligand,” as used herein, means a ligand that when present on an antigen presenting cell (e.g., an aAPC, a dendritic cell, a B-cell, and the like) can specifically bind with a cognate binding partner (referred to herein as a“stimulatory molecule”) on a T cell, thereby mediating a primary response by the T cell, including, but not limited to, activation, initiation of an immune response, proliferation, and the like.
- an antigen presenting cell e.g., an aAPC, a dendritic cell, a B-cell, and the like
- a“stimulatory molecule” a cognate binding partner
- Stimulatory ligands are well-known in the art and encompass, inter alia, an MHC Class I molecule loaded with a peptide, an anti-CD3 antibody, a superagonist anti-CD28 antibody, and a superagonist anti-CD2 antibody.
- ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4 from 1 to 5 from 2 to 4 from 2 to 6 from 3 to 6 etc as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range. Description Chimeric Autoantibody Receptor (CAAR)
- the present invention is partly based on the discovery that chimeric autoantibody receptors can be used to target B cells that express autoantibody-based B cell receptors, which after activation and autoantibody secretion, may cause an autoantibody-mediated kidney disease.
- the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- CAAR chimeric autoantibody receptor
- PLA2R anti-phospholipase A2 receptor
- BCR B cell receptor
- compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- the present invention includes a technology for treating an autoantibody- mediated kidney disease.
- technologies that target B cells that ultimately produce the autoantibodies and display the autoantibodies on their cell surfaces mark these B cells as disease-specific targets for therapeutic intervention.
- the invention therefore includes a method for efficiently targeting and killing the pathogenic B cells in autoantibody-mediated kidney diseases by targeting the disease-causing B cells using an antigen-specific (e.g., PLA2R) chimeric autoantibody receptor (or CAAR).
- an antigen-specific e.g., PLA2R
- CAAR chimeric autoantibody receptor
- the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- PHA2R phospholipase A2 receptor
- the CAAR of the invention comprises an autoantibody binding domain otherwise referred to as an autoantigen or a fragment thereof.
- an autoantigen for use in the present invention depends upon the type of autoantibody or BCR being targeted (e.g. anti-PLA2R).
- the autoantigen may be chosen because it recognizes a BCR or autoantibody on a target cell, such as a BCR-expressing B cell, associated with a particular autoantibody mediated kidney disease state, e.g. a glomerular disease and an primary membranous nephropathy.
- the autoantibody binding domain is derived from the same species in which the CAAR will ultimately be used.
- the autoantibody binding domain of the CAAR comprises a human autoantigen (or fragment thereof) that binds a human BCR or autoantibody.
- a genetically engineered chimeric autoantibody receptor includes PLA2R or fragments thereof, which binds an anti-PLA2R BCR, e.g., anti-PLA2R BCR on a B cell in a subject.
- the CAAR comprises an extracellular domain of PLA2R.
- the extracellular domain of PLA2R comprises an N- terminal cysteine rich domain (Ricin B type lectin domain), a Fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, a C-type lectin domain 7, or a combination of any of the foregoing.
- the extracellular domain of PLA2R comprises the immunodominant epitope, N-terminal cysteine rich (CysR) domain (Ricin B type lectin domain), encoded by SEQ ID NO: 1, a Fibronectin type II domain encoded by SEQ ID NO: 3, a C-type lectin domain 1 encoded by SEQ ID NO: 5, and a C-type lectin domain 2 encoded by SEQ ID NO: 7.
- This extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4027.CF12 herein and is encoded by SEQ ID NO: 8, wherein the linker between the immunodominant epitope, N-terminal cysteine rich domain and the Fibronectin type II domain is encoded by SEQ ID NO: 2 and the linker between the Fibronectin type II domain and the C-type lectin domain 1 is encoded by SEQ ID NO: 4, and the linker between the C-type lectin domain 1 and the C- type lectin domain 2 is encoded by SEQ ID NO: 6.
- the extracellular domain of PLA2R comprises the extracellular domain of construct 4027.CF12 and additionally a C-type lectin domain 3 encoded by SEQ ID NO: 14.
- This latter extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4028.CF123 herein and is encoded by SEQ ID NO: 15, wherein the linkers between the immunodominant epitope, N-terminal cysteine rich domain, the Fibronectin type II, the C-type lectin domain 1 and the C-type lectin domain 2 are the same as those listed above herein for construct 4027.CF12 (SEQ ID NOS: 2, 4 and 6) and further wherein the linker between the C-type lectin domain 2 and the C-type lectin domain 3 is encoded by SEQ ID NO: 13.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C, comprising a cysteine rich domain.
- the cysteine rich domain comprises SEQ ID NO: 49, and may be encoded by SEQ ID NO: 47.
- the cysteine rich domain comprises SEQ ID NO: 1.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1, comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1.
- the extracellular domain comprises SEQ ID NO: 51, and may be encoded by SEQ ID NO: 50.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
- the extracellular domain comprises SEQ ID NO: 53, and may be encoded by SEQ ID NO: 52.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1237, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 55, and may be encoded by SEQ ID NO: 54.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF17, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C- type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 57, and may be encoded by SEQ ID NO: 56.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C17, comprising a cysteine rich domain, a C-type lectin domain 1, and a C-type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 59, and may be encoded by SEQ ID NO: 58.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4025.C, comprising a cysteine rich domain.
- the extracellular domain comprises SEQ ID NO: 61, and may be encoded by SEQ ID NO: 60.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4026.CF1, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1.
- the extracellular domain comprises SEQ ID NO: 40, and may be encoded by SEQ ID NO: 39.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4027.CF12, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 2.
- the extracellular domain comprises SEQ ID NO: 70, and may be encoded by SEQ ID NO: 8.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4028.CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
- the extracellular domain comprises SEQ ID NO: 71, and may be encoded by SEQ ID NO: 15.
- the autoantigen or a fragment thereof comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NO: 49, 51, 53, 55, 57, 59, 61, 63, 70 or 71.
- the autoantigen or a fragment thereof is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least or 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 8, 15, 47, 50, 52, 54, 56, 58, 60, or 62. Transmembrane domain
- the PLA2R CAAR comprises a transmembrane domain that is fused to the extracellular domain of the PLA2R CAAR.
- the PLA2R CAAR comprises a transmembrane domain that naturally is associated with one of the domains in the PLA2R CAAR.
- the transmembrane domain is selected or modified by amino acid substitution to avoid binding to the transmembrane domains of the same or different surface membrane proteins in order to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source. When the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one embodiment, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In one aspect a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain Optionally a short oligo- or polypeptide linker, between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the PLA2R CAAR. A glycine-serine doublet provides a particularly suitable linker.
- spacer domains before the transmembrane domain can be employed as well including a hinge (e.g. a CD8 or human Ig (immunoglobulin) hinge), or a glycine-serine (GS) linker.
- a hinge e.g. a CD8 or human Ig (immunoglobulin) hinge
- GS glycine-serine
- hinge and/or transmembrane domain examples include, but are not limited to, a hinge and/or transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, killer immunoglobulin-like receptor (KIR), OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R ⁇ , ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d,
- the PLA2R CAAR comprises a transmembrane domain, such as, but not limited to, a CD8 alpha transmembrane domain.
- the CD8 alpha transmembrane domain comprises the amino acid sequence
- the CD8 alpha transmembrane domain is encoded by the nucleotide sequence
- the transmembrane domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94% at least 95% at least 96% at least 97% at least 98% or at least 99% sequence identity to SEQ ID NO: 19, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
- the PLA2R CAAR comprises a hinge domain such as, but not limited to, a CD8 alpha hinge domain.
- the hinge domain comprises the amino acid sequence
- the hinge domain comprises the amino acid sequence FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- the hinge domain is encoded by the nucleotide sequence of SEQ ID NO: 10. In some embodiments, the hinge domain is encoded by the nucleotide sequence
- the hinge domain is encoded by the nucleotide sequence
- the PLA2R CAAR comprises a transmembrane domain and a hinge domain.
- the hinge domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO:43 or SEQ ID NO: 44, or is encoded by a nucleic acid sequence that has at least 60% at least 65% at least 70% at least 75% at least 80% at least 81% at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least
- the PLA2R CAAR comprises a glycine serine (GS) linker.
- the PLA2R CAAR comprises a GS linker and a transmembrane domain.
- the GS linker is encoded by the nucleotide sequence: GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 68).
- the GS linker comprises the amino acid sequence: GGGGSGGGGS (SEQ ID NO: 69).
- the PLA2R CAAR comprises an intracellular domain of a costimulatory molecule.
- the intracellular domain of a costimulatory molecule of the PLA2R CAAR of the invention is a cytoplasmic domain responsible for the activation of at least one of the normal effector functions of the immune cell in which the PLA2R CAAR has been placed in.
- Effector function of a T cell may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular domain of a costimulatory molecule refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While the entire intracellular domain of a costimulatory molecule can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular domain of a costimulatory molecule is used, such truncated portion may be used in place of the intact domain as long as it transduces the effector function signal.
- the intracellular domain of a costimulatory molecule refers to a portion of the CAAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- Examples of such molecules include CD27 CD28 4 1BB (CD137) OX40 CD30 CD40 PD 1 ICOS lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TR
- the nucleic acid sequence of the intracellular domain of a costimulatory molecule encodes an amino acid sequence comprising costimulatory molecule 4-1BB (also known and referred to as CD137) intracellular domain:
- nucleic acid sequence encoding the 4-1BB intracellular domain comprises:
- the nucleic acid sequence encoding the 4-1BB intracellular domain comprises: SEQ ID NO: 66.
- the human intracellular 4-1BB domain provides co-stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R, or a fragment thereof, without the need of its original ligand.
- the intracellular domain of a costimulatory molecule comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75% at least 80% at least 81% at least 82% at least 83% at least 84% at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 21, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
- primary cytoplasmic signaling sequences those that initiate antigen-dependent primary activation through the TCR
- secondary cytoplasmic signaling sequences those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal
- the PLA2R CAAR comprises a signaling domain.
- Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory manner or in an inhibitory manner.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary signaling sequences examples include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that signaling molecule in the CAAR of the invention comprises a signaling domain derived from CD3-zeta.
- the signaling domain of the CAAR can be designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAAR of the invention.
- the signaling domain of the CAAR can comprise a CD3 zeta chain portion and a costimulatory signaling domain.
- the PLA2R CAAR comprises a CD3-zeta signaling domain by itself or in combination with any other desired cytoplasmic domain(s) useful in the context of the PLA2R CAAR of the invention.
- the PLA2R CAAR can comprise a CD3 zeta chain portion and an intracellular domain of a costimulatory molecule.
- the CD3 zeta chain portion is a human T-cell surface glycoprotein CD3 zeta chain isoform 3 intracellular domain (human CD247).
- the human intracellular CD3 zeta domain provides stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R or a fragment thereof, without HLA restriction.
- the nucleic acid sequence of the signaling domain comprises a nucleic acid sequence encoding a CD3 zeta signaling domain. In another embodiment, the nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising
- nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising
- nucleic acid sequence encoding the CD3 zeta signaling domain comprises:
- nucleic acid sequence encoding the CD3 zeta signaling domain comprises SEQ ID NO: 74.
- the signaling domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 23 or SEQ ID NO: 45, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%
- the PLA2R CAAR and the polynucleotide encoding the PLA2R CAAR comprise a human T cell surface glycoprotein CD8 alpha chain signal peptide.
- the human CD8 alpha signal peptide is responsible for the translocation of the receptor to the T cell surface.
- the polynucleotide encoding the PLA2R CAAR comprises a nucleic acid sequence of a peptide linker.
- the PLA2R CAAR comprises a peptide linker.
- the cytoplasmic signaling sequences within the intracellular signaling domain of the PLA2R CAAR can be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example, between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet is a particularly suitable linker.
- the CAAR comprises a transmembrane domain and/or a cytoplasmic (intracellular) domain from a killer immunoglobulin-like receptor (KIR) family protein.
- the KIR gene family has at least 15 gene loci (KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5 KIR3DL1/S1 KIR3DL2 KIR3DL3) and two pseudogenes (KIR2DP1 and KIR3DP1) encoded within a 100-200 Kb region of the Leukocyte Receptor Complex (LRC) located on chromosome 19 (19q13.4).
- LRC Leukocyte Receptor Complex
- a cell comprising the CAAR of the invention comprising a KIR transmembrane domain and/or cytoplasmic domain may also comprise a polynucleotide encoding DAP10 or DAP12.
- the KIR is KIRS2 or KIR2DS2
- the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39.
- the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, 40, and 42.
- the CAAR comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NOs: 12, and 18, 26, 28, 30, 32, 34, 36, 38, or 40.
- the CAAR is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 11, 17, 25, 27, 29, 31, 33, 35, 37, or 39.
- Vector Comprising the PLA2R CAAR is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at
- a 3 rd generation self-inactivating lentiviral vector plasmid can be used in which the expression of the CAR is regulated by the human elongation factor 1 alpha promoter This results in stable (permanent) expression of the CAR in the host T cell.
- the encoding mRNA can be electroporated into the host cell, which would achieve the same therapeutic effect as the virally transduced T cells, but would not be permanent because the mRNA would dilute out with cell division.
- the invention includes a vector comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide comprises an extracellular domain comprising a human PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, and/or an intracellular signaling domain.
- the vector comprises any of the nucleic acid sequences encoding the CAAR as described herein.
- the vector comprises a plasmid vector, viral vector, retrotransposon (e.g. piggyback, sleeping beauty), site directed insertion vector (e.g. CRISPR, Zinc finger nucleases, TALEN), or suicide expression vector, or other known vector in the art.
- the vector is a viral vector, such as a lentiviral vector.
- the vector is a RNA vector.
- the expression of the PLA2R CAAR can be verified by sequencing. Expression of the full length CAAR protein may be verified using immunoblot,
- the present invention also provides a vector in which DNA encoding the CAAR of the present invention is inserted.
- Vectors including those derived from retroviruses such as lentivirus, are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses, such as murine leukemia viruses, in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of resulting in low immunogenicity in the subject into which they are introduced.
- the expression of natural or synthetic polynucleotides encoding CAARs is typically achieved by operably linking a nucleic acid encoding the CAAR polypeptide or portions thereof to a promoter (e g EF1alpha promoter) and incorporating the construct into an expression vector.
- the vector is one generally capable of replication in a mammalian cell, and/or also capable of integration into the cellular genome of the mammal.
- Typical vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
- the nucleic acid can be cloned into any number of different types of vectors.
- the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- the expression vector may be provided to a cell in the form of a viral vector.
- Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals.
- Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No.
- promoter elements e.g., enhancers
- promoters regulate the frequency of transcriptional initiation.
- these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
- the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
- tk thymidine kinase
- the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- individual elements can function either cooperatively or independently to activate transcription.
- CMV immediate early cytomegalovirus
- This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
- other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, the elongation factor- la promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, when appropriate for use in a CAAR construct.
- SV40 simian virus 40
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- LTR
- inducible promoters are also contemplated as part of the invention.
- the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence, which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
- inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
- an inducible promoter is activated in response to a extracellular ligand.
- the inducible promoter is activated (and the expression of the CAAR is regulated) by an extracellular ligand binding to a synthetic receptor.
- a synthetic receptor e.g., a synthetic Notch receptor (i.e.,
- “synNotch”) may be employed as a binding-triggered transcriptional switch that, when bound to its ligand, activates a promoter to which a nucleic acid sequence encoding the CAAR is operably linked. Accordingly, as a non-limiting example, such systems may require the presence of a ligand (e.g., to which the synNotch binds) for the immune cell to be responsive to a BCR or autoantibody (e.g., to which the CAAR binds). The requirement of particular combinations to generate certain signaling outputs in molecular circuits results in a logic gate. See, for example, Roybal et al, 2016 Cell l64(4):770-9.
- Examples of other systems for expressing or regulating expression of a chimeric receptor include those described in Wu et al. (2015) Science 350: aab4077; Fedorov et al. (2014) Cancer Journal 20: 160-165; Kloss et al. (2013) Nature Biotechnology 31 : 71-75; Sakemura et al. (2016) Cancer Immunol. Res. 4:658-668; Hill et al. (2016) Nature Chemical Biology 14:112-117; Di Stasi et al. (2011) N. Engl. J. Med.365:1673-1683; Budde et al. (2013) PLoS One 8: e82742; Wei et al. (2012) Nature 488: 384-388; Ma et al. (2016) Proc.
- the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
- the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
- Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
- Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assessed at a suitable time after the DNA has been introduced into the recipient cells.
- Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
- Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
- the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter- driven
- the vector can be readily introduced into a host cell, e g mammalian bacterial yeast or insect cell by any method in the art
- the expression vector can be transferred into a host cell by physical, chemical, or biological means.
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection,
- RNA vectors include vectors having a RNA promoter and/ other relevant domains for production of a RNA transcript.
- Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors may be derived from lentivirus, poxviruses, herpes simplex virus, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos.5,350,674 and 5,585,362.
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
- an exemplary delivery vehicle is a liposome.
- lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
- the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution
- they may be present in a bilayer structure, as micelles, or with a“collapsed” structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape.
- Lipids are fatty substances, which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- Lipids suitable for use can be obtained from commercial sources.
- DMPC dimyristyl phosphatidylcholine
- DCP dicetyl phosphate
- Choi cholesterol
- DMPG phosphatidylglycerol
- Avanti Polar Lipids, Inc. (Birmingham, AL.).
- Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- compositions that have different structures in solution than the normal vesicular structure are also encompassed.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- lipofectamine-nucleic acid complexes are also contemplated.
- the invention includes a genetically modified cell comprising the PLA2R chimeric autoantibody receptor (CAAR) disclosed herein.
- CAAR PLA2R chimeric autoantibody receptor
- the genetically modified cell expresses the PLA2R CAAR.
- the cell has high affinity for PLA2R autoantibody-based B cell receptors (BCRs) on B cells or rarely, on B cells that have differentiated into plasma cells that have not yet downregulated their BCR.
- BCRs PLA2R autoantibody-based B cell receptors
- the genetically modified cell can induce direct killing of anti-PLA2R B cells or indirect killing of plasma cells expressing PLA2R autoantibodies.
- the genetically modified cell has low affinity for antibodies bound to an Fc receptor.
- the genetically modified cell is a T cell, such as a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, cytokine induced killer cell, a cell line thereof, a T memory stem cell, or other T effector cell. It is also useful for the T cell to have limited toxicity toward healthy cells and specificity to cells expressing autoantibodies. Such specificity prevents or reduces off-target toxicity that is prevalent in current therapies that are not specific for autoantibodies. In one embodiment, the T cell has limited toxicity toward healthy cells. In one embodiment the T cell is an autologous cell. In another embodiment, the T cell is an allogeneic cell.
- the invention includes genetically modified immune cells derived from pluripotent stem cells that were differentiated in vitro.
- the invention includes T cells, such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
- T cells such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
- T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
- a transduced Jurkat cell line with a NFAT response element followed by GFP can be used to detect and isolate PLA2R specific B cells and to clone the PLA2R specific antibody repertoire in a comprehensive and unbiased fashion.
- the interacting B and Jurkat cells can be detected as GFP positive doublets or multimers and sorted by flow cytometry.
- PLA2R - PLA2R truncations of PLA2R based on major disease epitopes are also useful and included herein. Versions using a different length hinge region or GS linker are also useful. With regard to safety, preventing or reducing possible homophilic and heterophilic interactions and activation (e.g. PLA2R - PLA2R) between the transduced cells or toward podocytes is preferred.
- Constructs can be transiently transfected into human cells, such as 293T/17.
- the surface expression can be detected with monoclonal antibodies (either IgG or ScFv) or serum antibodies from PLA2R MN patients specific for the abovementioned extracellular domains, the linker between the domains, or other structure included in the CAAR.
- Binding can be verified with specific secondary antibodies and quantified by flow cytometry.
- Production of membrane expressed constructs of human anti- PLA2R antibodies of any isotype can serve as target cells for testing the different PLA2R-CAARs.
- Additional target cell lines can be produced as needed by expression of human monoclonal antibodies on the surface of cell lines (e.g. Nalm6 or K562 cells).
- autoimmune Diseases e.g., IL-6 or K562 cells.
- the present invention also provides methods for preventing, treating and/or managing a disorder or autoimmune disease associated with autoantibody-expressing cells in the context of an autoantibody-mediated kidney disease.
- the methods comprise administering to a subject in need thereof a genetically modified T cell comprising the CAAR of the invention that binds to the autoantibody expressing cell
- the subject is a human.
- Non-limiting examples of an autoantibody-mediated kidney disease include to glomerular disease and primary membranous nephropathy.
- T cells isolated from a subject can be modified to express the appropriate CAAR, expanded ex vivo and then reinfused into the same subject (e.g., the T cells are autologous T cells).
- the T cells are reinfused into a different subject than the original T cells’ donor (e.g., the T cells are allogeneic T cells).
- the modified T cells recognize target cells, such as anti-PLA2R B cells or PLA2R autoantibody producing B cells or plasma cells, and become activated, resulting in killing of the autoimmune target cells.
- Relapse may also occur in patients with an autoimmune disease, for example in primary membranous nephropathy patients.
- the relapse may be mediated by persistence of the same autoantibody B cell clones, whereas remission is associated with disappearance of these clones.
- the autoimmune cells are depleted to induce long-term remission, possibly due to the longevity of the PLA2R CAAR T cells and/or autoantigen-reactive clones do not re- appear.
- PLA2R CAAR cells can further express a detectable marker.
- the detectable marker is activated and expressed, which can be detected by assays known in the art, such as flow cytometry.
- the PLA2R CAAR includes a NFAT response element and a detectable marker, such as a green fluorescent protein (GFP), to detect and quantify PLA2R CAAR expressing cells.
- GFP green fluorescent protein
- T cells Prior to expansion and genetic modification, T cells (e.g., autologous or allogeneic T cells) are obtained from a subject. Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including skin, peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention any number of T cell lines available in the art may be used In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
- cells from the circulating blood of an individual are obtained by apheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Again, surprisingly, initial activation steps in the absence of calcium lead to magnified activation.
- a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated“flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer’s instructions.
- a semi-automated“flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
- the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
- the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
- T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL TM gradient or by counterflow centrifugal elutriation.
- a specific subpopulation of T cells such as CD3 + , CD28 + , CD4 + , CD8 + , CD45RA + , and
- CD45RO + T cells can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3x28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
- the time period is about 30 minutes.
- the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
- the time period is at least 1, 2, 3, 4, 5, or 6 hours.
- the time period is 10 to 24 hours In one preferred embodiment the incubation time period is 24 hours.
- TIL tumor infiltrating lymphocytes
- subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
- multiple rounds of selection can also be used in the context of this invention.
- Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- One method is cell sorting and/or selection via negative magnetic
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
- T regulatory cells are depleted by anti-CD25 conjugated beads or other similar method of selection.
- subpopulation of T cells such as, but not limited to, cells positive or expressing high levels of one or more surface markers e.g. CD28+, CD8+, CCR7+, CD27+, CD127+, CD45RA+, and/or CD45RO+ T cells can be isolated by positive or negative selection techniques
- concentration of cells and surface e.g., particles such as beads
- a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion.
- CD28-negative T cells or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain.
- using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
- the concentration of cells used is 5 X 10 6 /ml. In other embodiments, the concentration used can be from about 1 X 10 5 /ml to 1 X 10 6 /ml, and any integer value in between.
- the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10°C or at room temperature.
- T cells for stimulation can also be frozen after a washing step.
- the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25%
- suitable cell freezing media containing for example, Hespan and PlasmaLyte A
- Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C or in liquid nitrogen.
- cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
- a blood sample or an apheresis product is taken from a generally healthy subject.
- a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
- the T cells may be expanded, frozen, and used at a later time.
- samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
- the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH anti CD3 antibodies cytoxan fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
- agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH anti CD3 antibodies cytoxan flu
- These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- rapamycin growth factor induced signaling
- the cells are isolated prior to and can be frozen for later use for treatment following B-cell ablative therapy, e.g., Rituxan.
- T cells are obtained from a patient directly following treatment.
- the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
- these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
- mobilization for example, mobilization with GM-CSF
- conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
- Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system. Activation and Expansion of T Cells
- T cells are activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358;
- the T cells of the invention are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
- T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
- a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
- a population of T cells can be contacted with an anti-CD3 antibody and an anti- CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc.30(8):3975-3977, 1998; Haanen et al., J. Exp. Med.190(9):13191328, 1999; Garland et al., J. Immunol Meth.227(1-2):53-63, 1999).
- the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
- the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in“cis” formation) or to separate surfaces (i.e., in“trans” formation).
- one agent may be coupled to a surface and the other agent in solution.
- the agent providing the co- stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
- the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- the two agents are immobilized on beads, either on the same bead, i.e.,“cis,” or to separate beads, i.e.,“trans.”
- the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co stimulatory signal is an anti CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
- a 1:1 ratio of each antibody bound to the beads for CD4 + T cell expansion and T cell growth is used.
- a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one embodiment, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present invention, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain embodiments of the invention, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
- a 1:100 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:75 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:50 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:30 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:10 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:3 CD3:CD28 ratio of antibody bound to the beads is used.
- a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
- Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
- the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
- the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
- the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1 7:1 8:1 9:1 10:1 and 15:1 with one preferred ratio being at least 1:1 particles per T cell.
- a ratio of particles to cells of 1:1 or less is used.
- a preferred particle: cell ratio is 1:5.
- the ratio of particles to cells can be varied depending on the day of stimulation.
- the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition).
- the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation.
- the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation.
- ratios will vary depending on particle size and on cell size and type.
- the cells such as T cells
- the cells are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured.
- the agent- coated beads and cells prior to culture, are not separated but are cultured together.
- the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
- cell surface proteins may be ligated by allowing
- the cells for example, 10 4 to 10 9 T cells
- beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1
- a buffer for example PBS (without divalent cations such as, calcium and magnesium).
- the target cell may be very rare in the sample and comprise only 001% of the sample or the entire sample (i e 100%) may comprise the target cell of interest. Accordingly, any cell number is within the context of the present invention.
- a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion.
- CD28-negative T cells Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments.
- using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
- the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for 21 days. In one embodiment of the invention the beads and the T cells are cultured together for about eight days. In another embodiment, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
- Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
- Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
- Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
- Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
- the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO 2 ).
- T cells that have been exposed to varied stimulation times may exhibit different characteristics.
- typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (T H , CD4 + ) that is greater than the cytotoxic or suppressor T cell population (T C , CD8 + ).
- T H , CD4 + helper T cell population
- T C cytotoxic or suppressor T cell population
- Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of T H cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of T C cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising
- T C cells or T H cells predominately of T C cells or T H cells may be advantageous. Similarly, if an antigen-specific subset of T C cells has been isolated it may be beneficial to expand this subset to a greater degree.
- the invention includes a method for treating an autoantibody- mediated kidney disease in a subject.
- the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody-mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk or suffering from an autoantibody-mediated kidney disease.
- the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a CAAR, wherein the polynucleotide encodes a PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
- the autoantibody-mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous nephropathy, e.g., a primary membranous nephropathy mediated by or otherwise associated with a known anti-PLA2R autoantibody and/or BCR.
- the subject is a human.
- the anti-autoantibody immune response elicited by the CAAR-modified T cells may be an active or a passive immune response.
- the modified T cell targets a B cell.
- autoantibody expressing B cells may be susceptible to indirect destruction by CAAR-redirected T cells that have previously reacted against adjacent autoantibody- expressing cells.
- the genetically modified T cells of the invention are modified by a fully-human CAAR.
- the fully-human CAAR-genetically modified T cells may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal.
- the mammal is a human.
- cells are isolated from a mammal (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAAR disclosed herein.
- the CAAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
- the mammalian recipient may be a human and the CAAR-modified cell can be autologous with respect to the recipient.
- the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
- ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
- other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
- the present invention also includes compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
- the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are
- the PLA2R CAAR-modified T cells of the invention are used in the treatment of diseases, disorders and conditions associated with expression of autoantibodies.
- the cells of the invention are used in the treatment of patients at risk for developing autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies.
- the present invention provides methods for the treatment or prevention of autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies (PLA2R) comprising administering to a subject in need thereof, a therapeutically effective amount of the CAAR-modified T cells of the invention.
- compositions of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
- pharmaceutical compositions of the present invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers diluents or excipients
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- Compositions of the present invention are in one aspect formulated for intravenous administration.
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient’s disease, although appropriate dosages may be determined by clinical trials.
- compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages.
- the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med.319:1676, 1988).
- the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
- activated T cells are administered to a subject.
- T cells are activated and expanded therefrom using the methods described here, and are then reinfused back into the patient. This process can be carried out multiple times every few weeks.
- T cells can be activated from blood draws of from 10cc to 400cc.
- T cells are activated from blood draws of 20cc, 30cc, 40cc 50cc 60cc 70cc 80cc 90cc or 100cc Not to be bound by theory using this multiple blood draw/multiple reinfusion protocol, may select out certain populations of T cells.
- the cells of the invention to be administered may be autologous, allogeneic or xenogeneic with respect to the subject undergoing therapy.
- Administration of the cells of the invention may be carried out using any convenient means, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
- the compositions described herein may be administered to a patient transarterially, subcutaneously, intradermally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
- the T cell compositions of the present invention are administered to a patient by intradermal or subcutaneous injection.
- the T cell compositions of the present invention are administered by i.v. injection.
- the compositions of T cells may be injected directly into a lymph node, or other site of pathophysiologic activity.
- cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as immunosuppressive agents, such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, Cytoxan, fludarabine, mycophenolic acid, steroids, FR901228, cytokines, and irradiation.
- immunosuppressive agents such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents
- CAMPATH anti-CD3 antibodies or other antibody therapies
- These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- cyclosporine and FK506 calcium dependent phosphatase calcineurin
- p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
- chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
- the cell compositions of the present invention are administered following B cell ablative therapy such as agents that react with CD20 e g Rituxan
- the T cells of the invention may be used in combination with complement inhibitors to reduce risk of complement-mediated cytotoxicity or an antibody anti-FcRn, IVIg, or plasmapheresis in order to reduce the anti-PLA2R antibody concentration before therapy.
- a mild lymphodepletion regimen e.g. Low-dose fludarabine or Cytoxan
- the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
- the scaling of dosages for human administration can be performed according to art-accepted practices.
- the dose for CAMPATH for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days.
- the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Patent No.6,120,766).
- Cysteine-rich (CysR) domain (Ricin B type lectin domain) (SEQ ID NO: 1)
- Linker between ricin B type lectin domain and fibronectin type II domain (SEQ ID NO: 2)
- Fibronectin type II domain (SEQ ID NO: 3)
- CD8 TMD 2374-2445 (SEQ ID NO: 20)
- CD3zeta intracellular domain 2572-2907 (SEQ ID NO: 24)
- 293T cells were transfected at a confluence of 90% with a mixture of the pTRPE- gene-of-interest, the packaging plasmid pGAG-Pol and pRSV-Rev and the envelope plasmid pCI VSVg in a complex with Lipofectamine 2000.
- Lentivirus containing supernatant was harvested after 24 and 48 hours, filtered through a 0.45 micron polyethersulfone (PES) membrane, concentrated at 12,000ug for 24 hours at 4°C, and stored at -80°C. - Stimulation, transduction, and expansion of primary human T cells.
- PES polyethersulfone
- Jurkat cells were cultured at 37°C with 5% CO2 in a completely humidified environment using RPMI1640, HEPES 10mM, and FBS at 10%.
- the CAAR constructs were expressed in a Jurkat reporter cell line that has been selected (G418) for stable expression of GFP controlled under an NFAT response element, facilitating GFP expression after CAAR engagement and PLCgamma and IP3 mediated intracellular calcium release.
- Jurkat-NFAT-GFP cells 1 million Jurkat-NFAT-GFP cells were transduced with each lentivirus encoding for PLA2R CAAR construct C, CF1, CF123, CF1237, CD17, C17, 4025.C, 4026.CF1, 4027.CF12, 4028.CF123 and untransduced Jurkat cells were used as negative control.
- Transduced and untransduced cells were plated in a 96-well plate at 2x10 5 cells/well in 100 ml cell culture medium.
- the stimulation conditions were as follows:
- transduced and untransduced cells were plated in a 96-well plate at 5u10 4 cells/well in 100ml cell culture medium.
- PLA2R CAAR or mock transduced primary human T cells were cultured for 24h at 5u10 4 /well in a 96-well plate coated with 10 mg/ml either IgG purified from plasma of patient with primary membranous nephropathy or control human IgG. Culture supernatants were then harvested for detection of IFN- J by ELISA. - In vivo efficacy testing of CAAR T cells
- anti-PLA2R BCR-expressing cells for example hybridoma cells or human cell lines, targeting human PLA2R are generated.
- PLA2R BCR-expressing cells are transduced with lentiviral vectors expressing click-beetle green or click-beetle red luciferase and GFP.
- approximately 2u10 5 anti-PLA2R cells are injected intravenously into NSG mice (age 6-8 weeks), after pre-treatment of mice daily for 2 days with 600 mg/kg intravenous immunoglobulin to minimize FcJR-mediated toxicity against BCR-expressing cells.
- PLA2R CAAR T cells (approximately 10 7 cells per mouse) are injected intravenously. Bioluminescence and/or serum
- PLA2R constructs representing different domains of the PLA2R were cloned into a CAAR expression system (4025.C, 4026.CF1, Construct 4027.CF12 and
- PLA2R CAAR constructs illustrated in Figures 2A-2G All constructs use the CD8 transmembrane domain and BBZ intracellular domain and differ in their extracellular composition.
- Construct 4025.C was comprised of a cysteine rich extracellular domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2A, SEQ ID NOs: 37 & 38).
- Construct 4026.CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct 4026.CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2B, SEQ ID NOs: 39 & 40).
- Construct 4027.CF12 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 2 domain. Construct 4027.CF12 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain (Figure 2C, SEQ ID NOs: 11 & 12).
- Construct 4028.CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Construct 4028.CF123 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2D, SEQ ID NOs: 17 & 18). A detailed map of PLA2R CAAR Construct 4028.CF123 is shown in Figure 3A.
- FIG. 4 shows the PLA2R CAAR expression.
- the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured by staining with soluble anti-PLA2R monoclonal antibody conjugated to PE.
- Figures 5 and 6 show T cell activation by GFP expression of Jurkat cells transduced with the indicated constructs. Negative and positive controls are shown in Figure 5. Test samples are shown in Figure 6.
- Figure 5 depicts the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA+ionomycin (bottom, positive control).
- Figure 6 illustrates the activation of PLA2R CAAR T cells by specific antibodies measured as GFP expression by Jurkat NFAT-GFP cells (6h activation). No evidence of T cell activation is seen in construct 4025.C and untransduced cells upon exposure to the monoclonal anti-PLA2R Mab or the polyclonal anti-PLA2R Ab. Specific T cell activation in response to cross-linking by the monoclonal anti-PLA2R Ab but not the polyclonal anti-PLA2R Ab is seen using constructs 4027.CF12 and 4028.CF123.
- Example 2 Example 2:
- Construct C was comprised of a cysteine rich domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2A, SEQ ID NOs: 25 & 26).
- Construct CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2B SEQ ID NOs: 27 & 28) Construct CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Also included in construct CF123 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2C, SEQ ID NOs: 29 & 30).
- Construct CF1237 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, a C-type lectin 3 domain and a C-type lectin 7 domain. Additionally included in construct CF1237 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( Figure 2D, SEQ ID NOs: 31 & 32).
- Construct CF17 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct CF17 also included a GS linker, a CD8 transmembrane domain, a 4- 1BB intracellular domain and CD3 zeta signaling domain (Figure 7E, SEQ ID NOs: 33 & 34).
- Construct Cl 7 was comprised of an extracellular domain comprising a cysteine rich domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct Cl 7 also included a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain (Figure 7F, SEQ ID NOs: 35 & 36).
- the various PLA2R CAAR constructs were transduced into Jurkat cells and primary human T cells. Surface expression of the PLA2R CAARs was assessed by flow cytometry using MN patient IgG, followed by APC-labeled anti-human IgG secondary antibody. All of the transduced Jurkat ( Figure 7A) and primary human T cells ( Figure 7B), but not the untransduced control cells, exhibited detectable surface expression of the CAAR constructs.
- PLA2R CAAR T cells were exposed to either plate-bound MN patient IgG or control human IgG for 24h. IFN-J secretion was measured by ELISA of culture supernatants. MN patient IgG stimulated markedly higher IFN-J production compared to the control human IgG, reflecting primary human CAAR T cell activation after target engagement ( Figure 9).
- Figure 9 The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Urology & Nephrology (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Transplantation (AREA)
- Rheumatology (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2020011610A MX2020011610A (es) | 2018-05-02 | 2019-05-02 | Composiciones y métodos de células t receptoras de autoanticuerpo quimérico del receptor de fosfolipasa a2. |
| CA3098865A CA3098865A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| JP2020561076A JP7519906B2 (ja) | 2018-05-02 | 2019-05-02 | ホスホリパーゼa2受容体キメラ自己受容体t細胞の組成物および方法 |
| CN201980042269.7A CN112312930A (zh) | 2018-05-02 | 2019-05-02 | 磷脂酶a2受体嵌合自身抗体受体t细胞的组合物和方法 |
| AU2019262131A AU2019262131A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| US17/051,248 US20210095001A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| EP19796773.0A EP3813885A4 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| KR1020207033822A KR20210007998A (ko) | 2018-05-02 | 2019-05-02 | 포스포리파제 a2 수용체 키메라 자가항체 수용체 t 세포의 조성물 및 방법 |
| US17/543,429 US11884716B2 (en) | 2018-05-02 | 2021-12-06 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| JP2024027975A JP2024059867A (ja) | 2018-05-02 | 2024-02-28 | ホスホリパーゼa2受容体キメラ自己受容体t細胞の組成物および方法 |
| US18/640,092 US20240383965A1 (en) | 2018-05-02 | 2024-04-19 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862665863P | 2018-05-02 | 2018-05-02 | |
| US62/665,863 | 2018-05-02 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/051,248 A-371-Of-International US20210095001A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| US17/543,429 Continuation US11884716B2 (en) | 2018-05-02 | 2021-12-06 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| US18/640,092 Continuation US20240383965A1 (en) | 2018-05-02 | 2024-04-19 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019213434A1 true WO2019213434A1 (en) | 2019-11-07 |
Family
ID=68386834
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/030459 Ceased WO2019213434A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US20210095001A1 (enExample) |
| EP (1) | EP3813885A4 (enExample) |
| JP (2) | JP7519906B2 (enExample) |
| KR (1) | KR20210007998A (enExample) |
| CN (1) | CN112312930A (enExample) |
| AU (1) | AU2019262131A1 (enExample) |
| CA (1) | CA3098865A1 (enExample) |
| MX (1) | MX2020011610A (enExample) |
| WO (1) | WO2019213434A1 (enExample) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527507A (zh) * | 2020-04-16 | 2021-10-22 | 上海赛比曼生物科技有限公司 | 靶向cd22的嵌合抗原受体及其制法和应用 |
| WO2022136503A1 (en) | 2020-12-22 | 2022-06-30 | Deutsches Zentrum Für Neurodegenerative Erkrankungen E. V. (Dzne) | Chimeric autoantibody receptor (caar) comprising a nicotinic acetylcholine receptor autoantigen |
| EP4083061A1 (en) * | 2021-04-30 | 2022-11-02 | Kilometro Rosso SPA | Fusion proteins and use thereof in the treatment of membranous nephropathy |
| EP4380963A4 (en) * | 2021-08-05 | 2025-06-04 | The Trustees of The University of Pennsylvania | Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170151281A1 (en) | 2015-02-19 | 2017-06-01 | Batu Biologics, Inc. | Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer |
| US10980836B1 (en) | 2019-12-11 | 2021-04-20 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| EP4240367A4 (en) | 2020-11-04 | 2024-10-16 | Myeloid Therapeutics, Inc. | MODIFIED CHIMERIC FUSION PROTEIN COMPOSITIONS AND METHODS OF USE THEREOF |
| WO2022197949A2 (en) | 2021-03-17 | 2022-09-22 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| BR112023023642A2 (pt) | 2021-05-11 | 2024-01-30 | Myeloid Therapeutics Inc | Métodos e composições para integração genômica |
| JP2024545870A (ja) * | 2021-12-15 | 2024-12-13 | シャンハイ シンヴィダ バイオテクノロジー カンパニー リミテッド | 血小板減少症を治療するための製品及び方法 |
| CN114588881B (zh) * | 2022-03-07 | 2023-07-18 | 大连理工大学 | 免疫吸附剂及其制备方法 |
| CN116082517B (zh) * | 2022-05-26 | 2025-08-22 | 成都地奥制药集团有限公司 | 融合蛋白及其用途 |
| KR20250057777A (ko) | 2022-07-25 | 2025-04-29 | 인테리우스 바이오테라퓨틱스, 인코포레이티드 | 돌연변이된 폴리펩티드, 이를 포함하는 조성물, 및 그 용도(mutated polypeptides, compositions comprising the same, and uses thereof) |
| CN115838751A (zh) * | 2022-11-22 | 2023-03-24 | 迪亚莱博(张家港)生物科技有限公司 | 一种磷脂酶a2受体重组蛋白的制备方法 |
| CN121941504A (zh) * | 2023-08-01 | 2026-04-28 | 梅里达生物科学公司 | 用于控制自身免疫反应的分子 |
Citations (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US6120766A (en) | 1991-12-04 | 2000-09-19 | Hale; Geoffrey | CDW52-specific antibody for treatment of multiple sclerosis |
| WO2001029058A1 (en) | 1999-10-15 | 2001-04-26 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| WO2001096584A2 (en) | 2000-06-12 | 2001-12-20 | Akkadix Corporation | Materials and methods for the control of nematodes |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US20040101519A1 (en) | 2002-01-03 | 2004-05-27 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US20060034810A1 (en) | 2004-05-27 | 2006-02-16 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| US20060121005A1 (en) | 2000-02-24 | 2006-06-08 | Xcyte Therapies, Inc. | Activation and expansion of cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| WO2013007640A1 (en) | 2011-07-08 | 2013-01-17 | Centre Leon Berard | Pla2r1 as anti-tumoral compound and as biomarker for the detection of cancer |
| US20130287748A1 (en) * | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US20140010861A1 (en) * | 2012-04-02 | 2014-01-09 | modeRNA Therapeutics | Modified polynucleotides for the production of proteins associated with human disease |
| US20170051035A1 (en) * | 2014-05-02 | 2017-02-23 | The Trustees Of The University Of Pennsylvania | Compositions and methods of chimeric autoantibody receptor t cells |
| CN107663235A (zh) * | 2017-08-11 | 2018-02-06 | 南京诺唯赞医疗科技有限公司 | 特发性膜性肾病相关的pla2r重组蛋白及其应用 |
| WO2018031947A1 (en) | 2016-08-12 | 2018-02-15 | Immunowork, Llc | Diagnosis, prevention, and/or treatment of autoimmune diseases |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ZA973051B (en) | 1996-04-24 | 1998-10-12 | Genentech Inc | Type c lectins |
| JP2011526916A (ja) * | 2008-06-30 | 2011-10-20 | ザ リージェンツ オブ ザ ユニバーシティ オブ ミシガン | 全身性紅斑性狼瘡を同定および処置するための診断標的および治療標的としてのリソソームホスホリパーゼa2(lpla2)活性 |
| WO2013044225A1 (en) * | 2011-09-22 | 2013-03-28 | The Trustees Of The University Of Pennsylvania | A universal immune receptor expressed by t cells for the targeting of diverse and multiple antigens |
| CN108027367A (zh) * | 2015-07-10 | 2018-05-11 | 楚尼斯 | 基于pla2r1表位谱和扩散分析的膜性肾病的预后和监测 |
| WO2018127585A1 (en) | 2017-01-06 | 2018-07-12 | Txcell | Monospecific regulatory t cell population with cytotoxicity for b cells |
-
2019
- 2019-05-02 CN CN201980042269.7A patent/CN112312930A/zh active Pending
- 2019-05-02 JP JP2020561076A patent/JP7519906B2/ja active Active
- 2019-05-02 AU AU2019262131A patent/AU2019262131A1/en not_active Abandoned
- 2019-05-02 KR KR1020207033822A patent/KR20210007998A/ko not_active Ceased
- 2019-05-02 MX MX2020011610A patent/MX2020011610A/es unknown
- 2019-05-02 WO PCT/US2019/030459 patent/WO2019213434A1/en not_active Ceased
- 2019-05-02 US US17/051,248 patent/US20210095001A1/en not_active Abandoned
- 2019-05-02 EP EP19796773.0A patent/EP3813885A4/en active Pending
- 2019-05-02 CA CA3098865A patent/CA3098865A1/en active Pending
-
2021
- 2021-12-06 US US17/543,429 patent/US11884716B2/en active Active
-
2024
- 2024-02-28 JP JP2024027975A patent/JP2024059867A/ja active Pending
- 2024-04-19 US US18/640,092 patent/US20240383965A1/en active Pending
Patent Citations (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| US7232566B2 (en) | 1988-11-23 | 2007-06-19 | The United States As Represented By The Secretary Of The Navy | Methods for treating HIV infected subjects |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US7144575B2 (en) | 1988-11-23 | 2006-12-05 | The Regents Of The University Of Michigan | Methods for selectively stimulating proliferation of T cells |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US5883223A (en) | 1988-11-23 | 1999-03-16 | Gray; Gary S. | CD9 antigen peptides and antibodies thereto |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
| US6120766A (en) | 1991-12-04 | 2000-09-19 | Hale; Geoffrey | CDW52-specific antibody for treatment of multiple sclerosis |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US7172869B2 (en) | 1995-05-04 | 2007-02-06 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| WO2001029058A1 (en) | 1999-10-15 | 2001-04-26 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US20060121005A1 (en) | 2000-02-24 | 2006-06-08 | Xcyte Therapies, Inc. | Activation and expansion of cells |
| WO2001096584A2 (en) | 2000-06-12 | 2001-12-20 | Akkadix Corporation | Materials and methods for the control of nematodes |
| US20040101519A1 (en) | 2002-01-03 | 2004-05-27 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| US20060034810A1 (en) | 2004-05-27 | 2006-02-16 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| US20130287748A1 (en) * | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2013007640A1 (en) | 2011-07-08 | 2013-01-17 | Centre Leon Berard | Pla2r1 as anti-tumoral compound and as biomarker for the detection of cancer |
| US20140010861A1 (en) * | 2012-04-02 | 2014-01-09 | modeRNA Therapeutics | Modified polynucleotides for the production of proteins associated with human disease |
| US20170051035A1 (en) * | 2014-05-02 | 2017-02-23 | The Trustees Of The University Of Pennsylvania | Compositions and methods of chimeric autoantibody receptor t cells |
| WO2018031947A1 (en) | 2016-08-12 | 2018-02-15 | Immunowork, Llc | Diagnosis, prevention, and/or treatment of autoimmune diseases |
| CN107663235A (zh) * | 2017-08-11 | 2018-02-06 | 南京诺唯赞医疗科技有限公司 | 特发性膜性肾病相关的pla2r重组蛋白及其应用 |
Non-Patent Citations (29)
| Title |
|---|
| BECK ET AL., N ENGL J MED, vol. 361, 2009, pages 11 - 21 |
| BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977 |
| BIERER ET AL., CURR. OPIN. IMMUN., vol. 5, 1993, pages 763 - 773 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BUDDE ET AL., PLOS ONE, vol. 8, 2013, pages 82742 |
| CHEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 107, 2010, pages 8531 - 8536 |
| DI STASI ET AL., N. ENGL. J. MED., vol. 365, 2011, pages 1673 - 1683 |
| ELLEBRECHT ET AL.: "Reengineering chimeric antigen receptor T cells for targeted therapy of autoimmune disease", SCIENCE, vol. 353, no. 6295, 2016, pages 179 - 184, XP055434542, DOI: 10.1126/science.aaf6756 |
| FEDOROV, CANCER JOURNAL, vol. 20, 2014, pages 160 - 165 |
| GARLAND ET AL., J. IMMUNOL METH., vol. 227, no. 1-2, 1999, pages 53 - 63 |
| GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10 |
| HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 13191328 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1989, COLD SPRING HARBOR |
| HENDERSON ET AL., IMMUN, vol. 73, 1991, pages 316 - 321 |
| HILL ET AL., NATURE CHEMICAL BIOLOGY, vol. 14, 2018, pages 112 - 117 |
| HOUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| KLOSS ET AL., NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 71 - 75 |
| KUDO ET AL., CANCER RES., vol. 74, 2014, pages 93 - 103 |
| LIU ET AL., CELL, vol. 66, 1991, pages 807 - 815 |
| RODGERS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 113, 2016, pages 459 - 468 |
| ROSENBERG ET AL., NEW ENG. J. OF MED., vol. 319, 1988, pages 1676 |
| ROYBAL ET AL., CELL, vol. 164, no. 4, 2016, pages 770 - 9 |
| SAKEMURA ET AL., CANCER IMMUNOL. RES., vol. 4, 2016, pages 658 - 668 |
| See also references of EP3813885A4 |
| SEITZ-POLSKI: "Epitope Spreading of Autoantibody Response to PLA2R Associates with Poor Prognosis in Membranous Nephropathy", J AM SOC NEPHROL, vol. 27, 2016, pages 1517 - 1533, XP002800680, DOI: 10.1681/ASN.2014111061 |
| STANESCU ET AL., N ENGL J MED, vol. 364, no. 7, 2011, pages 616 - 26 |
| UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82 |
| WEI ET AL., NATURE, vol. 1 -4, 2012, pages 384 - 388 |
| WU ET AL., SCIENCE, vol. 350, 2015, pages 4077 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527507A (zh) * | 2020-04-16 | 2021-10-22 | 上海赛比曼生物科技有限公司 | 靶向cd22的嵌合抗原受体及其制法和应用 |
| WO2022136503A1 (en) | 2020-12-22 | 2022-06-30 | Deutsches Zentrum Für Neurodegenerative Erkrankungen E. V. (Dzne) | Chimeric autoantibody receptor (caar) comprising a nicotinic acetylcholine receptor autoantigen |
| EP4083061A1 (en) * | 2021-04-30 | 2022-11-02 | Kilometro Rosso SPA | Fusion proteins and use thereof in the treatment of membranous nephropathy |
| WO2022229434A1 (en) * | 2021-04-30 | 2022-11-03 | Kilometro Rosso Spa | Fusion proteins and use thereof in the treatment of membranous nephropathy |
| EP4380963A4 (en) * | 2021-08-05 | 2025-06-04 | The Trustees of The University of Pennsylvania | Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210095001A1 (en) | 2021-04-01 |
| KR20210007998A (ko) | 2021-01-20 |
| US20220098271A1 (en) | 2022-03-31 |
| AU2019262131A1 (en) | 2020-11-19 |
| JP2024059867A (ja) | 2024-05-01 |
| MX2020011610A (es) | 2021-02-09 |
| EP3813885A1 (en) | 2021-05-05 |
| CN112312930A (zh) | 2021-02-02 |
| CA3098865A1 (en) | 2019-11-07 |
| US20240383965A1 (en) | 2024-11-21 |
| EP3813885A4 (en) | 2022-01-12 |
| JP2021522790A (ja) | 2021-09-02 |
| JP7519906B2 (ja) | 2024-07-22 |
| US11884716B2 (en) | 2024-01-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11884716B2 (en) | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells | |
| US20230303653A1 (en) | Compositions and methods of chimeric autoantibody receptor t cells | |
| US20240425564A1 (en) | Compositions and methods of muscle specific kinase chimeric autoantibody receptor cells | |
| US20210269501A1 (en) | Compositions and methods of nkg2d chimeric antigen receptor t cells for controlling triple-negative breast cancer | |
| US20220242931A1 (en) | Compositions and methods of acetylcholine receptor chimeric autoantibody receptor cells | |
| US20250073265A1 (en) | Compositions and Methods of Chimeric Autoantibody Receptor Cells Expressing Extended Phospholipase A2 Receptor Fragments | |
| US20230167429A1 (en) | Compositions and methods of adamts13 chimeric autoantibody receptor cells | |
| HK40074993A (en) | Compositions and methods of chimeric autoantibody receptor t cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19796773 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3098865 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020561076 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019262131 Country of ref document: AU Date of ref document: 20190502 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20207033822 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019796773 Country of ref document: EP Effective date: 20201202 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020207033822 Country of ref document: KR |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 278344 Country of ref document: IL |