WO2019204398A1 - Trivalent trispecific antibody constructs - Google Patents
Trivalent trispecific antibody constructs Download PDFInfo
- Publication number
- WO2019204398A1 WO2019204398A1 PCT/US2019/027816 US2019027816W WO2019204398A1 WO 2019204398 A1 WO2019204398 A1 WO 2019204398A1 US 2019027816 W US2019027816 W US 2019027816W WO 2019204398 A1 WO2019204398 A1 WO 2019204398A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- amino acid
- sequence
- domains
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- Antibodies are an invaluable tool in the medical field.
- the importance of monoclonal antibodies, including their roles in scientific research and medical diagnostics, have been widely recognized for several decades.
- the full potential of antibodies, especially their successful use as therapeutic agents, has only more recently been
- An area of active research in the antibody therapeutic field is the design and use of multispecific antibodies, i.e. a single antibody engineered to recognize multiple targets. These antibodies offer the promise of greater therapeutic control. For example, a need exists to improve target specificity in order to reduce the off-target effects associated with many antibody therapies, particularly in the case of antibody based immunotherapies.
- multispecific antibodies offer new therapeutic strategies, such as synergistic targeting of multiple cell receptors, especially in an immunotherapy context.
- One such immunotherapy is the use of bispecific antibodies to recruit T cells to target and kill specific tumor cell populations through bispecific engagement of a T cell marker and a tumor cell marker. For example, the targeting of B cell lymphoma using CD3xCDl9 bispecific antibodies is described in U.S. Pub.
- a trivalent trispecific binding molecule comprising: a first, a second, a third, a fourth, and a fifth polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, a domain E, a domain N and a domain O, wherein the domains are arranged, from N-terminus to C-terminus, in an N-O-A-B-D-E orientation, and domain A has a variable region domain amino acid sequence, domain B has a constant region domain amino acid sequence, domain D has a CH2 amino acid sequence, domain E has a constant region domain amino acid sequence, domain N has a variable region domain amino acid sequence, and domain O has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a variable
- the second and the fifth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the fifth polypeptide chains, the amino acid sequences of domain O and domain B are identical, and the amino acid sequences of domain I is different from domains O and B.
- the fourth and the fifth polypeptide chains are identical and the second polypeptide chain is different from the second and the fifth polypeptide chains, the amino acid sequences of domain O and domain I are identical, and the amino acid sequences of domain B is different from domains O and I.
- a trivalent trispecific binding molecule comprising: a first, a second, a third, a fourth, and a sixth polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in an A-B-D-E orientation, and domain A has a variable region domain amino acid sequence, domain B has a constant region domain amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a variable region domain amino acid sequence and domain G has a a constant region domain amino acid sequence amino acid sequence; (c) the third polypeptide chain comprises a domain H,
- the fourth and the sixth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the sixth polypeptide chains, the amino acid sequences of domain S and domain I are identical, and the amino acid sequences of domain B is different from domains S and I.
- the second and the sixth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the sixth polypeptide chains, the amino acid sequences of domain S and domain B are identical, and the amino acid sequences of domain I is different from domains S and B.
- a purified binding molecule comprising any of the binding molecules described herein.
- the binding molecule is purified by a purification method comprising a CH1 affinity purification step.
- the purification method is a single-step purification method.
- composition comprising any of the binding molecules described herein and a pharmaceutically acceptable diluent.
- Also disclosed herein is a method for treating a subject with cancer, the method comprising administering a therapeutically effective amount of any of the pharmaceutical composition described herein.
- FIG. 1 shows an alignment of the CH3-CH3 IgGl dimer pair with CFH-CL.
- the quaternary structures align with an RMSD of -1.6 A 2 .
- FIG. 2 presents schematic architectures, with respective naming conventions, for various binding molecules (also called antibody constructs) described herein.
- FIG. 3 presents a higher resolution schematic of polypeptide chains and their domains, with respective naming conventions, for the bivalent lxl antibody constructs described herein.
- FIG. 4 shows the architecture of an exemplary bivalent, monospecific, construct.
- FIG. 5 shows data from a biolayer interferometry (BLI) experiment, described in Example 1, in which a bivalent monospecific binding molecule having the architecture illustrated in FIG. 4 [polypeptide 1 : VL-CH3(Knob)-CH2-CH3 / polypeptide 2: VH- CH3(Hole)] was assayed. The antigen binding site was specific for TNFa. The BLI response from binding molecule immobilization and TNFa binding to the immobilized construct demonstrates robust, specific, bivalent binding to the antigen. The data are consistent with a molecule having a high percentage of intended pairing of polypeptide 1 and polypeptide 2.
- FIG. 6 illustrates features of an exemplary bivalent lxl bispecific binding molecule, “BC1”.
- FIG. 7A shows size exclusion chromatography (SEC) analysis of“BC1”,
- FIG. 7B shows comparative literature data of SEC analysis of a CrossMab bivalent antibody construct [data from Schaefer et al. ( Proc Natl Acad Sci USA. 2011 Jul 5; 108(27): 11187-92)].
- FIG. 8A is a cation exchange chromatography elution profile of“BC1” following one-step purification using the CaptureSelectTM CH1 affinity resin, showing a single tight peak.
- FIG. 8B is a cation exchange chromatography elution profile of“BC1” following purification using standard Protein A purification.
- FIG. 9 shows nonreducing SDS-PAGE gels of“BC1” at various stages of
- FIGS. 10A and 10B compare SDS-PAGE gels of“BC1” after single-step CH1- affmity purification under both non-reducing and reducing conditions (FIG. 10A) with SDS- PAGE gels of a CrossMab bispecific antibody under non-reducing and reducing conditions as published in the referenced literature (FIG. 10B).
- FIGS. 11A and 11B show mass spec analysis of“BC1”, demonstrating two distinct heavy chains (FIG. 11 A) and two distinct light chains (FIG. 11B) under reducing conditions.
- FIG. 12 presents a mass spectrometry analysis of purified“BC1” under non-reducing conditions, confirming the absence of incomplete pairing after purification.
- FIG. 13 presents accelerated stability testing data demonstrating stability of“BC1” over 8 weeks at 40°C, compared to two IgG control antibodies.
- FIG. 14 illustrates features of an exemplary bivalent lxl bispecific binding molecule, “BC6”, further described in Example 3.
- FIG. 15A presents size exclusion chromatography (SEC) analysis of“BC6” following one-step purification using the CaptureSelectTM CH1 affinity resin, demonstrating that the single step CH1 affinity purification yields a single monodisperse peak and the absence of non-covalent aggregates.
- FIG. 15B shows a SDS-PAGE gel of“BC6” under non reducing conditions.
- FIG. 16 illustrates features of an exemplary bivalent bispecific binding molecule, “BC28”, further described in Example 4.
- FIG. 17 shows SDS-PAGE analysis under non-reducing conditions following single-step CH1 affinity purification of“BC28”,“BC29”,“BC30”,“BC31”, and“BC32”.
- FIG. 18 shows SEC analysis of“BC28” and“BC30”, each following one-step purification using the CaptureSelectTM CH1 affinity resin.
- FIG. 19 illustrates features of an exemplary bivalent bispecific binding molecule, “BC44”, further described in Example 5.
- FIGS. 20A and 20B show size exclusion chromatography data of two bivalent binding molecules,“BC15” and“BC16”, respectively, under accelerated stability testing conditions. “BC15” and“BC16” have different variable region-CFB junctions.
- FIG. 21 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for the trivalent 2x1 antibody constructs described herein.
- FIG. 22 illustrates features of an exemplary trivalent 2x1 bispecific binding molecule, “BCl-2xl”, further described in Example 7.
- FIG. 23 shows non-reducing SDS-PAGE of“BC1” and“BCl-2xl” protein expressed using the ThermoFisher Expi293 transient transfection system, at various stages of purification.
- FIG. 24 compares the avidity of the bivalent lxl construct“BC1” to the avidity of the trivalent 2x1 construct“BC 1-2x1” using an Octet (Pall ForteBio) biolayer interferometry analysis.
- FIG. 25 illustrates salient features of a trivalent 2x1 construct,“TB111.”
- FIG. 26 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for the trivalent 1x2 antibody constructs described herein.
- FIG. 27 illustrates features of an exemplary trivalent 1x2 construct“CTLA4-4 x Nivo x CTLA4-4”, further described in Example 10.
- FIG. 28 is a SDS-PAGE gel in which the lanes showing the trivalent 1x2 construct “CTLA4-4 x Nivo x CTLA4-4” construct under non-reducing (“-DTT”) and reducing (“+DTT”) conditions have been boxed.
- FIG. 29 shows a comparison of antigen binding between two antibodies: bivalent lxl construct“CTLA4-4 x 0X40-8” and the trivalent 1x2 construct“CTLA4-4 x Nivo x CTLA4- 4.”“CTLA4-4 x 0X40-8” binds to CTLA4 monovalently, while“CTLA4-4 x Nivo x CTLA4-4” binds to CTLA4 bivalently.
- FIG. 30 illustrates features of an exemplary trivalent 1x2 trispecific construct, “BC28-lxlxla”, further described in Example 11.
- FIG. 31 shows size exclusion chromatography of“BC28-lxlxla” following transient expression and single step CH1 affinity resin purification, demonstrating a single well- defined peak.
- FIG. 32 shows SDS-PAGE results with bivalent and trivalent constructs, each after transient expression and one-step purification using the CaptureSelectTM CH1 affinity resin, under non-reducing and reducing conditions, as further described in Example 12.
- FIGS. 33A-33C show Octet binding analyses to 3 antigens: PD1, Antigen“A”, and CTLA4.
- FIG. 33A shows binding of“BC1” to PD1 and Antigen“A”
- FIG. 33B shows binding of a bivalent bispecific construct“CTLA4-4 x 0X40- 8” to CTLA4, Antigen“A”, and PD1
- FIG. 33C shows binding of trivalent trispecific “BC28-lxlxla” to PD1, Antigen“A”, and CTLA4.
- FIG. 34 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for certain tetravalent 2x2 constructs described herein.
- FIG. 35 illustrates certain salient features of the exemplary tetravalent 2x2 construct, “BC22-2x2” further described in Example 14.
- FIG. 36 is a non-reducing SDS-PAGE gel comparing the 2x2 tetravalent“BC22-2x2” construct to a 1x2 trivalent construct“BCl2-lx2” and a 2x1 trivalent construct“BC2l-2xl” at different stages of purification.
- FIG. 37 provides architecture for an exemplary tetravalent 2x2 construct.
- FIG. 38 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for certain tetravalent constructs described herein.
- FIG. 39 provides exemplary architecture of a bispecific tetravalent construct.
- FIG. 40 provides exemplary architecture for a trispecific tetravalent construct utilizing a common light chain strategy.
- FIG. 41 shows bispecific antigen engagement by the tetravalent construct
- FIG. 42 provides flow cytometry analysis of B-Body binding to cell-surface antigen.
- Cross-hatched signal indicates cells without antigen; dotted signal indicates transiently transfected cells with surface antigen.
- FIG. 43 provides exemplary architecture of a trivalent construct.
- FIG. 44 provides exemplary architecture of a trivalent construct.
- FIG. 45 shows SDS-PAGE results with bivalent and trivalent constructs, each after transient expression and one-step purification using the CaptureSelectTM CH1 affinity resin, under non-reducing and reducing conditions, as further described in Example 17.
- FIG. 46 shows differences in the thermal transitions for“BC24jv”,“BC26jv”, and “BC28jv” measured to assess pairing stability of junctional variants.
- FIG. 47 demonstrates Octet (Pall ForteBio) biolayer interferometry analysis of a two- fold serial dilution (200-12.5 nM) used to determine binding affinity to CD3 for a non- mutagenized SP34-89 monovalent B-Body.
- Fig. 48 shows SDS-PAGE analysis of bispecific antibodies comprising standard knob-hole orthogonal mutations introduced into CH3 domains found in their native positions within the Fc portion of the bispecific antibody that have been purified using a single-step CH1 affinity purification step (CaptureSelectTM CH1 affinity resin).
- FIG. 49 shows Octet (Pall ForteBio) biolayer interferometry analysis demonstrating FcyRIa binding to trastuzumab (FIG. 49A“WT IgGl”), but not sFclO (FIG. 49B).
- FIG. 50 shows killing by trastuzumab (Herceptin,“WT-IgGl”) but not by the Fc variants tested in an ADCC assay.
- FIG. 51 shows Clq binding by trastuzumab (Herceptin,“WT-IgGl”) but not by the Fc variants tested in a Clq ELISA.
- FIG. 52 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for a series of trivalent trispecific 2x1 antibody constructs described herein.
- FIG. 53 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for a series of trivalent trispecific 2x1 antibody constructs described herein.
- FIG. 54 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for a series of trivalent trispecific 1x2 antibody constructs described herein.
- FIG. 55 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for a series of trivalent trispecific 1x2 antibody constructs described herein.
- FIG. 56 shows the Octet binding analysis for the VL domains paired with the 0X40- 13 VH domain, with non-cognate VL domains 1-12 and 21-24 shown in FIG. 56 A, non cognate VL domains 25-40 shown in FIG. 56B, and non-cognate VL domains 14-20 and cognate VL domain VL13 shown in FIG. 56C.
- antigen binding site is meant a region of a trivalent trispecific binding molecule that specifically recognizes or binds to a given antigen or epitope.
- “B-Body,” as used herein and with reference to FIG. 3, refers to binding molecules comprising the features of a first and a second polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and wherein domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; and (c) the first and the second polypeptides are associated through an interaction between the A and the F
- the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of multiple sclerosis, arthritis, or cancer.
- Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- subject or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
- Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
- the term“sufficient amount” means an amount sufficient to produce a desired effect, e.g., an amount sufficient to modulate protein aggregation in a cell.
- therapeutically effective amount is an amount that is effective to ameliorate a symptom of a disease.
- a therapeutically effective amount can be a
- prophylaxis can be considered therapy.
- antibody constant region residue numbering is according to the Eu index as described at
- polypeptide chain numbers e.g ., a“first” polypeptide chains, a“second” polypeptide chain etc. or polypeptide“chain 1,”“chain 2,” etc) are used herein as a unique identifier for specific polypeptide chains that form a binding molecule and is not intended to connote order or quantity of the different polypeptide chains within the binding molecule.
- Ranges provided herein are understood to be shorthand for all of the values within the range, inclusive of the recited endpoints.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2,
- trivalent trispecific binding molecules are provided.
- the trivalent trispecific binding molecules have three antigen binding sites in which the ABSs collectively have three recognition specificities and are therefore termed“trivalent trispecific.”
- the trivalent trispecific binding molecules comprises a first, a second, a third, a fourth, and a fifth polypeptide chain, wherein:
- the first polypeptide chain comprises a domain A, a domain B, a domain D, a domain E, a domain N and a domain O, wherein the domains are arranged, from N-terminus to C-terminus, in an N-O-A-B-D-E orientation, and domain A has a variable region domain amino acid sequence, domain B has a constant region domain amino acid sequence, domain D has a CH2 amino acid sequence, domain E has a constant region domain amino acid sequence, domain N has a variable region domain amino acid sequence, and domain O has a constant region domain amino acid sequence;
- the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a variable region domain amino acid sequence and domain G has a a constant region domain amino acid sequence amino acid sequence;
- the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein the domains are arranged, from N-terminus to C-terminus, in a H-I-J-K orientation, and wherein domain H has a variable region domain amino acid sequence, domain I has a constant region domain amino acid sequence, domain J has a CH2 amino acid sequence, and K has a constant region domain amino acid sequence;
- the fourth polypeptide chain comprises a domain L and a domain M, wherein the domains are arranged, from N-terminus to C-terminus, in a L-M orientation, and wherein domain L has a variable region domain amino acid sequence and domain M has a constant region domain amino acid sequence;
- the fifth polypeptide chain comprises a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and wherein domain P has a variable region domain amino acid sequence and domain Q has a constant region domain amino acid sequence,
- the first and the second polypeptides are associated through an interaction between the A and the F domains and an interaction between the B and the G domains;
- the third and the fourth polypeptides are associated through an interaction between the H and the L domains and an interaction between the I and the M domains;
- the first and the fifth polypeptides are associated through an interaction between the N and the P domains and an interaction between the O and the Q domains to form the binding molecule;
- the first and the third polypeptides are associated through an interaction between the D and the J domains and an interaction between the E and the K domains to form the binding molecule;
- the second and the fifth polypeptide chains are identical and the fourth polypeptide chain is different, or the fourth and the fifth polypeptide chains are identical and the second polypeptide chain is different; and (1) the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the interaction between the N domain and the P domain form a third antigen binding site specific for a third antigen.
- the second and the fifth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the fifth polypeptide chains, the amino acid sequences of domain O and domain B are identical, and the amino acid sequences of domain I is different from domains O and B.
- the fourth and the fifth polypeptide chains are identical and the second polypeptide chain is different from the second and the fifth polypeptide chains, the amino acid sequences of domain O and domain I are identical, and the amino acid sequences of domain B is different from domains O and I.
- the domain O is connected to domain A through a peptide linker.
- the domain S is connected to domain H through a peptide linker.
- the peptide linker connecting either domain O to domain A or connecting domain S to domain H is a 6 amino acid GSGSGS peptide sequence, as described in more detail in Section 6 3 20 6
- the trivalent trispecific binding molecules comprises a first, a second, a third, a fourth, and a sixth polypeptide chain, wherein:
- the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in an A-B-D-E orientation, and domain A has a variable region domain amino acid sequence, domain B has a constant region domain amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence;
- the second polypeptide chain comprises a domain F and a domain G
- the third polypeptide chain comprises a domain H, a domain I, a domain J, a domain K, a domain R, and a domain S wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain H has a variable region domain amino acid sequence, domain I has a constant region domain amino acid sequence, domain J has a CH2 amino acid sequence, domain K has a constant region domain amino acid sequence, domain R has a variable region domain amino acid sequence, and domain S has a constant region domain amino acid sequence;
- the fourth polypeptide chain comprises a domain L and a domain M, wherein the domains are arranged, from N-terminus to C-terminus, in a L-M orientation, and wherein domain L has a variable region domain amino acid sequence and domain M has a constant region domain amino acid sequence;
- the sixth polypeptide chain comprises a domain T and a domain U, wherein the domains are arranged, from N-terminus to C-terminus, in a T-U orientation, and wherein domain T has a variable region domain amino acid sequence and domain U has a constant region domain amino acid sequence,
- the first and the second polypeptides are associated through an interaction between the A and the F domains and an interaction between the B and the G domains;
- the third and the fourth polypeptides are associated through an interaction between the H and the L domains and an interaction between the I and the M domains;
- the first and the sixth polypeptides are associated through an interaction between the R and the T domains and an interaction between the S and the U domains to form the binding molecule;
- the first and the third polypeptides are associated through an interaction between the D and the J domains and an interaction between the E and the K domains to form the binding molecule;
- the fourth and the sixth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the sixth polypeptide chains, the amino acid sequences of domain S and domain I are identical, and the amino acid sequences of domain B is different from domains S and I.
- the second and the sixth polypeptide chains are identical and the fourth polypeptide chain is different from the second and the sixth polypeptide chains, the amino acid sequences of domain S and domain B are identical, and the amino acid sequences of domain I is different from domains S and B.
- the domain O is connected to domain A through a peptide linker.
- the domain S is connected to domain H through a peptide linker.
- the peptide linker connecting either domain O to domain A or connecting domain S to domain H is a 6 amino acid GSGSGS peptide sequence, as described in more detail in Section 6.3.20.6.
- domain A has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as described herein, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail below in Sections 6.3.3.1 and 6.3.3.4, respectively.
- domain A has a VL antibody domain sequence and domain F has a VH antibody domain sequence.
- VL amino acid sequences useful in the trivalent trispecific binding molecules described herein are antibody light chain variable domain sequences.
- VL amino acid sequences are mammalian sequences, including human sequences, synthesized sequences, or combinations of human, non-human mammalian, mammalian, and/or synthesized sequences, as described in further detail below in Sections 6.3.3.2 and 6.3.3.3. [00100]
- VL amino acid sequences are mutated sequences of naturally occurring sequences.
- the VL amino acid sequences are lambda (l) light chain variable domain sequences.
- the VL amino acid sequences are kappa (K) light chain variable domain sequences.
- the VL amino acid sequences are kappa (K) light chain variable domain sequences.
- domain A is connected to the N-terminus of domain B.
- domain A has a VL amino acid sequence that is mutated at its C-terminus at the junction between domain A and domain B, as described in greater detail below in Section 6.3.20.1 and in Example 6.
- VL amino acid sequences comprise highly variable sequences termed
- CDRs complementarity determining regions
- the CDRs are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CDRs are human sequences.
- the CDRs are naturally occurring sequences.
- the CDRs are naturally occurring sequences that have been mutated to alter the binding affinity of the antigen-binding site for a particular antigen or epitope.
- the naturally occurring CDRs have been mutated in an in vivo host through affinity maturation and somatic hypermutation.
- the CDRs have been mutated in vitro through methods including, but not limited to, PCR-mutagenesis and chemical mutagenesis.
- the CDRs are synthesized sequences including, but not limited to, CDRs obtained from random sequence CDR libraries and rationally designed CDR libraries.
- the VL amino acid sequences comprise“framework region” (FR) sequences.
- FRs are generally conserved sequence regions that act as a scaffold for interspersed CDRs (see Section 6.3.3.2.), typically in a FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 arrangement (from N-terminus to C-terminus).
- the FRs are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the FRs are human sequences.
- the FRs are naturally occurring sequences.
- the FRs are synthesized sequences including, but not limited, rationally designed sequences.
- the FRs and the CDRs are both from the same naturally occurring variable domain sequence.
- the FRs and the CDRs are from different variable domain sequences, wherein the CDRs are grafted onto the FR scaffold with the CDRs providing specificity for a particular antigen.
- the grafted CDRs are all derived from the same naturally occurring variable domain sequence.
- the grafted CDRs are derived from different variable domain sequences.
- the grafted CDRs are synthesized sequences including, but not limited to, CDRs obtained from random sequence CDR libraries and rationally designed CDR libraries.
- the grafted CDRs and the FRs are from the same species. In certain embodiments, the grafted CDRs and the FRs are from different species.
- an antibody is“humanized”, wherein the grafted CDRs are non-human mammalian sequences including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, and goat sequences, and the FRs are human sequences.
- VH amino acid sequences in the trivalent trispecific binding molecules described herein are antibody heavy chain variable domain sequences. In a typical antibody
- VH amino acid sequences are mammalian sequences, including human sequences, synthesized sequences, or combinations of non-human mammalian, mammalian, and/or synthesized sequences, as described in further detail above in Sections 6.3.3.2 and 6.3.3.3.
- VH amino acid sequences are mutated sequences of naturally occurring sequences.
- Domain B has a constant region domain sequence.
- Constant region domain amino acid sequences as described herein, are sequences of a constant region domain of an antibody.
- the constant region sequences are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the constant region sequences are human sequences.
- the constant region sequences are from an antibody light chain.
- the constant region sequences are from a lambda or kappa light chain.
- the constant region sequences are from an antibody heavy chain.
- the constant region sequences are an antibody heavy chain sequence that is an IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype.
- the constant region sequences are from an IgG isotype.
- the constant region sequences are from an IgGl isotype.
- the constant region sequence is a CH3 sequence. CH3 sequences are described in greater detail below in Section 6.3.4.1.
- the constant region sequence is an orthologous CH2 sequence. Orthologous CH2 sequences are described in greater detail below in Section 6.3.4.2.
- the constant region sequence has been mutated to include one or more orthogonal mutations.
- domain B has a constant region sequence that is a CH3 sequence comprising knob-hole (synonymously,“knob-in hole,”“KIH”) orthogonal mutations, as described in greater detail below in Section 6.3.16.2, and either a S354C or a Y349C mutation that forms an engineered disulfide bridge with a CH3 domain containing an orthogonal mutation, as described in in greater detail below in Section 6.3.16.1.
- the knob-hole orthogonal mutation is a T366W mutation.
- CH3 amino acid sequences are sequences of the C-terminal domain of an antibody heavy chain.
- the CH3 sequences are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CH3 sequences are human sequences.
- the CH3 sequences are from an IgAl, IgA2, IgD, IgE, IgM, IgGl, IgG2, IgG3, IgG4 isotype or CH4 sequences from an IgE or IgM isotype.
- the CH3 sequences are from an IgG isotype.
- the CH3 sequences are from an IgGl isotype.
- the CH3 sequence is from an IgA isotype.
- the CH3 sequences are endogenous sequences.
- the CH3 sequence is UniProt accession number P01857 amino acids 224-330.
- a CH3 sequence is a segment of an endogenous CH3 sequence.
- a CH3 sequence has an endogenous CH3 sequence that lacks the N- terminal amino acids G224 and Q225.
- a CH3 sequence has an endogenous CH3 sequence that lacks the C-terminal amino acids P328, G329, and K330.
- a CH3 sequence has an endogenous CH3 sequence that lacks both the N-terminal amino acids G224 and Q225 and the C-terminal amino acids P328, G329, and K330.
- a trivalent trispecific binding molecule has multiple domains that have CH3 sequences, wherein a CH3 sequence can refer to both a full endogenous CH3 sequence as well as a CH3 sequence that lacks N-terminal amino acids, C- terminal amino acids, or both.
- the CH3 sequences are endogenous sequences that have one or more mutations.
- the mutations are one or more orthogonal mutations that are introduced into an endogenous CH3 sequence to guide specific pairing of specific CH3 sequences, as described in more detail in Sections 6.3.16.1-6.3.16.4.
- the CH3 sequences are engineered to reduce
- isoallotype mutations are replaced.
- isoallotype mutations D356E and L358M are made in the CH3 sequence.
- domain B has a human IgGl CH3 amino acid sequence with the following mutational changes: P343V; Y349C; and a tripeptide insertion, 445P, 446G, 447K.
- domain B has a human IgGl CH3 sequence with the following mutational changes: T366K; and a tripeptide insertion, 445K, 446S, 447C.
- domain B has a human IgGl CH3 sequence with the following mutational changes: Y349C and a tripeptide insertion, 445P, 446G, 447K.
- domain B has a human IgGl CH3 sequence with a 447C mutation incorporated into an otherwise endogenous CH3 sequence.
- domain B is connected to the C-terminus of domain A.
- domain B has a CH3 amino acid sequence that is mutated at its N-terminus at the junction between domain A and domain B, as described in greater detail below in Section 6.3.20.1 and
- domain B In the trivalent trispecific binding molecules, the C-terminus of domain B is connected to the N-terminus of domain D.
- domain B has a CH3 amino acid sequence that is extended at the C-terminus at the junction between domain B and domain D, as described in greater detail below in Section 6.3.20.3.
- domain B comprises a human IgA CH3 sequence.
- IgA CH3 isotype substitution is described in greater detail in Section 6.3.16.4.
- An exemplary human IgA CH3 amino acid sequence is:
- CH2 amino acid sequences are sequences of the third domain of an antibody heavy chain, with reference from the N-terminus to C-terminus. CH2 amino acid sequences, in general, are discussed in more detail below in section 6.3.5.
- a trivalent trispecific binding molecule has more than one paired set of CH2 domains that have CH2 sequences, wherein a first set has CH2 amino acid sequences from a first isotype and one or more orthologous sets of CH2 amino acid sequences from another isotype.
- the orthologous CH2 amino acid sequences are able to interact with CH2 amino acid sequences from a shared isotype, but not significantly interact with the CH2 amino acid sequences from another isotype present in the trivalent trispecific binding molecule.
- all sets of CH2 amino acid sequences are from the same species.
- all sets of CH2 amino acid sequences are human CH2 amino acid sequences.
- the sets of CH2 amino acid sequences are from different species.
- the first set of CH2 amino acid sequences is from the same isotype as the other non-CH2 domains in the trivalent trispecific binding molecule.
- the first set has CH2 amino acid sequences from an IgG isotype and the one or more orthologous sets have CH2 amino acid sequences from an IgM or IgE isotype.
- one or more of the sets of CH2 amino acid sequences are endogenous CH2 sequences.
- one or more of the sets of CH2 amino acid sequences are endogenous CH2 sequences that have one or more mutations.
- the one or more mutations are orthogonal knob-hole mutations, orthogonal charge-pair mutations, or orthogonal hydrophobic mutations. Orthologous CH2 amino acid sequences useful for the trivalent trispecific binding molecules are described in more detail in international PCT applications W02017/011342 and WO2017/106462, herein incorporated by reference in their entirety.
- domain D has a constant region amino acid sequence. Constant region amino acid sequences are described in more detail in Section 6.3.4.
- domain D has a CH2 amino acid sequence.
- CH2 amino acid sequences are CH2 amino acid sequences of the third domain of a native antibody heavy chain, with reference from the N-terminus to C-terminus.
- the CH2 sequences are mammalian sequences, including but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CH2 sequences are human sequences.
- the CH2 sequences are from an IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype.
- the CH2 sequences are from an IgGl isotype.
- the CH2 sequences are endogenous sequences.
- the sequence is UniProt accession number P01857 amino acids 111-223.
- the CH2 sequences have an N-terminal hinge region peptide that connects the N-terminal variable domain-constant domain segment to the CH2 domain, as discussed in more detail below in Section 6.3.20.3.
- domain D is connected to the C-terminus of domain B.
- domain B has a CH3 amino acid sequence that is extended at the C-terminus at the junction between domain D and domain B, as described in greater detail below in Section 6.3.20.3.
- domain E has a constant region domain amino acid sequence. Constant region amino acid sequences are described in more detail in Section 6.3.4.
- the constant region sequence is a CH3 sequence. CH3 sequences are described in greater detail above in Section 6.3.4.1.
- the constant region sequence has been mutated to include one or more orthogonal mutations.
- domain E has a constant region sequence that is a CH3 sequence comprising knob-hole (synonymously,“knob-in-hole,”“KIH”) orthogonal mutations, as described in greater detail below in Section 6.3.16.2, and either a S354C or a Y349C mutation that forms an engineered disulfide bridge with a CH3 domain containing an orthogonal mutation, as described in in greater detail below in Section 6.3.16.1.
- the knob-hole orthogonal mutation is a T366W mutation.
- the constant region domain sequence is a CH1 sequence.
- the CH1 amino acid sequence of domain E is the only CH1 amino acid sequence in the trivalent trispecific binding molecule.
- the N- terminus of the CH1 domain is connected to the C-terminus of a CH2 domain, as described in greater detail below in 6.3.20.5.
- the constant region sequence is a CL sequence.
- the N-terminus of the CL domain is connected to the C- terminus of a CH2 domain, as described in greater detail below in 6.3.20.5.
- CH1 and CL sequences are described in further detail in Section 6.3.10.1.
- domain F has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as discussed in greater detail in Section 6.3.1, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail above in Sections 6.3.3.1 and 6.3.3.4, respectively.
- domain F has a VH antibody domain sequence.
- domain G has a constant region amino acid sequence. Constant region amino acid sequences are described in more detail in Section 6.3.4.
- the constant region sequence is a CH3 sequence. CH3 sequences are described in greater detail below in Section 6.3.4.1. In other preferred embodiments, the constant region sequence is an orthologous CH2 sequence. Orthologous CH2 sequences are described in greater detail below in Section 6.3.4.2.
- domain G has a human IgGl CH3 sequence with the following mutational changes: S354C; and a tripeptide insertion, 445P, 446G, 447K.
- domain G has a human IgGl CH3 sequence with the following mutational changes: S354C; and 445P, 446G, 447K tripeptide insertion.
- domain G has a human IgGl CH3 sequence with the following changes: L351D, and a tripeptide insertion of 445G, 446E, 447C.
- domain L has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as discussed in greater detail in Section 6.3.1, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail above in Sections 6.3.3.1. and 6.3.3.4, respectively.
- domain H has a VL antibody domain sequence.
- domain I has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4. In a series of preferred embodiments of the trivalent trispecific binding molecules, domain I has a CL amino acid sequence. In another series of
- domain I has a CH1 amino acid sequence.
- CH1 and CL amino acid sequences are described in further detail in Section 6.3.10.1.
- CH1 amino acid sequences are sequences of the second domain of an antibody heavy chain, with reference from the N-terminus to C-terminus.
- the CH1 sequences are endogenous sequences.
- the CH1 sequences are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CH1 sequences are human sequences.
- the CH1 sequences are from an IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype.
- the CH1 sequences are from an IgGl isotype.
- the CH1 sequence is UniProt accession number P01857 amino acids 1-98.
- CL amino acid sequences useful in the trivalent trispecific binding molecules described herein are antibody light chain constant domain sequences.
- the CL sequences are endogenous sequences.
- the CL sequences are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- CL sequences are human sequences.
- the CL amino acid sequences are lambda (l) light chain constant domain sequences.
- the CL amino acid sequences are human lambda light chain constant domain sequences.
- the lambda (l) light chain sequence is UniProt accession number P0CG04.
- the CL amino acid sequences are kappa (K) light chain constant domain sequences.
- the CL amino acid sequences are human kappa (K) light chain constant domain sequences.
- the kappa light chain sequence is UniProt accession number P01834.
- the CH1 sequence and the CL sequences are both endogenous sequences.
- the CH1 sequence and the CL sequences separately comprise respectively orthogonal modifications in endogenous CH1 and CL sequences, as discussed below in greater detail in Section 6.3.10.2. It is to be understood that orthogonal mutations in the CH1 sequence do not eliminate the specific binding interaction between the CH1 binding reagent and the CH1 domain. However, in some embodiments, the orthogonal mutations may reduce, though not eliminate, the specific binding interaction.
- CH1 and CL sequences can also be portions thereof, either of an endogenous or modified sequence, such that a domain having the CH1 sequence, or portion thereof, can associate with a domain having the CH1 sequence, or portion thereof.
- the trivalent trispecific binding molecule having a portion of the CH1 sequences described above can be bound by the CH1 binding reagent.
- the CH1 domain is also unique in that it’s folding is typically the rate limiting step in the secretion of IgG (Feige et al. Mol Cell. 2009 Jun l2;34(5):569-79; herein incorporated by reference in its entirety).
- purifying the trivalent trispecific binding molecules based on the rate limiting component of CH1 comprising polypeptide chains can provide a means to purify complete complexes from incomplete chains, e.g ., purifying complexes having a limiting CH1 domain from complexes only having one or more non-CHl comprising chains.
- the CH1 limiting expression may be a benefit in some aspects, as discussed, there is the potential for CH1 to limit overall expression of the complete trispecific trivalent binding molecules.
- the expression of the polypeptide chain comprising the CH1 sequence(s) is adjusted to improve the efficiency of the trivalent trispecific binding molecules forming complete complexes.
- the ratio of a plasmid vector constructed to express the polypeptide chain comprising the CH1 sequence(s) can be increased relative to the plasmid vectors constructed to express the other polypeptide chains.
- polypeptide chain comprising the CH1 sequence(s) when compared to the polypeptide chain comprising the CL sequence(s) can be the smaller of the two polypeptide chains.
- expression of the polypeptide chain comprising the CH1 sequence(s) can be adjusted by controlling which polypeptide chain has the CH1 sequence(s).
- engineering the trivalent trispecific binding molecule such that the CH1 domain is present in a two-domain polypeptide chain e.g ., the 4 th polypeptide chain described herein
- the CH1 sequence instead of the CH1 sequence’s native position in a four-domain polypeptide chain (e.g., the 3 rd polypeptide chain described herein)
- a relative expression level of CH1 containing chains that is too high compared to the other chains can result in incomplete complexes the have the CH1 chain, but not each of the other chains.
- the expression of the polypeptide chain comprising the CH1 sequence(s) is adjusted to both reduce the formation incomplete complexes without the CH1 containing chain, and to reduce the formation incomplete complexes with the CH1 containing chain but without the other chains present in a complete complex.
- the CH1 sequence and the CL sequences separately comprise respectively orthogonal modifications in endogenous CH1 and CL sequences.
- orthogonal modifications or synonymously“orthogonal mutations” as described herein are one or more engineered mutations in an amino acid sequence of an antibody domain that alter the affinity of binding of a first domain having orthogonal modification for a second domain having a complementary orthogonal modification, as compared to binding of the first and second domains in the absence of the orthogonal modifications.
- the orthogonal modifications decrease the affinity of binding of the first domain having the orthogonal modification for the second domain having the complementary orthogonal modification, as compared to binding of the first and second domains in the absence of the orthogonal modifications.
- the orthogonal modifications increase the affinity of binding of the first domain having the orthogonal modification for the second domain having the complementary orthogonal modification, as compared to binding of the first and second domains in the absence of the orthogonal modifications. In certain preferred embodiments, the orthogonal modifications decrease the affinity of a domain having the orthogonal modifications for a domain lacking the complementary orthogonal modifications.
- orthogonal modifications are mutations in an endogenous antibody domain sequence.
- orthogonal modifications are modifications of the N-terminus or C-terminus of an endogenous antibody domain sequence including, but not limited to, amino acid additions or deletions.
- orthogonal modifications include, but are not limited to, engineered disulfide bridges, knob- in-hole mutations, and charge-pair mutations, as described in greater detail below.
- orthogonal modifications include a combination of orthogonal modifications selected from, but not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations.
- the orthogonal modifications can be combined with amino acid substitutions that reduce immunogenicity, such as isoallotype mutations as described in greater detail in Section 6.3.4.1.
- the CH1 sequence and the CL sequence of the CH1/CL pair separately comprise respectively orthogonal modifications in endogenous CH1 and CL sequences.
- one sequence of the CH1/CL pair comprises at least one modification while the other sequence of the CH1/CL pair does not comprise a modification in the respectively orthogonal amino acid position.
- a CH1/CL orthogonal modification may affect the CH1/CL domain pairing via an interaction between a modified residue in the CH1 domain and a corresponding modified or unmodified residue in the CL domain.
- CH1 and CL sequences can also be portions thereof, either of an endogenous or modified sequence, such that a domain having the CH1 sequence, or portion thereof, can associate with a domain having the CH1 sequence, or portion thereof.
- binding molecule having a portion of the CH1 sequences described herein can be bound by the CH1 binding reagent.
- Some embodiments of a CH1/CL orthogonal modification comprise an engineered disulfide bridge between engineered cysteines in CH1 and CL. Such engineered disulfide bridges may stabilize an interaction between the polypeptide comprising the modified CH1 and the polypeptide comprising the corresponding modified CL.
- An orthogonal CH1/CL modification comprising an engineered disulfide bridge can comprise, by way of example only, a CH1 domain having an engineered cysteine at position 128, 129, 138, 141, 168, or 171, as numbered by the EU index.
- Such an orthogonal CH1/CL modification comprising an engineered disulfide bridge may further comprise, by way of example only, a CL domain having an engineered cysteine at position 116, 118, 119, 164,
- a CH1/CL orthogonal modification may be selected from engineered cysteines at position 138 of the CH1 sequence and position 116 of the CL sequence, at position 128 of the CH1 sequence and position 119 of the CL sequence, or at position 129 of the CH1 sequence and position 210 of the CL sequence, as numbered and discussed in more detail in U.S. Pat. No. 8,053,562 and U.S. Pat. No. 9,527,927, each incorporated herein by reference in its entirety.
- the CH1/CL orthogonal modification comprises an engineered cysteine at position 141 of the CH1 sequence and position 118 of the CL sequence, as numbered by the EU index.
- the CH1/CL orthogonal modification comprises an engineered cysteine at position 168 of the CH1 sequence and position 164 of the CL sequence, as numbered by the EU index. In some embodiments, the CH1/CL orthogonal modification comprises an engineered cysteine at position 128 of the CH1 sequence and position 118 of the CL sequence, as numbered by the EU index. In some embodiments, the CH1/CL orthogonal modification comprises an engineered cysteine at position 171 of the CH1 sequence and position 162 of the CL sequence, as numbered by the EU index. In some embodiments, the CL sequence is a CL-lambda sequence. In preferred embodiments, the CL sequence is a CL-kappa sequence. In some embodiments, the engineered cysteines are at position 128 of the CH1 sequence and position 118 of the CL Kappa sequence, as numbered by the EU index.
- Table 8 below provides exemplary CH1/CL orthogonal modifications comprising an engineered disulfide bridge between CH1 and CL, numbered according to the EU index.
- the mutations that provide non-endogenous (engineered) cysteine amino acids are a Fl 18C mutation in the CL sequence with a corresponding A141C in the CH1 sequence, or a Fl 18C mutation in the CL sequence with a corresponding L128C in the CH1 sequence, a T164C mutation in the CL sequence with a corresponding H168C mutation in the CH1 sequence, or a S162C mutation in the CL sequence with a corresponding P171C mutation in the CH1 sequence, as numbered by the Eu index.
- the orthogonal modifications in the CL sequence and the CH1 sequence are charge-pair mutations.
- charge-pair mutations are amino acid substitutions that affect the charge of a residue in a domain’s surface such that the domain will preferentially associate with a second domain having complementary charge-pair mutations relative to association with domains without the complementary charge-pair mutations.
- charge-pair mutations improve orthogonal association between specific domains. Charge-pair mutations are described in greater detail in U.S. Pat. No. 8,592,562, U.S. Pat. No. 9,248,182, and U.S. Pat. No. 9,358,286, each of which is incorporated by reference herein for all they teach.
- charge-pair mutations improve stability between specific domains.
- the charge- pair mutations are a Fl 18S, Fl 18A or Fl 18V mutation in the CL sequence with a
- the CH1/CL charge-pair mutations are a Nl38K mutation in the CL sequence with a corresponding G166D in the CH1 sequence, or a N138D mutation in the CL sequence with a corresponding G166K in the CH1 sequence, as numbered by the Eu index.
- the charge-pair mutations are a P127E mutation in CH1 sequence with a corresponding E123K mutation in the corresponding Cl sequence. In some embodiments, the charge-pair mutations are a P127K mutation in CH1 sequence with a corresponding E123 (not mutated) in the corresponding CL sequence.
- Table 9 provides exemplary CH1/CL orthogonal charged-pair modifications.
- the CH1 and CL domains of a single CH1/CL pair separately contain two or more respectively orthogonal modifications in endogenous CH1 and CL sequences.
- the CH1 and CL sequence may contain a first orthogonal modification and a second orthogonal modification in the endogenous CH1 and CL sequences.
- the two or more respectively orthogonal modifications in endogenous CH1 and CL sequences can be selected from any of the CH1/CL orthogonal modifications described herein.
- the first orthogonal modification is an orthogonal charge-pair mutation
- the second orthogonal modification is an orthogonal engineered disulfide bridge.
- the first orthogonal modification is an orthogonal charge-pair mutation as described in Table 9, and the additional orthogonal modification comprise an engineered disulfide bridge selected from engineered cysteines at position 138 of the CH1 sequence and position 116 of the CL sequence, at position 128 of the CH1 sequence and position 119 of the CL sequence, or at position 129 of the CH1 sequence and position 210 of the CL sequence, as numbered and discussed in more detail in U.S. Pat. No. 8,053,562 and U.S. Pat. No.
- the first orthogonal modification is an orthogonal charge-pair mutation as described in Table 9, and the additional orthogonal modification comprise an engineered disulfide bridge as described in Table 8.
- the first orthogonal modification comprises an L128C mutation in the CH1 sequence and an Fl 18C mutation in the CL sequence
- the second orthogonal modification comprises a modification of residue 166 in the same CH1 sequence and a modification of residue 138 in the same CL sequence.
- the first orthogonal modification comprises an L128C mutation in the CH1 sequence and an Fl 18C mutation in the CL sequence
- the second orthogonal modification comprises a G166D mutation in the CH1 sequence and a N138K mutation in the CL sequence.
- the first orthogonal modification comprises an L128C mutation in the CH1 sequence and an Fl 18C mutation in the CL sequence
- the second orthogonal modification comprises a G166K mutation in the CH1 sequence and a N138D mutation in the CL sequence.
- domain J has a CH2 amino acid sequence.
- CH2 amino acid sequences are described in greater detail above in Section 6.3.5.
- the CH2 amino acid sequence has an N-terminal hinge region that connects domain J to domain I, as described in more detail below in Section 6.3.20.4.
- the C-terminus of domain J is connected to the N-terminus of domain K.
- domain J is connected to the N-terminus of domain K that has a CH1 amino acid sequence or CL amino acid sequence, as described in further detail below in Section 6.3.20.5.
- domain K has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4.
- domain K has a constant region sequence that is a CH3 sequence comprising knob-hole orthogonal mutations, as described in greater detail below in Section 6.3.16.2; isoallotype mutations, as described in more detail above in 6.3.4. L; and either a S354C or a Y349C mutation that forms an engineered disulfide bridge with a CH3 domain containing an orthogonal mutation, as described in in greater detail below in Section 6.3.16.1.
- the knob-hole orthogonal mutations combined with isoallotype mutations are the following mutational changes:
- the constant region domain sequence is a CH1 sequence.
- the CH1 amino acid sequence of domain K is the only CH1 amino acid sequence in the trivalent trispecific binding molecule.
- the N- terminus of the CH1 domain is connected to the C-terminus of a CH2 domain, as described in greater detail below in 6.3.20.5.
- the constant region sequence is a CL sequence.
- the N-terminus of the CL domain is connected to the C- terminus of a CH2 domain, as described in greater detail below in 6.3.20.5.
- CH1 and CL sequences are described in further detail in Section 6.3.10.1.
- domain L has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as discussed in greater detail in Section 6.3.1, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail above in Sections 6.3.3. Land 6.3.3.4, respectively.
- domain L has a VH antibody domain sequence.
- domain M has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4.
- domain I has a CH1 amino acid sequence.
- domain I has a CL amino acid sequence. CH1 and CL amino acid sequences are described in further detail in Section 6.3.10.1.
- a domain A VL or VH amino acid sequence and a cognate domain F VL or VH amino acid sequence are associated and form an antigen binding site (ABS).
- the A:F antigen binding site (ABS) is capable of specifically binding an epitope of an antigen. Antigen binding by an ABS is described in greater detail below in Section 6.3.15.1.
- the ABS formed by domains A and F is identical in sequence to one or more other ABSs within the trivalent trispecific binding molecule and therefore has the same recognition specificity as the one or more other sequence-identical ABSs within the trivalent trispecific binding molecule.
- the A:F ABS is non-identical in sequence to one or more other ABSs within the trivalent trispecific binding molecule.
- the A:F ABS has a recognition specificity different from that of one or more other sequence-non-identical ABSs in the trivalent trispecific binding molecule.
- the A:F ABS recognizes a different antigen from that recognized by at least one other sequence-non-identical ABS in the trivalent trispecific binding molecule.
- the A:F ABS recognizes a different epitope of an antigen that is also recognized by at least one other sequence-non-identical ABS in the trivalent trispecific binding molecule.
- the ABS formed by domains A and F recognizes an epitope of antigen, wherein one or more other ABSs within the trivalent trispecific binding molecule recognizes the same antigen but not the same epitope.
- ABS and the trivalent trispecific binding molecule comprising such ABS, is said to“recognize” the epitope (or more generally, the antigen) to which the ABS specifically binds, and the epitope (or more generally, the antigen) is said to be the“recognition specificity” or“binding specificity” of the ABS.
- ABS is said to bind to its specific antigen or epitope with a particular affinity.
- affinity refers to the strength of interaction of non-covalent
- KD dissociation equilibrium constant
- “Specific binding,” as used herein, refers to an affinity between an ABS and its cognate antigen or epitope in which the KD value is below 10 6 M, 10 7 M, 10 8 M, 10 9 M, or 10 10 M.
- ABSs in a binding molecule as described herein defines the number of ABSs in a binding molecule as described herein.
- a binding molecule having a single ABS is“monovalent”.
- a binding molecule having a plurality of ABSs is said to be “multivalent”.
- a multivalent binding molecule having two ABSs is“bivalent.”
- a multivalent binding molecule having three ABSs is“trivalent.”
- a multivalent binding molecule having four ABSs is“tetravalent.”
- all of the plurality of ABSs have the same recognition specificity.
- a binding molecule is a “monospecific”“multivalent” binding construct.
- at least two of the plurality of ABSs have different recognition specificities.
- Such binding molecules are multivalent and“multispecific”. In multivalent embodiments in which the ABSs collectively have two recognition specificities, the binding molecule is“bispecific.” In multivalent embodiments in which the ABSs collectively have three recognition specificities, the binding molecule is“trispecific.”
- the binding molecule is“multiparatopic.”
- Multivalent embodiments in which the ABSs collectively recognize two epitopes on the same antigen are“biparatopic.”
- multivalency of the binding molecule improves the avidity of the binding molecule for a specific target.
- avidity refers to the overall strength of interaction between two or more molecules, e.g. a multivalent binding molecule for a specific target, wherein the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs. Avidity can be measured by the same methods as those used to determine affinity, as described above.
- the avidity of a trivalent trispecific binding molecule for a specific target is such that the interaction is a specific binding interaction, wherein the avidity between two molecules has a KD value below 10 6 M, 10 7 M, 10 8 M, 10 9 M, or 10 10 M.
- the avidity of a binding molecule for a specific target has a KD value such that the interaction is a specific binding interaction, wherein the one or more affinities of individual ABSs do not have has a KD value that qualifies as specifically binding their respective antigens or epitopes on their own.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs for separate antigens on a shared specific target or complex, such as separate antigens found on an individual cell. In certain embodiments, the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs for separate epitopes on a shared individual antigen.
- domain B constant region amino acid sequence and a domain G constant region amino acid sequence are associated. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4.
- domain B and domain G have CH3 amino acid sequences. CH3 sequences are described in greater detail above in Section 6.3.4.1.
- amino acid sequences of the B and the G domains are identical. In certain of these embodiments, the sequence is an endogenous CH3 sequence.
- amino acid sequences of the B and the G domains are different, and separately comprise respectively orthogonal modifications in an
- orthogonal modifications or synonymously“orthogonal mutations” as described herein are one or more engineered mutations in an amino acid sequence of an antibody domain that increase the affinity of binding of a first domain having orthogonal modification for a second domain having a complementary orthogonal modification.
- the orthogonal modifications decrease the affinity of a domain having the orthogonal modifications for a domain lacking the complementary orthogonal
- orthogonal modifications are mutations in an endogenous antibody domain sequence. In a variety of embodiments, orthogonal
- orthogonal modifications are modifications of the N-terminus or C-terminus of an endogenous antibody domain sequence including, but not limited to, amino acid additions or deletions.
- orthogonal modifications include, but are not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations, and isotype substitution as described in greater detail in Sections 6.3.16.1-6.3.16.4.
- orthogonal modifications include a combination of orthogonal modifications selected from, but not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations.
- the orthogonal modifications can be combined with amino acid substitutions that reduce immunogenicity, such as isoallotype mutations, as described in greater detail above in Section 6.3.4.1.
- the orthogonal modifications comprise mutations that generate engineered disulfide bridges between a first and a second domain.
- “engineered disulfide bridges” are mutations that provide non-endogenous cysteine amino acids in two or more domains such that a non-native disulfide bond forms when the two or more domains associate.
- Engineered disulfide bridges are described in greater detail in Merchant et al. ⁇ Nature Biotech (1998) 16:677-681), the entirety of which is hereby incorporated by reference for all it teaches.
- engineered disulfide bridges improve orthogonal association between specific domains. In a particular
- the mutations that generate engineered disulfide bridges are a K392C mutation in one of a first or second CH3 domains, and a D399C in the other CH3 domain.
- the mutations that generate engineered disulfide bridges are a S354C mutation in one of a first or second CH3 domains, and a Y349C in the other CH3 domain.
- the mutations that generate engineered disulfide bridges are a 447C mutation in both the first and second CH3 domains that are provided by extension of the C-terminus of a CH3 domain incorporating a KSC tripeptide sequence.
- orthogonal modifications comprise knob-hole
- knob-hole mutations are mutations that change the steric features of a first domain’s surface such that the first domain will preferentially associate with a second domain having complementary steric mutations relative to association with domains without the complementary steric mutations. Knob-hole mutations are described in greater detail in U.S. Pat. No. 5,821,333 and U.S. Pat. No.
- knob-hole mutations are combined with engineered disulfide bridges, as described in greater detail in Merchant et al. ⁇ Nature Biotech (1998) 16:677-681)), incorporated herein by reference in its entirety.
- knob-hole mutations, isoallotype mutations, and engineered disulfide mutations are combined.
- the knob-in-hole mutations are a T366Y mutation in a first domain, and a Y407T mutation in a second domain.
- the knob-in-hole mutations are a F405A in a first domain, and a T394W in a second domain.
- the knob-in-hole mutations are a T366Y mutation and a F405A in a first domain, and a T394W and a Y407T in a second domain.
- the knob- in-hole mutations are a T366W mutation in a first domain, and a Y407A in a second domain.
- the combined knob-in-hole mutations and engineered disulfide mutations are a S354C and T366W mutations in a first domain, and a Y349C, T366S,
- the combined knob-in-hole mutations, isoallotype mutations, and engineered disulfide mutations are a S354C and T366W mutations in a first domain, and a Y349C, D356E, L358M, T366S, L368A, and aY407V mutation in a second domain.
- orthogonal modifications are charge-pair mutations.
- charge-pair mutations are mutations that affect the charge of an amino acid in a domain’s surface such that the domain will preferentially associate with a second domain having complementary charge-pair mutations relative to association with domains without the complementary charge-pair mutations.
- charge-pair mutations improve orthogonal association between specific domains. Charge-pair mutations are described in greater detail in U.S. Pat. No. 8,592,562, U.S. Pat. No. 9,248,182, and U.S. Pat. No. 9,358,286, each of which is incorporated by reference herein for all they teach.
- charge-pair mutations improve stability between specific domains.
- the charge-pair mutations are a T366K mutation in a first domain, and a L351D mutation in the other domain.
- a first and second domain which may contain CH3 sequences
- a third and fourth domain which may also contain CH3 sequences.
- use of CH3 sequences from human IgA (IgA-CH3) in the first and/or second domain may improve antibody assembly and stability by reducing such undesired associations.
- the first and/or second domain comprises IgA-CH3 sequences.
- At least one of the first or second domain comprise a CH3 linker sequence as described in Section 6.3.20.3.
- both the first and second domain comprise a CH3 linker sequence as described in Section 6.3.20.3.
- the first comprises a first CH3 linker sequence and the second domain comprises a second CH3 linker sequence.
- the first CH3 linker sequence associates with the second CH3 linker sequence by formation of a disulfide bridge between cysteine residues of the first and second CH3 linker sequences.
- the first CH3 linker and the second CH3 linker are identical. In some embodiments, the first CH3 linker and second CH3 linker are non-identical. In some embodiments, the first CH3 linker and second CH3 linker differ in length by 1-6 amino acids. In some embodiments, the first CH3 linker and second CH3 linker differ in length by 1-3 amino acids.
- the first CH3 linker and the second CH3 linker are provided in Table 10 below.
- the first CH3 linker is AGC and the second CH3 linker is AGKGSC. In some embodiments, the first CH3 linker is AGKGC and the second CH3 linker is AGC. In some embodiments, the first CH3 linker is AGKGSC and the second CH3 linker is AGC. In some embodiments, the first CH3 linker is AGKC and the second CH3 linker is AGC.
- the E domain has a CH3 amino acid sequence.
- the K domain has a CH3 amino acid sequence.
- amino acid sequences of the E and K domains are identical, wherein the sequence is an endogenous CH3 sequence.
- the sequences of the E and K domains are different.
- the different sequences separately comprise respectively orthogonal modifications in an endogenous CH3 sequence, wherein the E domain interacts with the K domain, and wherein neither the E domain nor the K domain significantly interacts with a CH3 domain lacking the orthogonal modification.
- the orthogonal modifications include, but are not limited to, engineered disulfide bridges, knob-in-hole mutations, charge-pair mutations, and isotype substitution as described in greater detail in Sections 6.3.16.1-6.3.16.4.
- orthogonal modifications include a combination of orthogonal modifications selected from, but not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations.
- the orthogonal modifications can be combined with amino acid substitutions that reduce immunogenicity, such as isoallotype mutations.
- domain I has a CL sequence and domain M has a CH1 sequence.
- domain H has a VL sequence and domain L has a VH sequence.
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CH1 amino acid sequence.
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CH1 amino acid sequence
- domain K has a CH3 amino acid sequence.
- the amino acid sequences of the I domain and the M domain separately comprise respectively orthogonal modifications in an endogenous sequence, wherein the I domain interacts with the M domain, and wherein neither the I domain nor the M domain significantly interacts with a domain lacking the orthogonal modification.
- the orthogonal mutations in the I domain are in a CL sequence and the orthogonal mutations in the M domain are in CH1 sequence. Orthogonal mutations are in CH1 and CL sequences are described in more detail above in Section 6.3.10.2.
- the amino acid sequences of the H domain and the L domain separately comprise respectively orthogonal modifications in an endogenous sequence, wherein the H domain interacts with the L domain, and wherein neither the H domain nor the L domain significantly interacts with a domain lacking the orthogonal modification.
- the orthogonal mutations in the H domain are in a VL sequence and the orthogonal mutations in the L domain are in VH sequence.
- the orthogonal mutations are charge-pair mutations at the VH/VL interface.
- the charge-pair mutations at the VH/VL interface are a Q39E in VH with a corresponding Q38K in VL, or a Q39K in VH with a corresponding Q38E in VL, as described in greater detail in Igawa et al. ⁇ Protein Eng. Des. Sel., 2010, vol. 23, 667-677), herein incorporated by reference for all it teaches.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen.
- the binding molecules have 4 antigen binding sites and are therefore termed“tetravalent.”
- the binding molecules further comprise a fifth and a sixth polypeptide chain, wherein (a) the first polypeptide chain further comprises a domain N and a domain O, wherein the domains are arranged, from N- terminus to C-terminus, in a N-O-A-B-D-E orientation; (b) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation; (c) the binding molecule further comprises a fifth and a sixth polypeptide chain, wherein the fifth polypeptide chain comprises a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and the sixth polypeptide chain comprises a domain T and a domain U, wherein the domains are arranged, from N-terminus to C
- the domain O is connected to domain A through a peptide linker and the domain S is connected to domain H through a peptide linker.
- the peptide linker connecting domain O to domain A and connecting domain S to domain H is a 6 amino acid GSGSGS peptide sequence, as described in more detail in Section 6.3.20.6.
- the amino acid sequences of domain N and domain A are identical, the amino acid sequences of domain H and domain R are identical, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I and domain S are identical, the amino acid sequences of domain P and domain F are identical, the amino acid sequences of domain L and domain T are identical, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for the first antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for a second antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- the amino acid sequences of domain H and domain A are identical, the amino acid sequences of domain N and domain R are identical, the amino acid sequences of domain I and domain B are identical, the amino acid sequences of domain O and domain S are identical, the amino acid sequences of domain L and domain F are identical, the amino acid sequences of domain P and domain T are identical, the amino acid sequences of domain M and domain G are identical, the amino acid sequences of domain Q and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for a second antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for the first antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- the amino acid sequence that forms a junction between the C-terminus of a VL domain and the N-terminus of a CH3 domain is an engineered sequence.
- one or more amino acids are deleted or added in the C- terminus of the VL domain.
- the junction connecting the C-terminus of a VL domain and the N-terminus of a CH3 domain is one of the sequences described in Table 2 below in Section 6.13.7.
- Al 11 is deleted in the C- terminus of the VL domain.
- one or more amino acids are deleted or added in the N-terminus of the CH3 domain.
- P343 is deleted in the N-terminus of the CH3 domain.
- P343 and R344 are deleted in the N-terminus of the CH3 domain.
- one or more amino acids are deleted or added to both the C-terminus of the VL domain and the N-terminus of the CH3 domain.
- Al 11 is deleted in the C-terminus of the VL domain and P343 is deleted in the N-terminus of the CH3 domain.
- Al 11 and VI 10 are deleted in the C-terminus of the VL domain.
- Al 11 and VI 10 are deleted in the C-terminus of the VL domain and the N-terminus of the CH3 domain has a P343 V mutation.
- the amino acid sequence that forms a junction between the C-terminus of a VH domain and the N-terminus of a CH3 domain is an engineered sequence.
- one or more amino acids are deleted or added in the C- terminus of the VH domain.
- the junction connecting the C-terminus of a VH domain and the N-terminus of the CH3 domain is one of the sequences described in Table 3 below in Section 6.13.7.
- Kl 17 and Gl 18 are deleted in the C-terminus of the VH domain.
- one or more amino acids are deleted or added in the N-terminus of the CH3 domain.
- P343 is deleted in the N-terminus of the CH3 domain.
- P343 and R344 are deleted in the N-terminus of the CH3 domain.
- P343, R344, and E345 are deleted in the N-terminus of the CH3 domain.
- one or more amino acids are deleted or added to both the C-terminus of the VH domain and the N- terminus of the CH3 domain.
- Tl 16, Kl 17, and Gl 18 are deleted in the C-terminus of the VH domain.
- the N-terminus of the CH2 domain has a“hinge” region amino acid sequence.
- hinge regions are sequences of an antibody heavy chain that link the N-terminal variable domain-constant domain segment of an antibody and a CH2 domain of an antibody.
- the hinge region typically provides both flexibility between the N-terminal variable domain-constant domain segment and CH2 domain, as well as amino acid sequence motifs that form disulfide bridges between heavy chains (e.g. the first and the third polypeptide chains).
- the hinge region amino acid sequence is SEQ ID NO: 56.
- a CH3 amino acid sequence is extended at the C- terminus at the junction between the C-terminus of the CH3 domain and the N-terminus of a CH2 domain.
- a CH3 amino acid sequence is extended at the C- terminus at the junction between the C-terminus of the CH3 domain and a hinge region, which in turn is connected to the N-terminus of a CH2 domain.
- the CH3 amino acid sequence is extended by inserting a PGK tripeptide sequence followed by the DKTHT motif of an IgGl hinge region.
- the extension at the C-terminus of the CH3 domain incorporates amino acid sequences that can form a disulfide bond with orthogonal C-terminal extension of another CH3 domain.
- the extension at the C- terminus of the CH3 domain incorporates a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region that forms a disulfide bond with orthogonal C- terminal extension of another CH3 domain that incorporates a GEC motif of a kappa light chain.
- a CL amino acid sequence is connected through its C- terminus to a hinge region, which in turn is connected to the N-terminus of a CH2 domain.
- Hinge region sequences are described in more detail above in Section 6.3.20.3.
- the hinge region amino acid sequence is SEQ ID NO:56. 6.3.20.5.
- a CH2 amino acid sequence is connected through its C- terminus to the N-terminus of a constant region domain. Constant regions are described in more detail above in Section 6.3.6.
- the CH2 sequence is connected to a CH3 sequence via its endogenous sequence.
- the CH2 sequence is connected to a CH1 or CL sequence. Examples discussing connecting a CH2 sequence to a CH1 or CL sequence are described in more detail in U.S. Pat. No. 8,242,247, which is hereby incorporated in its entirety.
- heavy chains of antibodies are extended at their N-terminus to include additional domains that provide additional ABSs.
- the C-terminus of the constant region domain amino acid sequence of a domain O and/or a domain S is connected to the N-terminus of the variable region domain amino acid sequence of a domain A and/or a domain H, respectively.
- the constant region domain is a CH3 amino acid sequence and the variable region domain is a VL amino acid sequence.
- the constant region domain is a CL amino acid sequence and the variable region domain is a VL amino acid sequence.
- the constant region domain is connected to the variable region domain through a peptide linker.
- the peptide linker is a 6 amino acid GSGSGS peptide sequence.
- light chains of antibodies are extended at their N-terminus to include additional variable domain- constant domain segments of an antibody.
- the constant region domain is a CH1 amino acid sequence and the variable region domain is a VH amino acid sequence.
- trivalent trispecific binding molecules are provided that are based on the bivalent B-body architectures described below and in Sections 6.4.1-6.4.5. [00208] With reference to FIG. 3, in a series of embodiments the bivalent B-body
- architectures comprise a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; (c) the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein the domains are arranged, from N-terminus to C-terminus,
- domain E has a CH3 amino acid sequence
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain K has a CH3 amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CH1 amino acid sequence.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the bivalent B-body architecture is a bispecific bivalent B-body architecture.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen
- the bivalent B- body architecture is a monospecific bivalent B-body architecture.
- trivalent trispecific binding molecules are provided that are based on the bivalent B-body architecture having a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a T366K mutation and a C-terminal extension incorporating a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid with a S354C and T366W mutation; (b) the second polypeptide chain has a domain F and a
- the first polypeptide chain has the sequence SEQ ID NO: 8
- the second polypeptide chain has the sequence SEQ ID NO: 9
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NO: 11.
- trivalent trispecific binding molecules are provided that are based on the bivalent B-body architecture having a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a C-terminal extension incorporating a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid with a S354C and a T366W mutation; (b) the second polypeptide chain has a domain F and a domain G, wherein
- trivalent trispecific binding molecules are provided that are based on the bivalent B-body architecture having a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a Y349C mutation and a C-terminal extension incorporating a PGK tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has a human IgGl CH3 amino acid with a S354C and a T366W mutation; (b) the second polypeptide chain has a human IgGl CH3 amino acid with a S354C and a T
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NO: 11.
- trivalent trispecific binding molecules are provided that are based on the bivalent B-body architecture having a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a Y349C mutation, a P343 V mutation, and a C-terminal extension incorporating a PGK tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid with a S354C mutation and a T366W mutation; (b)
- the first polypeptide chain has the sequence SEQ ID NO:32
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NO: 11.
- the binding molecule has a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a variable region amino acid sequence, domain B has a human IgA CH3 amino acid sequence, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid sequence; (b) the second polypeptide chain has a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a variable region amino acid sequence and domain G has a human IgA CH3 amino acid sequence; (c) the third polypeptide chain has a domain H,
- domain A and domain F form a first antigen binding site specific for a first antigen; and domain H and domain L form a second antigen binding site specific for a second antigen.
- domain A comprises a VH amino acid sequence
- domain F comprises a VL amino acid sequence
- domain H comprises a VH amino acid sequence
- domain I comprises a CH1 amino acid sequence
- domain L comprises a VL amino acid sequence
- domain M comprises a CL amino acid sequence.
- domain A comprises a first VH amino acid sequence and domain F comprises a first VL amino acid sequence
- domain H comprises a second VH amino acid sequence
- domain L comprises a second VL amino acid sequence.
- domain A comprises a VL amino acid sequence
- domain F comprises a VH amino acid sequence
- domain H comprises a VL amino acid sequence
- domain L comprises a VH amino acid sequence
- domain I comprises a CL amino acid sequence
- domain M comprises a CH1 amino acid sequence.
- the CL amino acid sequence is a CL-kappa sequence.
- domain A comprises a first VL amino acid sequence and domain F comprises a first VH amino acid sequence, domain H comprises a second VL amino acid sequence and domain L comprises a second VH amino acid sequence.
- domain E further comprises a S354C and T366W mutation in the human IgGl CH3 amino acid sequence.
- domain K further comprises a Y349C, a D356E, a L358M, a T366S, a L368A, and a Y407V mutation in the human IgGl CH3 amino acid sequence.
- domain B comprises a first CH3 linker sequence as described in Section 6.3.20.3 that is followed by the DKTHT motif of an IgGl hinge region; and domain G comprises a second CH3 linker sequence as described in Section 6.3.20.3.
- the first CH3 linker sequence associates with the second CH3 linker sequence by formation of a disulfide bridge between cysteine residues of the first and second CH3 linker sequences.
- the first CH3 linker and the second CH3 linker are identical. In some embodiments, the first CH3 linker and second CH3 linker are non-identical. In some embodiments, the first CH3 linker and second CH3 linker differ in length by 1-6 amino acids. In some embodiments, the first CH3 linker and second CH3 linker differ in length by 1-3 amino acids. In some embodiments, the first CH3 linker is AGC and the second CH3 linker is AGKGSC. In some embodiments, the first CH3 linker is AGKGC and the second CH3 linker is AGC. In some embodiments, the first CH3 linker is AGKGSC and the second CH3 linker is AGC. In some embodiments, the first CH3 linker is AGKC and the second CH3 linker is AGC. [00224] In some embodiments, the binding molecule further comprises one or more CH1/CL modifications as described in Sections 6.3.10.3 and 6.3.10.3.
- the binding molecule further comprises a modification that reduces effector function as described in Section 6.8.4.
- the trivalent trispecific binding molecules based on the bivalent B-body architectures described above comprise a sixth polypeptide chain, wherein (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has the first VL amino acid sequence and domain S has a human IgGl CH3 amino acid sequence with a Y349C mutation and a C-terminal extension incorporating a PGK tripeptide sequence that is followed by GSGSGS linker peptide connecting domain S to domain H; (b) the trivalent trispecific binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N-terminus to C- terminus, in a T-U orientation, and wherein domain
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 37
- the fourth polypeptide chain has the sequence SEQ ID NO: 11
- the sixth polypeptide chain has the sequence SEQ ID NO:25.
- the trivalent trispecific binding molecules based on the bivalent B-body architectures described above further comprise a sixth polypeptide chain, wherein (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has a third VL amino acid sequence and domain S has a human IgGl CH3 amino acid sequence with a T366K mutation and a C-terminal extension incorporating a KSC tripeptide sequence that is followed by GSGSGS linker peptide connecting domain S to domain H; (b) the trivalent trispecific binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N- terminus to C-terminus, in a T-U orientation, and wherein domain T has a third VH amino acid sequence and domain U has a human IgGl
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO:45
- the fourth polypeptide chain has the sequence SEQ ID NO: 11
- the sixth polypeptide chain has the sequence SEQ ID NO: 53.
- the various antibody platforms described above are not limiting.
- the trivalent trispecific binding molecules described herein, including specific CDR subsets can be based on any compatible binding molecule platform including, but not limited to, full-length antibodies, Fab fragments, Fvs, scFvs, tandem scFvs, Diabodies, scDiabodies, DARTs, tandAbs, minibodies, camelid VHH, and other antibody fragments or formats known to those skilled in the art.
- Exemplary antibody and antibody fragment formats are described in detail in Brinkmann et al. (MABS, 2017, Vol. 9, No. 2, 182-212), herein incorporated by reference for all that it teaches.
- the trivalent trispecific binding molecule is based on a CrossMabTM platform.
- CrossMabTM antibodies are described in U.S. Patent Nos. 8,242,247; 9,266,967; and 8,227,577, U.S. Patent Application Pub. No. 20120237506, U.S. Patent Application Pub. No. US20090162359, WO2016016299, W02015052230.
- the trivalent trispecific binding molecule is based on a bivalent, bispecific antibody, comprising: a) the light chain and heavy chain of an antibody specifically binding to a first antigen; and b) the light chain and heavy chain of an antibody specifically binding to a second antigen, wherein constant domains CL and CH1 from the antibody specifically binding to a second antigen are replaced by each other.
- the trivalent trispecific binding molecule is based on the format structured with reference to Section 6.4 and FIG. 3, wherein A is VH, B is CH1, D is CH2, E is CH3, F is VL, G is CL, H is VL or VH, I is CL, J is CH2, K is CH3, L is VH or VL, and M is CH1.
- the trivalent trispecific binding molecule is based on an antibody having a general architecture described in U.S. Patent No. 8,871,912 and
- the trivalent trispecific binding molecule is based on a domain-exchanged antibody comprising a light chain (LC) composed of VL- CH3, and a heavy chain (HC) comprising VH-CH3-CH2-CH3, wherein the VL-CH3 of the LC dimerizes with the VH-CH3 of the HC thereby forming a domain-exchanged LC/HC dimer comprising a CH3LC/CH3HC domain pair.
- the trivalent trispecific binding molecule is based on the format structured with reference to Section 6.4 and FIG. 3, wherein A is VH, B is CH3, D is CH2, E is CH3, F is VL, G is CH3, H is VH, I is CH1, J is CH2, K is CH3, L is VL, and M is CL.
- the trivalent trispecific binding molecule is based on the platform as described in WO2017011342. In some embodiments, the trivalent trispecific binding molecule is based on the format structured with reference to Section 6.4 and FIG. 3, wherein A is VH or VL, B is CH2 from IgM or IgE, D is CH2, E is CH3, F is VL or VH, G is CH2 from IgM or IgE, H is VH, I is CH1, J is CH2, K is CH3, L is VL, and M is CL.
- the trivalent trispecific binding molecule is based on the platform as described in W02006093794. In some embodiments, the trivalent trispecific binding molecule is based on the format structured with reference to Section 6.4 and FIG. 3, wherein A is VH, B is CH1, D is CH2, E is CH3, F is VL, G is CL, H is VL, I is CL or CH1,
- J is CH2, K is CH3, L is VH, and M is CH1 or CL.
- Antigen binding sites potentially relevant to the binding molecules described herein may be chosen to specifically bind a wide variety of molecular targets.
- an antigen binding site or sites may specifically bind E-Cad, CLDN7, FGFR2b, N-Cad, Cad-l 1, FGFR2c, ERBB2, ERBB3, FGFR1, FOLR1, IGF-Ira, GLP1R, PDGFRa, PDGFRb, EPHB6, ABCG2, CXCR4, CXCR7, Integrin-avb3, SPARC, VC AM, ICAM, Annexin, TNFa, CD 137, angiopoietin 2, angiopoietin 3, BAFF, beta amyloid, C5, CA-125, CD147, CD125, CD147, CD 152, CD 19, CD20, CD22, CD23, CD24, CD25, CD274, CD28, CD3, CD30, CD33,
- LT LT
- LT-a LT-a
- LT-b Fas, CD27, CD30, and 4-1BBL
- those unassigned to a particular family such as TGF-b, IL 1a, IE-1b, IL-l RA, IL-10 (cytokine synthesis inhibitor F), IL-l 2 (NK cell stimulatory factor), MIF, IL-l 6, IL-l 7 (mCTLA-8), and/or IL-l 8 (IGIF, interferon-g inducing factor)
- the antibody may for example bind two of these targets.
- the Fc portion of the heavy chain of an antibody may be used to target Fc receptor-expressing cells such as the use of the Fc portion of an IgE antibody to target mast cells and basophils.
- An antigen binding site or sites may be chosen that specifically binds the TNF family of receptors including, but not limited to, TNFR1 (also known as CD 120a and TNFRSF1A), TNFR2 (also known as CD 120b and TNFRSF1B), TNFRSF3 (also known as ETbE), TNFRSF4 (also known as 0X40 and CD 134), TNFRSF5 (also known as CD40), TNFRSF6 (also known as FAS and CD95), TNFRSF6B (also known as DCR3), TNFRSF7 (also known as CD27), TNFRSF8 (also known as CD30), TNFRSF9 (also known as 4-1BB), TNFRSF10A (also known as
- TRAILR1, DR4, and CD26 TNFRSF10B (also known as TRAILR2, DR5, and CD262), TNFRSF10C (also known as TRAILR3, DCR1, CD263), TNFRSF10D (also known as TRAILR4, DCR2, and CD264), TNFRSF11 A (also known as RANK and CD265),
- TNFRSF11B also known as OPG
- TNFRSF12A also known as FN14, TWEAKR, and CD266
- TNFRSF13B also known as TACI and CD267
- TNFRSF13C also known as BAFFR, BR3, and CD268
- TNFRSF14 also known as HVEM and CD270
- TNFRSF16 also known as NGFR, p75NTR, and CD271
- TNFRSF17 also known as BCMA and CD269
- TNFRSF18 also known as GITR and CD357
- TNFRSF19 also known as TROY, TAJ, and TRADE
- TNFRSF21 also known as CD358
- TNFRSF25 also known as Apo-3, TRAMP, LARD, or WS-l
- EDA2R also known as XEDAR
- An antigen binding site or sites may be chosen that specifically binds immune- oncology targets including, but not limited to,
- the trivalent trispecific binding molecule has antigen binding sites that specifically bind two tumor associated antigens and a T cell surface expressed molecule.
- the trivalent trispecific binding molecule has antigen binding sites that specifically bind two tumor associated antigens and the T cell surface expressed protein CD3.
- the trivalent trispecific binding molecule that specifically binds the two tumor antigens and the T cell surface expressed molecule ⁇ i.e., CD3) can direct T cell mediated killing (cytotoxicity) of cells expressing the two tumor associated antigens through redirecting T cells to the tumor associated antigens expressing cells (i.e., target cells). T cell mediated killing using bispecific anti-CD3 molecules is described in detail in U.S. Pub. No. 2006/0193852, herein
- the T cell surface expressed molecule is selected from any molecule capable of redirecting T cells to a target cell.
- the one or more affinities of individual ABSs for the two tumor associated antigens do not have has a KD value that qualifies as specifically binding their respective antigens or epitopes on their own, but the avidity of the trivalent trispecific binding molecule for a specific target cell expressing the two tumor associated antigens has a KD value such that the interaction is a specific binding interaction.
- an antigen binding site or sites may be chosen that specifically target tumor-associated cells.
- the antigen binding site or sites specifically target tumor associated immune cells.
- the antigen binding site or sites specifically target tumor associated regulatory T cells (Tregs).
- a binding molecule has antigen binding sites specific for antigens selected from one or more of CD25, 0X40, CTLA-4, and NRP1 such that the binding molecule specifically targets tumor associated regulatory T cells.
- a binding molecule has antigen binding sites that specifically bind CD25 and 0X40, CD25 and CTLA-4, CD25 and NRP1, 0X40 and CTLA-4, 0X40 and NRP1, or CTLA-4 and NRP1 such that the binding molecule specifically targets tumor associated regulatory T cells.
- a bispecific bivalent binding molecule has antigen binding sites that specifically bind CD25 and 0X40, CD25 and CTLA-4, CD25 and NRPl, 0X40 and
- CTLA-4, 0X40 and NRP1, or CTLA-4 and NRP1 such that the binding molecule specifically targets tumor associated regulatory T cells.
- the specific targeting of the tumor associated regulatory T cells results in depletion (e.g. killing) of the regulatory T cells.
- the depletion of the regulatory T cells is mediated by an antibody-drug conjugate (ADC) modification, such as an antibody conjugated to a toxin, as discussed in more detail below in Section 6.8.1.
- ADC antibody-drug conjugate
- the trivalent trispecific binding molecule has additional modifications.
- the trivalent trispecific binding molecule is conjugated to a therapeutic agent (i.e. drug) to form a trivalent trispecific binding molecule-drug conjugate.
- therapeutic agents include, but are not limited to, chemotherapeutic agents, imaging agents (e.g. radioisotopes), immune modulators (e.g. cytokines, chemokines, or checkpoint inhibitors), and toxins (e.g. cytotoxic agents).
- the therapeutic agents are attached to the trivalent trispecific binding molecule through a linker peptide, as discussed in more detail below in Section 6.8.3.
- ADCs antibody-drug conjugates
- Methods of preparing antibody-drug conjugates (ADCs) that can be adapted to conjugate drugs to the trivalent trispecific binding molecules disclosed herein are described, e.g., in US patent no. 8,624,003 (pot method), US patent no. 8,163,888 (one-step), US patent no. 5,208,020 (two-step method), US patent No. 8,337,856, US patent no. 5,773,001, US patent no. 7,829,531, US patent no. 5,208,020, US patent no. 7,745,394, WO 2017/136623, WO 2017/015502, WO 2017/015496, WO 2017/015495, WO 2004/010957, WO
- the trivalent trispecific binding molecule has modifications that comprise one or more additional binding moieties.
- the binding moieties are antibody fragments or antibody formats including, but not limited to, full-length antibodies, Fab fragments, Fvs, scFvs, tandem scFvs, Diabodies, scDiabodies, DARTs, tandAbs, minibodies, camelid VHH, and other antibody fragments or formats known to those skilled in the art. Exemplary antibody and antibody fragment formats are described in detail in Brinkmann et al. ⁇ MABS, 2017, Vol. 9, No. 2, 182-212), herein incorporated by reference for all that it teaches.
- the one or more additional binding moieties are attached to the C-terminus of the first or third polypeptide chain. In particular embodiments, the one or more additional binding moieties are attached to the C-terminus of both the first and third polypeptide chain. In particular embodiments, the one or more additional binding moieties are attached to the C-terminus of both the first and third polypeptide chains. In certain embodiments, individual portions of the one or more additional binding moieties are separately attached to the C-terminus of the first and third polypeptide chains such that the portions form the functional binding moiety.
- the one or more additional binding moieties are attached to the N-terminus of any of the polypeptide chains (e.g. the first, second, third, fourth, fifth, or sixth polypeptide chains).
- individual portions of the additional binding moieties are separately attached to the N-terminus of different polypeptide chains such that the portions form the functional binding moiety.
- the one or more additional binding moieties are specific for a different antigen or epitope of the ABSs within the trivalent trispecific binding molecule. In certain embodiments, the one or more additional binding moieties are specific for the same antigen or epitope of the ABSs within the trivalent trispecific binding molecule. In certain embodiments, wherein the modification is two or more additional binding moieties, the additional binding moieties are specific for the same antigen or epitope. In certain embodiments, wherein the modification is two or more additional binding moieties, the additional binding moieties are specific for different antigens or epitopes.
- the one or more additional binding moieties are attached to the trivalent trispecific binding molecule using in vitro methods including, but not limited to, reactive chemistry and affinity tagging systems, as discussed in more detail below in Section 6.8.3.
- the one or more additional binding moieties are attached to the trivalent trispecific binding molecule through Fc-mediated binding (e.g. Protein A/G).
- the one or more additional binding moieties are attached to the trivalent trispecific binding molecule using recombinant DNA techniques, such as encoding the nucleotide sequence of the fusion product between the trivalent trispecific binding molecule and the additional binding moieties on the same expression vector (e.g. plasmid).
- the trivalent trispecific binding molecule has modifications that comprise functional groups or chemically reactive groups that can be used in
- downstream processes such as linking to additional moieties (e.g. drug conjugates and additional binding moieties, as discussed in more detail above in Sections 6.8.1. and 6.8.2.) and downstream purification processes.
- additional moieties e.g. drug conjugates and additional binding moieties, as discussed in more detail above in Sections 6.8.1. and 6.8.2.
- the modifications are chemically reactive groups including, but not limited to, reactive thiols (e.g. maleimide based reactive groups), reactive amines (e.g. A-hydroxy sued ni mi de based reactive groups),“click chemistry” groups (e.g. reactive alkyne groups), and aldehydes bearing formylglycine (FGly).
- the modifications are functional groups including, but not limited to, affinity peptide sequences (e.g. HA, HIS, FLAG, GST, MBP, and Strep systems etc.).
- the functional groups or chemically reactive groups have a cleavable peptide sequence.
- the cleavable peptide is cleaved by means including, but not limited to, photocleavage, chemical cleavage, protease cleavage, reducing conditions, and pH conditions.
- protease cleavage is carried out by intracellular proteases.
- protease cleavage is carried out by extracellular or membrane associated proteases.
- ADC therapies adopting protease cleavage are described in more detail in Choi et al. ( Theranostics , 2012; 2(2): 156-178.), the entirety of which is hereby incorporated by reference for all it teaches. 6.8.4.
- the trivalent trispecific binding molecule has one or more engineered mutations in an amino acid sequence of an antibody domain that reduce the effector functions generally associated with antibody binding.
- Effector functions include, but are not limited to, cellular functions that result from an Fc receptor binding to an Fc portion of an antibody, such as antibody dependent cellular cytotoxicity (ADCC), complement fixation ( e.g . Clq binding), antibody dependent cellular-mediated phagocytosis (ADCP), opsonization.
- ADCC antibody dependent cellular cytotoxicity
- ADCP antibody dependent cellular-mediated phagocytosis
- Engineered mutations that reduce the effector functions are described in more detail in ET.S. Pub. No. 2017/0137530, Armour, et al. (Eur. J. Immunol.
- the trivalent trispecific binding molecule has one or more engineered mutations in an amino acid sequence of an antibody domain that reduce binding of an Fc portion of the trivalent trispecific binding molecule by FcR receptors.
- the FcR receptors are FcRy receptors.
- the FcR receptors are FcyRIIa and/or FcyRIIIA receptors.
- the one or more engineered mutations that reduce effector function are mutations in a CH2 domain of an antibody.
- the one or more engineered mutations are at position L234 and L235 of the CH2 domain.
- the one or more engineered mutations are L234A and L235A of the CH2 domain.
- the one or more engineered mutations are at position L234, L235, and P329 of the CH2 domain.
- the one or more engineered mutations are L234A, L235A, and P329G of the CH2 domain.
- the one or more engineered mutations are L234A, L235A, and P329K of the CH2 domain.
- a method of purifying a trivalent trispecific binding molecule comprising a B-body platform is provided herein.
- the method comprises the steps of: i) contacting a sample comprising the trivalent trispecific binding molecule with a CH1 binding reagent, wherein the trivalent trispecific binding molecule comprises at least a first, a second, a third, and a fourth polypeptide chain associated in a complex, wherein the complex comprises at least one CH1 domain, or portion thereof, and wherein the number of CH1 domains in the complex is at least one fewer than the valency of the complex, and wherein the contacting is performed under conditions sufficient for the CH1 binding reagent to bind the CH1 domain, or portion thereof; and ii) purifying the complex from one or more incomplete complexes, wherein the incomplete complexes do not comprise the first, the second, the third, and the fourth polypeptide chain.
- a typical antibody has two CH1 domains.
- CH1 domains are described in more detail in Section 6.3.10.1.
- the CH1 domain typically found in the protein has been substituted with another domain, such that the number of CH1 domains in the protein is effectively reduced.
- the CH1 domain of a typical antibody can be substituted with a CH3 domain, generating an antigen-binding protein having only a single CH1 domain.
- Trivalent trispecific binding molecules can also refer to molecules based on antibody architectures that have been engineered such that they no longer possess a typical antibody architecture.
- an antibody can be extended at its N or C terminus to increase the valency (described in more detail in Section 6.3.15.1) of the antigen-binding protein, and in certain instances the number of CH1 domains is also increased beyond the typical two CH1 domains.
- Such molecules can also have one or more of their CH1 domains substituted, such that the number of CH1 domains in the protein is at least one fewer than the valency of the antigen-binding protein.
- the number of CH1 domains that are substituted by other domains generates a trivalent trispecific binding molecule having only a single CH1 domain.
- the number of CH1 domains substituted by another domain generates a trivalent trispecific binding molecule having two or more CH1 domains, but at least one fewer than the valency of the antigen-binding protein.
- the multiple CH1 domains can all be in the same polypeptide chain.
- the multiple CH1 domains can be a single CH1 domain in multiple copies of the same polypeptide chain present in the complete complex.
- a sample comprising the trivalent trispecific binding molecules is contacted with CH1 binding reagents.
- CH1 binding reagents as described herein, can be any molecule that specifically binds a CH1 epitope.
- the various CH1 sequences that provide the CH1 epitope are described in more detail in Section 6.3.10.1, and specific binding is described in more detail in Section 6.3.15.1.
- CH1 binding reagents are derived from immunoglobulin proteins and have an antigen binding site (ABS) that specifically binds the CH1 epitope.
- the CH1 binding reagent is an antibody, also referred to as an“anti- CH1 antibody.”
- the anti-CHl antibody can be derived from a variety of species.
- the anti-CHl antibody is a mammalian antibody, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human antibodies.
- the anti-CHl antibody is a single-domain antibody.
- Single-domain antibodies as described herein, have a single variable domain that forms the ABS and specifically binds the CH1 epitope.
- Exemplary single-domain antibodies include, but are not limited to, heavy chain antibodies derived from camels and sharks, as described in more detail in international application WO 2009/011572, herein incorporated by reference for all it teaches.
- the anti-CHl antibody is a camel derived antibody (also referred to as a“camelid antibody”).
- camelid antibodies include, but are not limited to, human IgG-CHl CaptureSelectTM (ThermoFisher, #194320010) and human IgA-CHl
- the anti-CHl antibody is a monoclonal antibody.
- Monoclonal antibodies are typically produced from cultured antibody-producing cell lines.
- the anti-CHl antibody is a polyclonal antibody, i.e., a collection of different anti-CHl antibodies that each recognize the CH1 epitope.
- Polyclonal antibodies are typically produced by collecting the antibody containing serum of an animal immunized with the antigen of interest, or fragment thereof, here CH1.
- CH1 binding reagents are molecules not derived from immunoglobulin proteins.
- examples of such molecules include, but are not limited to, aptamers, peptoids, and affibodies, as described in more detail in Perret and Boschetti ( Biochimie , Feb. 2018, Vol 145:98-112).
- the CH1 binding reagent can be attached to a solid support in various ways.
- Solid supports refers to a material to which other entities can be attached or immobilized, e.g ., the CH1 binding reagent.
- Solid supports also referred to as“carriers,” are described in more detail in international application WO 2009/011572.
- the solid support comprises a bead or nanoparticle.
- beads and nanoparticles include, but are not limited to, agarose beads, polystyrene beads, magnetic nanoparticles (e.g ., DynabeadsTM, ThermoFisher), polymers (e.g ., dextran), synthetic polymers (e.g., SepharoseTM), or any other material suitable for attaching the CH1 binding reagent.
- the solid support is modified to enable attachment of the CH1 binding reagent.
- Example of solid support modifications include, but are not limited to, chemical modifications that form covalent bonds with proteins (e.g, activated aldehyde groups) and modifications that specifically pair with a cognate modification of a CH1 binding reagent (e.g, biotin-streptavidin pairs, disulfide linkages, polyhistidine-nickel, or“click-chemistry” modifications such as azido-alkynyl pairs).
- chemical modifications that form covalent bonds with proteins e.g, activated aldehyde groups
- modifications that specifically pair with a cognate modification of a CH1 binding reagent e.g, biotin-streptavidin pairs, disulfide linkages, polyhistidine-nickel, or“click-chemistry” modifications such as azido-alkynyl pairs.
- the CH1 binding reagent is attached to the solid support prior to the CH1 binding reagent contacting the trivalent trispecific binding molecules, herein also referred to as an“anti-CHl resin.”
- anti-CHl resins are dispersed in a solution.
- anti-CHl resins are“packed” into a column. The anti- CHl resin is then contacted with the trivalent trispecific binding molecules and the CH1 binding reagents specifically bind the trivalent trispecific binding molecules.
- the CH1 binding reagent is attached to the solid support after the CH1 binding reagent contacts the trivalent trispecific binding molecules.
- a CH1 binding reagent with a biotin modification can be contacted with the trivalent trispecific binding molecules, and subsequently the CH1 binding
- reagent/trivalent trispeicifc binding molecule mixture can be contacted with streptavidin modified solid support to attach the CH1 binding reagent to the solid support, including CH1 binding reagents specifically bound to the trivalent trispecific binding molecules.
- the bound trispecific trivalent binding molecules are released, or “eluted,” from the solid support forming an eluate having the trivalent trispecific binding molecules.
- the bound trispecific trivalent binding molecules are released through reversing the paired modifications (e.g, reduction of the disulfide linkage), adding a reagent to compete off the trivalent trispecific binding molecules (e.g, adding imidazole that competes with a polyhistidine for binding to nickel), cleaving off the trivalent trispecific binding molecules (e.g, a cleavable moiety can be included in the modification), or otherwise interfering with the specific binding of the CH1 binding reagent for the trivalent trispecific binding molecule.
- Methods that interfere with specific binding include, but are not limited to, contacting trispecific trivalent binding molecules bound to CH1 binding reagents with a low-pH solution.
- the low-pH solution comprises 0.1 M acetic acid pH 4.0.
- the bound trispecific trivalent binding molecules can be contacted with a range of low-pH solutions, i.e., a“gradient.”
- a single iteration of the method using the steps of contacting the trivalent trispecific binding molecules with the CH1 binding reagents, followed by eluting the trivalent trispecific binding molecules is used to purify the trivalent trispecific binding molecules from the one or more incomplete complexes.
- no other purifying step is performed.
- one or more additional purification steps are performed to further purify the trivalent trispecific binding molecules from the one or more incomplete complexes.
- the one or more additional purification steps include, but are not limited to, purifying the trivalent trispecific binding molecules based on other protein characteristics, such as size (e.g ., size exclusion chromatography), charge (e.g., ion exchange chromatography), or hydrophobicity (e.g, hydrophobicity interaction chromatography).
- size e.g ., size exclusion chromatography
- charge e.g., ion exchange chromatography
- hydrophobicity e.g, hydrophobicity interaction chromatography
- an additional cation exchange chromatograph is performed.
- the trivalent trispecific binding molecules can be further purified repeating contacting the trivalent trispecific binding molecules with the CH1 binding reagents as described above, as well as modifying the CH1 purification method between iterations, e.g, using a step elution for the first iteration and a gradient elution for a subsequent elution.
- At least four distinct polypeptide chains associate together to form a complete complex, i.e., the trivalent trispecific binding molecule.
- incomplete complexes can also form that do not contain the at least four distinct polypeptide chains.
- incomplete complexes may form that only have one, two, or three of the polypeptide chains.
- an incomplete complex may contain more than three polypeptide chains, but does not contain the at least four distinct polypeptide chains, e.g, the incomplete complex inappropriately associates with more than one copy of a distinct polypeptide chain.
- the method of the invention purifies the complex, i.e., the completely assembled trispecific trivalent binding molecule, from incomplete complexes.
- Methods to assess the efficacy and efficiency of the purification steps are well known to those skilled in the art and include, but are not limited to, SDS-PAGE analysis, ion exchange chromatography, size exclusion chromatography, and mass spectrometry. Purity can also be assessed according to a variety of criteria.
- criterion examples include, but are not limited to: 1) assessing the percentage of the total protein in an eluate that is provided by the completely assembled trispecific trivalent binding molecule, 2) assessing the fold enrichment or percent increase of the method for purifying the desired products, e.g ., comparing the total protein provided by the completely assembled trispecific trivalent binding molecule in the eluate to that in a starting sample, 3) assessing the percentage of the total protein or the percent decrease of undesired products, e.g., the incomplete complexes described above, including determining the percent or the percent decrease of specific undesired products (e.g, unassociated single polypeptide chains, dimers of any combination of the polypeptide chains, or trimers of any combination of the polypeptide chains).
- specific undesired products e.g, unassociated single polypeptide chains, dimers of any combination of the polypeptide chains, or trimers of any combination of the polypeptide chains.
- Purity can be assessed after any combination of methods described herein. For example, purity can be assessed after a single iteration of using the anti-CHl binding reagent, as described herein, or after additional purification steps, as described in more detail in Section 6.9.3. The efficacy and efficiency of the purification steps may also be used to compare the methods described using the anti-CHl binding reagent to other purification methods known to those skilled in the art, such as Protein A purification.
- the trivalent trispecific binding molecules described herein can readily be manufactured by expression using standard cell free translation, transient transfection, and stable transfection approaches currently used for antibody manufacture.
- Expi293 cells can be used for production of the trivalent trispecific binding molecules using protocols and reagents from ThermoFisher, such as ExpiFectamine, or other reagents known to those skilled in the art, such as polyethylenimine as described in detail in Fang et al. (Biological Procedures Online, 2017, 19: 11), herein incorporated by reference for all it teaches.
- the expressed proteins can be readily separated from undesired proteins and protein complexes using a CH1 affinity resin, such as the CaptureSelect CH1 resin and provided protocol from ThermoFisher.
- CH1 affinity resin such as the CaptureSelect CH1 resin and provided protocol from ThermoFisher.
- Other purification strategies include, but are not limited to, use of Protein A, Protein G, or Protein A/G reagents. Further purification can be affected using ion exchange chromatography as is routinely used in the art.
- compositions that comprise a trivalent trispecific binding molecule as described herein and a pharmaceutically acceptable carrier or diluent.
- the pharmaceutical composition is sterile.
- the pharmaceutical composition comprises the trivalent trispecific binding molecule at a concentration of 0.1 mg/ml - 100 mg/ml. In specific embodiments, the pharmaceutical composition comprises the trivalent trispecific binding molecule at a concentration of 0.5 mg/ml, 1 mg/ml, 1.5 mg/ml, 2 mg/ml, 2.5 mg/ml, 5 mg/ml, 7.5 mg/ml, or 10 mg/ml. In some embodiments, the pharmaceutical composition comprises the trivalent trispecific binding molecule at a concentration of more than 10 mg/ml.
- the trivalent trispecific binding molecule is present at a concentration of 20 mg/ml, 25 mg/ml, 30 mg/ml, 35 mg/ml, 40 mg/ml, 45 mg/ml, or even 50 mg/ml or higher. In particular embodiments, the trivalent trispecific binding molecule is present at a concentration of more than 50 mg/ml.
- the pharmaceutical compositions are described in more detail in U.S. Pat No. 8,961,964, U.S. Pat No. 8,945,865, U.S. Pat No. 8,420,081, U.S. Pat No. 6,685,940, U.S. Pat No. 6,171,586, U.S. Pat No. 8,821,865, U.S. Pat No. 9,216,219, US application 10/813,483, WO 2014/066468, WO 2011/104381, and WO 2016/180941, each of which is incorporated herein in its entirety.
- methods of treatment comprising administering a trivalent trispecific binding molecule as described herein to a patient in an amount effective to treat the patient.
- an antibody of the present disclosure may be used to treat a cancer.
- the cancer may be a cancer from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus.
- the cancer may be a neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma;
- lymphoepithelial carcinoma basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma;
- chromophobe carcinoma acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometroid carcinoma; skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous
- cystadenocarcinoma mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma;
- inflammatory carcinoma paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; androblastoma, malignant; sertoli cell carcinoma; leydig cell tumor, malignant; lipid cell tumor, malignant; paraganglioma, malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malig melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma
- choriocarcinoma mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant; kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma;
- osteosarcoma juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma;
- astrocytoma protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; meningioma, malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; hodgkin's disease; hodgkin's; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-hodgkin's lymphomas;
- malignant histiocytosis multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; and hairy cell leukemia.
- An antibody of the present disclosure may be administered to a subject per se or in the form of a pharmaceutical composition for the treatment of, e.g., cancer, autoimmunity, transplantation rejection, post-traumatic immune responses, graft-versus-host disease, ischemia, stroke, and infectious diseases, for example by targeting viral antigens, such as gpl20 of HIV.
- a pharmaceutical composition for the treatment of, e.g., cancer, autoimmunity, transplantation rejection, post-traumatic immune responses, graft-versus-host disease, ischemia, stroke, and infectious diseases, for example by targeting viral antigens, such as gpl20 of HIV.
- Non-limiting, illustrative methods for the purification of the various antigen-binding proteins and their use in various assays are described in more detail below.
- the various antigen-binding proteins tested were expressed using the Expi293 transient transfection system according to manufacturer’s instructions. Briefly, four plasmids coding for four individual chains were mixed at 1 : 1 : 1 : 1 mass ratio, unless otherwise stated, and transfected with ExpiFectamine 293 transfection kit to Expi 293 cells. Cells were cultured at 37°C with 8% C02, 100% humidity and shaking at 125 rpm. Transfected cells were fed once after 16-18 hours of transfections. The cells were harvested at day 5 by centrifugation at 2000 g for 10 munities. The supernatant was collected for affinity chromatography purification.
- the elution was monitored by absorbance at 280 nm and the elution peaks were pooled for analysis.
- a 1 mL CaptureSelectTM XL column (ThermoFisher) was equilibrated with PBS. The sample was loaded onto the column at 5 ml/min. The sample was eluted using 0.1 M acetic acid pH 4.0. The elution was monitored by absorbance at 280 nm and the elution peaks were pooled for analysis.
- Samples containing the various separated antigen-binding proteins were analyzed by mass spectrometry to confirm the correct species by molecular weight. All analysis was performed by a third-party research organization. Briefly, samples were treated with a cocktail of enzymes to remove glycosylation. Samples were both tested in the reduced format to specifically identify each chain by molecular weight. Samples were all tested under non-reducing conditions to identify the molecular weights of all complexes in the samples. Mass spec analysis was used to identify the number of unique products based on molecular weight.
- Biotinylated antigen of interest are purchased or synthesized. Phage clones are screened for the ability to bind antigens of interest by phage ELISA using standard protocols. Briefly, Fab- formatted phage libraries are constructed using expression vectors capable of replication and expression in phage (also referred to as a phagemid). Both the heavy chain and the light chain were encoded for in the same expression vector, where the heavy chain was fused to a truncated variant of the phage coat protein pill. The light chain and heavy chain-pill fusion are expressed as separate polypeptides and assemble in the bacterial periplasm, where the redox potential enables disulfide bond formation, to form the phage display antibody containing the candidate ABS.
- phage display heavy chain (SEQ ID NO:74) and light chain (SEQ ID NO:75) scaffolds used in the library are listed below, where a lower case“x” represents CDR amino acids that were varied to create the library, and bold italic represents the CDR sequences that were constant.
- Specific libraries are generated by introducing diversity into VL and VH CDR sequences. Diversity is created through Kunkel mutagenesis using primers to introduce diversity into VL CDR3 and VH CDR1 (Hl), CDR2 (H2) and CDR3 (H3) to mimic the diversity found in the natural antibody repertoire, as described in more detail in Kunkel, TA ( PNAS January 1, 1985. 82 (2) 488-492), herein incorporated by reference in its entirety.
- single-stranded DNA are prepared from isolated phage using standard procedures and Kunkel mutagenesis carried out. Chemically synthesized DNA are then electroporated into TG1 cells, followed by recovery. Recovered cells are sub-cultured and infected with M13K07 helper phage to produce the phage library.
- Phage panning is performed using standard procedures. Briefly, the first round of phage panning are performed with target immobilized on streptavidin magnetic beads which are subjected to ⁇ 5xl0 12 phages from the prepared library in a volume of 1 mL in PBST-2% BSA. After a one-hour incubation, the bead-bound phage are separated from the supernatant using a magnetic stand. Beads are washed three times to remove non-specifically bound phage and are then added to ER2738 cells (5 mL) at OD 6 oo ⁇ 0.6.
- infected cells are sub-cultured in 25 mL 2xYT + Ampicillin and M13K07 helper phage and allowed to grow overnight at 37 °C with vigorous shaking.
- phage are prepared using standard procedures by PEG precipitation. Pre-clearance of phage specific to SAV-coated beads is performed prior to panning.
- the second round of panning is performed using the KingFisher magnetic bead handler with 100 nM bead-immobilized antigen using standard procedures.
- 3-4 rounds of phage panning are performed to enrich in phage displaying Fabs specific for the target antigen. Target-specific enrichment is confirmed using polyclonal and monoclonal phage ELISA. DNA sequencing is used to determine isolated Fab clones containing a candidate ABS.
- VL and VH domains identified in the phage screen described above were formatted into a bivalent monospecific native human full-length IgGl architecture and immobilized to a biosensor on an Octet (Pall ForteBio) biolayer interferometer. Soluble antigens of interest are then added to the system and binding measured.
- VL variable regions of individual clones are formatted into Domain A and/or H, and VH region into Domain F and/or L of a bivalent lxl B-Body“BC1” scaffold shown below and with reference to FIG.
- Domain A Antigen 1 B-Body Domain A/H Scaffold (SEQ ID NO:76)
- Domain B CH3 (T366K; 445K, 446S, 447C tripeptide insertion)
- Domain D CH2
- Domain H Antigen 2 B-Body Domain A/H Scaffold (SEQ ID NO:76)
- Domain I CL (Kappa)
- variable domains are formatted into Chains 1, 2, and 4 above, as well as the Chain 3 scaffold with the sequence of SEQ ID NO: 82, where the junction between domain S and domain H is a 10 amino acid linker having the sequence TASSGGSSSG (SEQ ID NO:83).
- Polypeptide Chain 2 and Chain 6 are identical in the 1x2 format.
- the NFKB/Jurkat/GFP transcriptional reporter cell line was purchased from System Biosciences (Cat #TR850- 1 )
- the anti-CD28 antibody used for co-stimulation was purchased from BD Pharmingen (Cat 555725).
- the Solution C background suppression dye was purchased from Life Technologies (K1037). Briefly, the Jurkat cells (effector cells, E) were mixed with the tumor cells (T) at an E:T ratio of 2: 1 to 4: 1 in the presence of a dilution series of B-bodyTM antibodies and an anti-CD28 antibody at 1 ug/mL in a 96 well black walled clear bottom plate. The plate was incubated at 37°C/5% CO2 for 6 hours, following which a 6X solution of Solution C background suppressor was added to the plate and GFP
- T tumor antigen
- E effector cells
- Effector cells used include PBMCs or isolated cytotoxic CD8+ T cells.
- the candidate redirecting T cell antibody was added in a dilution series to the cells.
- Controls included media only controls, tumor cell only controls, and untreated E:T cell controls.
- the mixed cells and control conditions were incubated at 37°C/5% CO2 for 40-50 hours.
- the Cytotoxicity Detection Kit Plus (LDH) was purchased from Sigma (Cat
- lysis solution added to tumor cells served as the 100% cytotoxicity control and untreated E:T cells served as the 0% cytotoxicity control.
- the level of lactate dehydrogenase (LDH) in each sample was determined via absorbance at 490 nm and normalize to the 100% and 0% controls.
- EC50 values referring to the concentration of antibody that gives the half-maximal response, were determined from the dilution series.
- a bivalent monospecific B-Body recognizing TNFa was constructed with the following architecture (VL(Certolizumab)-CH3(Knob)-CH2-CH3/VH(Certolizumab)- CH3(Hole)) using standard molecular biology procedures.
- VL(Certolizumab)-CH3(Knob)-CH2-CH3/VH(Certolizumab)- CH3(Hole) using standard molecular biology procedures.
- FIG. 3 The overall construct architecture is illustrated in FIG. 4.
- the full-length construct was expressed in an E. coli cell free protein synthesis expression system for -18 hours at 26 °C with gentle agitation. Following expression, the cell-free extract was centrifuged to pellet insoluble material and the supernatant was diluted 2x with lOx Kinetic Buffer (Forte Bio) and used as the analyte for biolayer interferometry.
- Biotinylated TNFa was immobilized on a streptavidin sensor to give a wave shift response of -1.5 nm. After establishing a baseline with lOx kinetic buffer, the sensor was dipped into the antibody construct analyte solution. The construct gave a response of -3 nm, comparable to the traditional IgG format of certolizumab, demonstrating the ability of the bivalent monospecific construct to assemble into a functional, full-length antibody. Results are shown in FIG. 5.
- sequences are provided respectively in SEQ ID NO:3 (lst polypeptide chain), SEQ ID NO:4 (2nd polypeptide chain), SEQ ID NO:5 (3rd polypeptide chain), SEQ ID NO:6 (4th polypeptide chain).
- the A domain (SEQ ID NO: 12) and F domain (SEQ ID NO: 16) form an antigen binding site (A:F) specific for“Antigen A”.
- the H domain has the VH sequence from nivolumab and the L domain has the VL sequence from nivolumab; H and L associate to form an antigen binding site (H:L) specific for human PD1.
- the B domain (SEQ ID NO: 13) has the sequence of human IgGl CH3 with several mutations: T366K, 445K, 446S, and 447C insertion.
- T366K mutation is a charge pair cognate of the L351D residue in Domain G.
- The“447C” residue on domain B comes from the C-terminal KSC tripeptide insertion.
- Domain D (SEQ ID NO: 14) has the sequence of human IgGl CH2
- Domain E (SEQ ID NO: 15) has the sequence of human IgGl CH3 with the mutations T366W and S354C.
- the 366W is the“knob” mutation.
- the 354C introduces a cysteine that is able to form a disulfide bond with the cognate 349C mutation in Domain K.
- Domain G (SEQ ID NO: 17) has the sequence of human IgGl CH3 with the following mutations: L351D, and 445G, 446E, 447C tripeptide insertion.
- L351D mutation introduces a charge pair cognate to the Domain B T366K mutation.
- The“447C” residue on domain G comes from the C-terminal GEC tripeptide insertion.
- Domain I (SEQ ID NO: 19) has the sequence of human C kappa light chain (CK)
- Domain J (SEQ ID NO: 20] has the sequence of human IgGl CH2 domain, and is identical to the sequence of domain D.
- Domain K [SEQ ID NO: 21] has the sequence of human IgGl CH3 with the following changes: Y349C, D356E, L358M, T366S, L368A, Y407V.
- the 349C mutation introduces a cysteine that is able to form a disulfide bond with the cognate 354C mutation in Domain E.
- the 356E and L358M introduce isoallotype amino acids that reduce
- the 366S, 368A, and 407V are“hole” mutations.
- Domain M [SEQ ID NO: 23] has the sequence of the human IgGl CH1 region.
- bivalent bispecific“BC1” protein could easily be purified in a single step using a CH1 -specific CaptureSelectTM affinity resin from ThermoFisher.
- FIG. 7A SEC analysis demonstrates that a single-step CH1 affinity purification step yields a single, monodisperse peak via gel filtration in which >98% is monomer.
- FIG. 7B shows comparative literature data of SEC analysis of a CrossMab bivalent antibody construct.
- FIG. 8A is a cation exchange chromatography elution profile of“BC1” following one-step purification using the CaptureSelectTM CH1 affinity resin, showing a single tight peak.
- FIG. 8B is a cation exchange chromatography elution profile of“BC1” following purification using standard Protein A purification, showing additional elution peaks consistent with the co-purification of incomplete assembly products.
- FIG. 9 shows SDS-PAGE gels under non-reducing conditions.
- single-step purification of“BC1” with CH1 affinity resin provides a nearly homogeneous single band, with lane 4 showing minimal additional purification with a subsequent cation exchange polishing step.
- Lane 7, by comparison, shows less substantial purification using standard Protein A purification, with lanes 8-10 demonstrating further purification of the Protein A purified material using cation exchange chromatography.
- FIG. 10 compares SDS-PAGE gels of “BC1” after single-step CH1 -affinity purification, under both non-reducing and reducing conditions (Panel A) with SDS-PAGE gels of a CrossMab bispecific antibody under non-reducing and reducing conditions as published in the referenced literature (Panel B).
- FIG. 11 shows mass spec analysis of“BC1”, demonstrating two distinct heavy chains (FIG. 11 A) and two distinct light chains (FIG. 11B) under reducing conditions.
- the mass spectrometry data in FIG. 12 confirms the absence of incomplete pairing after purification.
- Table 1 compares“BC1” to CrossMab in key developability characteristics:
- FIG. 15A shows SEC analysis of“BC6” following one-step purification using the CaptureSelectTM CH1 affinity resin.
- the data demonstrate that the single step CH1 affinity purification yields a single monodisperse peak, similar to what we observed with“BC1”, demonstrating that the disulfide bonds between polypeptide chains 1 and 2 and between polypeptide chains 3 and 4 are intact.
- the chromatogram also shows the absence of non-covalent aggregates.
- FIG. 15B shows a SDS-PAGE gel under non-reducing conditions, with lane 1 loaded with a first lot of“BC6” after a single-step CH1 affinity purification, lane 2 loaded with a second lot of“BC6” after a single-step CH1 affinity purification. Lanes 3 and 4 demonstrate further purification can be achieved with ion exchange chromatography subsequent to CH1 affinity purification.
- Polypeptide chain 1 “BC28” chain 1 (SEQ ID NO:24)
- Polypeptide chain 2 “BC28” chain 2 (SEQ ID NO:25)
- Polypeptide chain 3:“BC1” chain 3 (SEQ ID NO: 10)
- Polypeptide chain 4:“BC1” chain 4 (SEQ ID NO: 11)
- The“BC28” A:F antigen binding site is specific for“Antigen A”.
- The“BC28” H:L antigen binding site is specific for PD1 (nivolumab sequences).
- “BC28” domain B has the following changes as compared to wild type CH3: Y349C; 445P, 446G, 447K insertion.
- “BC28” domain E has the following changes as compared to wild type CH3: S354C, T366W.
- “BC28” domain G has the following changes as compared to wild type: S354C; 445P, 446G, 447K insertion.
- “BC29” has engineered cysteines at residue 351C of Domain B and 351C of Domain G (“351C-351C”).“BC30” has an engineered cysteine at residue 354C of Domain B and 349C of Domain G (“354C-349C”). BC31 has an engineered cysteine at residue 394C and engineered cysteine at 394C of Domain G (“394C-394C”). BC32 has engineered cysteines at residue 407C of Domain B and 407C of Domain G (“407C-407C”).
- FIG. 17 shows SDS-PAGE analysis under non-reducing conditions following one- step purification using the CaptureSelectTM CH1 affinity resin.
- Lanes 1 and 3 show high levels of expression and substantial homogeneity of intact“BC28” (lane 1) and“BC30” (lane 3).
- Lane 2 shows oligomerization of BC29.
- Lanes 4 and 5 show poor expression of BC31 and BC32, respectively, and insufficient linkage in BC32.
- Another construct, BC9 which had cysteines introduced at residue 392 in domain B and 399 in Domain G (“392C-399C”), a disulfide pairing reported by Genentech, demonstrated oligomerization on SDS PAGE (data not shown).
- FIG. 18 shows SEC analysis of“BC28” and“BC30” following one-step purification using the CaptureSelectTM CH1 affinity resin.
- “BC28” can readily be purified using a single step purification using Protein A resin (results not shown).
- FIG. 19 shows the general architecture of the bivalent bispecific lxl B-Body “BC44”, our currently preferred bivalent bispecific lxl construct.
- BC44 chain 1 SEQ ID NO:32
- FIG. 20 shows size exclusion chromatography of“BC15” and“BC16” samples at the indicated week of an accelerated stability testing protocol at 40° C. “BC15” remained stable;“BC16” proved to be unstable over time. 6.13.8.
- Example 7 Trivalent 2x1 Bispecific B-Body construct (“BCl-2xl”)
- FIG. 23 shows non-reducing SDS-PAGE of protein expressed using the
- ThermoFisher Expi293 transient transfection system ThermoFisher Expi293 transient transfection system.
- Lane 1 shows the eluate of the trivalent 2x1“BC1-2X1” protein following one-step purification using the CaptureSelectTM CH1 affinity resin.
- Lane 2 shows the lower molecular weight, faster migrating, bivalent“BC1” protein following one-step purification using the CaptureSelectTM CH1 affinity resin.
- Lanes 3-5 demonstrate purification of“BCl-2xl” using protein A.
- Lanes 6 and 7 show purification of“BCl-2xl” using CH1 affinity resin.
- FIG. 24 compares the avidity of the bivalent“BC1” construct to the avidity of the trivalent 2x1“BCl-2xl” construct using an Octet (Pall ForteBio) analysis. Biotinylated antigen“A” is immobilized on the surface, and the antibody constructs are passed over the surface for binding analysis.
- TBl l l has the following architecture (“Ada” indicates a V region from
- the A:F antigen binding site is specific for“Antigen A”, as is the H:L binding antigen binding site.
- the R:T antigen binding site is specific for PD.
- the specificity of this construct is thus Antigen“A” x (PD 1 -Antigen“A”). 6.13.11.
- Example 10 Trivalent 1x2 bispecific construct (“CTLA4-4 x Nivo x CTLA4-4”)
- FIG. 28 is a SDS-PAGE gel in which the lanes showing the“CTLA4-4 x Nivo x CTLA4-4” construct under non-reducing and reducing conditions have been boxed.
- FIG. 29 compares antigen binding of two antibodies:“CTLA4-4 x 0X40-8” and “CTLA4-4 x Nivo x CTLA4-4”.“CTLA4-4 x 0X40-8” binds to CTLA4 monovalently; while“CTLA4-4 x Nivo x CTLA4-4” bind to CTLA4 bivalently.
- Antigen binding site A:F was specific for“Antigen A”
- Antigen binding site H:L was specific for PD1 (nivolumab sequence)
- Antigen binding site R:T was specific for CTLA4.
- FIG. 31 shows size exclusion chromatography with“BC28-lxlxla” following transient expression and one-step purification using the CaptureSelectTM CH1 affinity resin, demonstrating a single well-defined peak.
- FIG. 32 shows a SDS-PAGE gel with various constructs, each after transient expression and one-step purification using the CaptureSelectTM CH1 affinity resin, under non-reducing and reducing conditions.
- Lanes 1 (nonreducing conditions) and 2 (reducing conditions, + DTT) are the bivalent lxl bispecific construct“BC1”.
- Lanes 3 (nonreducing) and 4 (reducing) are the trivalent bispecific 2x1 construct“BCl-2xl” (see Example 7).
- Lanes 5 (nonreducing) and 6 (reducing) are the trivalent 1x2 bispecific construct“CTLA4-4 x Nivo x CTLA4-4” (see Example 10).
- Lanes 7 (nonreducing) and 8 (reducing) are the trivalent 1x2 trispecific “BC28-lxlxla” construct described in Example 11.
- the SDS-PAGE gel demonstrates the complete assembly of each construct, with the predominant band in the non-reducing gel appearing at the expected molecular weight for each construct.
- FIG. 33 shows Octet binding analyses to 3 antigens: PD1, Antigen“A”, and CTLA- 4. In each instance, the antigen is immobilized and the B-Body is the analyte. For reference, lxl bispecifics“BC1” and“CTLA4-4 x 0X40-8” were also compared to demonstrate lxl B- Bodies bind specifically only to antigens for which the antigen binding sites were selected. [00349] FIG. 33 A shows binding of“BC1” to PD1 and to Antigen“A”, but not CTLA4.
- FIG. 33B shows binding of a bivalent bispecific lxl construct“CTLA4-4 x 0X40-8” to CTLA4, but not to Antigen“A” or PD1.
- FIG. 33C shows the binding of the trivalent trispecific 1x2 construct,“BC28-lxlxla” to PD1, Antigen“A”, and CTLA4.
- FIG. 35 shows the overall architecture of a 2x2 tetravalent bispecific construct “BC22 -2x2”.
- the 2x2 tetravalent bispecific was constructed with“BC1” scaffold by duplicating each variable domain-constant domain segment. Domain nomenclature is schematized in FIG. 34.
- FIG. 36 is a SDS-PAGE gel.
- Lanes 7-9 show the“BC22-2x2” tetravalent construct respectively following one-step purification using the CaptureSelectTM CH1 affinity resin (“CH1 eluate”), and after an additional ion exchange chromatography purification (lane 8, “pk 1 after IEX”; lane 9,“pk 2 after IEX”).
- Lanes 1-3 are the trivalent 2x1 construct“BC21- 2x1” after CH1 affinity purification (lane 1) and, in lanes 2 and 3, subsequent ion exchange chromatography.
- Lanes 4-6 are the 1x2 trivalent construct“BC 12-1x2”.
- FIG. 37 shows the overall architecture of a 2x2 tetravalent construct.
- FIGS. 39 and 40 schematize tetravalent constructs having alternative architectures. Domain nomenclature is presented in FIG. 38.
- Domain X CH1 (IgGl) 3 rd polypeptide chain (identical to first polypeptide chain)
- Expi-293 cells were either mock transfected or transiently transfected with Antigen “B” using the Expi-293 Transfection Kit (Life Technologies). Forty-eight hours after transfection, the Expi-293 cells were harvested and fixed in 4% paraformaldehyde for 15 minutes at room temperature. The cells were washed twice in PBS. 200,000 Antigen B or Mock transfected Expi-293 cells were placed in a V-bottom 96 well plate in 100 pL of PBS. The cells were incubated with the“B-Body-IgG 2x2” at a concentration of 3 ug/mL for 1.5 hours at room temperature.
- the cells were centrifuged at 300xG for 7 minutes, washed in PBS, and incubated with 100 pL of FITC labeled goat-anti human secondary antibody at a concentration of 8 pg/mL for 1 hour at room temperature.
- the cells were centrifuged at 300xG for 7 minutes, washed in PBS, and cell binding was confirmed by flow cytometry using a Guava easyCyte. Results are shown in FIG. 42.
- FIG. 45 shows a SDS-PAGE gel with various constructs, each after transient expression and one-step purification using the CaptureSelectTM CH1 affinity resin, under non-reducing and reducing conditions.
- Lanes 1 (nonreducing conditions) and 2 (reducing conditions, + DTT) are the bivalent lxl bispecific construct“BC1”.
- Lanes 3 (nonreducing) and 4 (reducing) are the bivalent lxl bispecific construct“BC28” (see Example 4).
- Lanes 5 (nonreducing) and 6 (reducing) are the bivalent lxl bispecific construct“BC44” (see Example 5).
- Lanes 7 (nonreducing) and 8 (reducing) are the trivalent 1x2 bispecific“BC28-lx2” construct (see Example 9).
- Lanes 9 (nonreducing) and 10 (reducing) are the trivalent 1x2 trispecific“BC28- lxlxla” construct described in Example 11.
- the SDS-PAGE gel demonstrates the complete assembly of each construct, with the predominant band in the non-reducing gel appearing at the expected molecular weight for each construct.
- a series of CD3 binding arm variants based on a humanized version of the SP34 anti-CD3 antibody (SP34-89, SEQ ID NOs:68 and 69) were engineered with point mutations in either the VH or VL amino acid sequences (SEQ ID Nos:70-73). The various VH and VL sequences were paired together as described in Table 5.
- FIG. 47 demonstrates binding affinity of the non-mutagenized SP34-89 monovalent B-Body as determined by Octet (Pall ForteBio) biolayer interferometry analysis.
- the kinetic affinity also matched the equilibrium binding affinity.
- a chemically synthetic Fab phage library with diversity introduced into the Fab CDRs was screened against CD3 antigens using a monoclonal phage ELISA format where plate-immobilized CD3 variants were assessed for binding to phage, as described above. Phage clones expressing Fabs that recognized CD3 antigens were sequenced. Table A lists CD3 antigen binding site candidates. CD3-8 interestingly was cross-reactive with human and cyno CD3 antigen.
- a series of engineered Fc variants were generated in the monoclonal IgGl antibody trastuzumab (Herceptin,“WT-IgGl”) with mutations at positions L234, L235, and P329 of the CH2 domain.
- the specific mutations for the variants tested are described in Table 6 below and include sFcl (PALALA), sFc7 (PGLALA), and sFclO (PKLALA). All variants were produced by Expi293 expression as described herein.
- the protein melting temperature was determined using the Protein Thermal Shift Dye Kit (Thermo Fisher). Briefly, proteins of interest were brought to a concentration of 1 mg/ml. Thermal shift dye mix (water, Thermal shift buffer, and Thermal Shift Dye) was added to the protein of interest. The protein/thermal dye mix was added to glass capillary tubes and analyzed using a thermal gradient on a Roche Light Cycler. Proteins were incubated at 37°C for 2 minutes before initiating a thermal gradient from 37°C to 99°C with a temperature increase rate of 0. l°C/sec. Fluorescence increase was measured over time and used to calculate the thermal melting temperature. Table 6 depicts results from the Protein Thermal Shift experiment above. All variants showed comparable stability as the wild-type IgG.
- FIG. 49 shows Octet (Pall ForteBio) biolayer interferometry analysis demonstrating FcyRIa binding to trastuzumab (FIG. 49A “WT IgGl”), but not sFclO (FIG. 49B).
- FcyRIa Upon addition of FcyRIa, an increase in signal was seen for trastuzumab, but no observable signal increase was detected for sFclO demonstrating FcyRIa no longer binds the antibody with the engineered mutations. Binding summaries for the variants tested presented in Table 6. In addition, all variants retained strong binding to HER2 (not shown).
- ADCC antibody dependent cellular cytotoxicity
- Bioreporter Assay Kit (Promega). A serial dilution of each variant was incubated with SKBR3 cells. The reactions were then incubated at 37 °C in a humidified C02 incubator with the ADCC Bioassay effector cells according to the manufacturer’s protocol and incubated for 6 to 24 hrs. After incubation, the Bio-GloTM Luciferase Assay Reagent was added to each sample and the luminescent signal was measured with a plate reader with glow-type luminescence read capabilities.
- trastuzumab Herceptin,“WT-IgGl”
- demonstrated killing while none of the Fc variants tested resulted in detectable levels of killing.
- WT-IgGl and the Fc variants were also tested for complement component Clq binding by ELISA. Briefly, up to 128 pg/ml IgG was immobilized for each of the variants. The ELISA was performed with 12 pg/ml Clq and 1/400 dilution of the Clq-HRP secondary antibody. Washes and samples were diluted in PBST-BSA (1%).
- trastuzumab (Herceptin,“WT-IgGl”) demonstrated Clq binding, while neither sFcl, sFc7, nor sFclO resulted in detectable Clq binding.
- the results demonstrate that the Fc variants tested have reduced levels of Fc effector function.
- Trivalent trispecific binding molecules are identified, de novo, that have two new antigen binding sites (ABSs) that share a common light chain variable sequence.
- the common light chain library used restricts the diversification of CDRs to the heavy chain variable domain (VH).
- Common light chain libraries are created for in vitro display (phage display, yeast display, mammalian display, etc) or in humanized animal models. Selections performed with common light chain libraries produce trivalent trispecific binding molecules with diversity in the VH domain for two ABSs but a single sequence in the light chain variable domain (VL) common to both ABSs.
- the common light chain library is created using sequences derived from a specific heavy chain variable domain (e.g ., VH3-23) and a specific light chain variable domain (e.g, Vk-l).
- Phage display libraries can be created through a number of strategies known in the art.
- Fab-formatted phage libraries are constructed using expression vectors capable of replication and expression in phage (also referred to as a phagemid). Both the heavy chain and the light chain are encoded for in the same expression vector, where the heavy chain is fused to a truncated variant of the phage coat protein pill.
- the light chain and heavy chain are expressed as a separate polypeptides, and the light chain and heavy chain-pill fusion assemble in the bacterial periplasm, where the redox potential enables disulfide bond formation, to form the antibody containing the candidate ABS.
- a single light chain variable domain is chosen where the common light chain CDR1 (Ll) and CDR2 (L2) remain the human germline sequence and the CDR3 (L3) is chosen from a consensus sequence that is able to support binding to a large variety of antigens.
- Libraries can also be constructed wherein all VL CDRs in the common light chain are varied to represent the full human diversity of light chain variable sequences. For a given common light chain, ah CDR positions of the VH domain are diversified to match the positional amino acid frequency by CDR length found in the human antibody repertoire. Diversity can be created through a number of strategies known in the art.
- Kunkel mutagenesis is performed with primers introducing diversity into VH CDRs Hl, H2 and H3 to mimic the diversity found in the natural antibody repertoire, as described in more detail in Kunkel, TA ( PNAS January 1, 1985. 82 (2) 488-492), herein incorporated by reference in its entirety. Briefly, single-stranded DNA is prepared from isolated phage using standard procedures and Kunkel mutagenesis carried out. Chemically synthesized DNA is then electroporated into TG1 cells, followed by recovery. Recovered cells are sub-cultured and infected with M13K07 helper phage to produce the phage library. 6.13.23.2. Common Light Chain Phage Screening
- Phage panning is performed using standard procedures. Briefly, the first round of phage panning is performed mixing target antigens immobilized on streptavidin magnetic beads with ⁇ 5xl0 12 phages from the prepared library described above in a volume of 1 mL in PBST-2% BSA. After a one-hour incubation, the bead-bound phage are separated from the supernatant using a magnetic stand. Beads are washed three times to remove non-specifically bound phage and then added to ER2738 cells (5 mL) at OD 6 oo ⁇ 0.6.
- infected cells are sub-cultured in 25 mL 2xYT + Ampicillin and M13K07 helper phage and allowed to grow overnight at 37 °C with vigorous shaking.
- phage are prepared using standard procedures by PEG precipitation. Pre-clearance of phage specific to SAV-coated beads is performed prior to panning.
- the second round of panning is performed using the KingFisher magnetic bead handler with 100 nM bead-immobilized antigen using standard procedures.
- 3-4 rounds of phage panning are performed to enrich in phage displaying Fabs specific for the target antigen. Target-specific enrichment is then confirmed using polyclonal and monoclonal phage ELISA.
- the trivalent trispecific antibody also has a third ABS, which does not share the common VL region, which is specific for a third distinct antigen.
- a phage display campaign using a common light chain library is used to separately identify candidate ABSs that bind Antigen 1 (Al) or Antigen 2 (A2).
- ABSs that share a common VL but with different VHs that impart specificity for Antigen 1 or Antigen 2 are identified, with affinities ranging from ImM to below lnM.
- ABSs are reformatted into full length human bivalent monospecific native IgGl architecture for characterization. Candidates are evaluated for binding affinity, epitope, and generally biophysical qualities (expression, purity, developability, etc.). ABSs having individual binding affinities ranging from IOhM-ImM, or preferably 50nM-250nM, which bind both Antigen 1 and Antigen 2 are identified.
- VL and VH domains from the parental IgG candidates for Antigen 1 and Antigen 2 are reformatted into the 1x2 antibody format below, along with the third ABS specific for Antigen 3 (A3).
- the combinations of candidates are expressed via transient mammalian expression, purified, and tested for the ability to simultaneously co-engage both antigens on the cell surface. Candidates have the following binding properties:
- Monovalent KD to Antigen 1 50 to 100 nM
- Chain 1 VH Ai -CH3-CH2-CH3 Hoie
- Chain 2 and Chain 6 VLAI/A2 -common- CH3
- VLA 3 -CL1 and VHA 3 -CH1 can be swapped, and all domains may possess any of the orthogonal mutations previously described
- the trivalent trispecific antibody also has a third ABS, which does not share the common VL region, which is specific for a T cell molecule useful for T cell redirection therapy, such as CD3 epsilon.
- This trivalent trispecific antibody can also be designed to utilize low monovalent affinities to the two tumor antigens yet achieve strong bivalent binding to tumor cells that present both antigens on the cell surface.
- a phage display campaign using a common light chain library is used to separately identify candidate ABSs that bind Tumor Antigen 1 (TA1) or Tumor Antigen 2 (TA2).
- ABSs that share a common VL but with different VHs that impart specificity for Tumor Antigen 1 or Tumor Antigen 2 are identified, with affinities ranging from ImM to below lnM.
- ABSs are reformatted into full length human bivalent monospecific native IgGl architecture for characterization. Candidates are evaluated for binding affinity, epitope, and generally biophysical qualities (expression, purity, developability, etc.). ABSs having individual binding affinities ranging from IOhM-ImM, or preferably 50nM-250nM, which bind both Antigen 1 and Antigen 2 are identified.
- VL and VH domains from the parental IgG candidates for Tumor Antigen 1 and Tumor Antigen 2 are reformatted into the 1x2 antibody format below, along with a third known ABS specific for CD3 (e.g, SP34, OKT3, etc., and humanized variants thereof).
- the combinations of candidates are expressed via transient mammalian expression, purified, and tested for the ability to simultaneously co-engage both antigens on the cell surface.
- T cell killing and proliferation assays are performed to characterize antibody efficacy.
- Candidates have the following binding properties:
- Monovalent KD to Antigen 1 50 to 100 nM
- Chain 1 VH TAi -CH3-CH2-CH3 Hoie
- Chain 2 and Chain 6 VLTAI/TA2 -common- CH3
- VLcD3-CLl and VHcD 3 -CHl can be swapped, and all domains may possess any of the orthogonal mutations previously described
- Trivalent trispecific binding molecules are identified, de novo , that have two new antigen binding sites (ABSs) that share a common heavy chain variable sequence.
- the common light chain library used restricts the diversification of CDRs to the light chain variable domain (VL).
- Common heavy chain libraries are created for in vitro display (phage display, yeast display, mammalian display, etc) or in humanized animal models. Selections performed with common heavy chain libraries produce trivalent trispecific binding molecules with diversity in the VL domain for two ABSs but a single sequence in the heavy chain variable domain (VH) common to both ABSs. 6.13.24.1. Common Heavy Chain Phage Library Construction
- the common heavy chain library is created using sequences derived from a specific heavy chain variable domain (e.g ., human VH3-23) and a specific light chain variable domain e.g ., human Vk-l).
- Phage display libraries can be created through a number of strategies known in the art.
- Fab-formatted phage libraries are constructed using expression vectors capable of replication and expression in phage (also referred to as a phagemid). Both the heavy chain and the light chain are encoded for in the same expression vector, where the heavy chain is fused to a truncated variant of the phage coat protein pill.
- the light chain and heavy chain are expressed as a separate polypeptides, and the light chain and heavy chain- pIII fusion assemble in the bacterial periplasm, where the redox potential enables disulfide bond formation, to form the antibody containing the candidate ABS.
- a single heavy chain variable domain is chosen where the common heavy chain CDR1 (Hl) and CDR2 (H2) remain the human germline sequence and the CDR3 (H3) is chosen from a consensus sequence that is able to support binding to a large variety of antigens.
- Libraries can also be constructed wherein all VH CDRs in the common heavy chain are varied to represent the full human diversity of heavy chain variable sequences. For a given common heavy chain, all CDR positions of the VL domain are diversified to match the positional amino acid frequency by CDR length found in the human antibody repertoire. Diversity can be created through a number of strategies known in the art.
- Kunkel mutagenesis is performed with primers introducing diversity into VL CDRs Ll, L2 and L3 to mimic the diversity found in the natural antibody repertoire, as described in more detail in Kunkel, TA (PNAS January 1, 1985. 82 (2) 488- 492), herein incorporated by reference in its entirety. Briefly, single-stranded DNA is prepared from isolated phage using standard procedures and Kunkel mutagenesis carried out. Chemically synthesized DNA is then electroporated into TG1 cells, followed by recovery. Recovered cells are sub-cultured and infected with M13K07 helper phage to produce the phage library.
- Phage panning is performed using standard procedures. Briefly, the first round of phage panning is performed mixing target antigens immobilized on streptavidin magnetic beads with ⁇ 5xl0 12 phages from the prepared library described above in a volume of 1 mL in PBST-2% BSA. After a one-hour incubation, the bead-bound phage are separated from the supernatant using a magnetic stand. Beads are washed three times to remove non-specifically bound phage and then added to ER2738 cells (5 mL) at OD 6 oo ⁇ 0.6.
- infected cells are sub-cultured in 25 mL 2xYT + Ampicillin and M13K07 helper phage and allowed to grow overnight at 37 °C with vigorous shaking.
- phage are prepared using standard procedures by PEG precipitation. Pre-clearance of phage specific to SAV-coated beads is performed prior to panning.
- the second round of panning is performed using the KingFisher magnetic bead handler with 100 nM bead-immobilized antigen using standard procedures.
- 3-4 rounds of phage panning are performed to enrich in phage displaying Fabs specific for the target antigen. Target-specific enrichment is then confirmed using polyclonal and monoclonal phage ELISA.
- the trivalent trispecific antibody also has a third ABS, which does not share the common VH region, which is specific for a third distinct antigen.
- a phage display campaign using a common heavy chain library is used to separately identify candidate ABSs that bind Antigen 1 (Al) or Antigen 2 (A2).
- ABSs that share a common VH but with different VLs that impart specificity for Antigen 1 or Antigen 2 are identified, with affinities ranging from ImM to below lnM.
- ABSs are reformatted into full length human bivalent monospecific native IgGl architecture for characterization. Candidates are evaluated for binding affinity, epitope, and generally biophysical qualities (expression, purity, developability, etc.). ABSs having individual binding affinities ranging from IOhM-ImM, or preferably 50nM-250nM, which bind both Antigen 1 and Antigen 2 are identified.
- VL and VH domains from the parental IgG candidates for Antigen 1 and Antigen 2 are reformatted into the 1x2 B-Body format below, along with the third ABS specific for Antigen 3 (A3).
- Exemplary 1x2 B-body scaffold chains are described by SEQ ID NOs: 78,
- Candidates have the following binding properties: Monovalent KD to Antigen 1 : 50 to 100 nM
- Chain 1 VL Ai -CH3-CH2-CH3 Hoie
- Chain 2 and Chain 6 VHAI/A2 -common- CH3
- Chain 3 VLA 2 -CH3 -VLA3-CL 1 -CH2-CH3 Knob
- VLA3-CL1 and VHA 3 -CH1 can be swapped, and all domains may possess any of the orthogonal mutations previously described
- the trivalent trispecific antibody also has a third ABS, which does not share the common VH region, which is specific for a T cell molecule useful for T cell redirection therapy, such as CD3 epsilon.
- This trivalent trispecific antibody can also be designed to utilize low monovalent affinities to the two tumor antigens yet achieve strong bivalent binding to tumor cells that present both antigens on the cell surface.
- a phage display campaign using a common heavy chain library is used to separately identify candidate ABSs that bind Tumor Antigen 1 (TA1) or Tumor Antigen 2 (TA2).
- ABSs that share a common VH but with different VLs that impart specificity for Tumor Antigen 1 or Tumor Antigen 2 are identified, with affinities ranging from ImM to below lnM.
- ABSs are reformatted into full length human bivalent monospecific native IgGl architecture for characterization. Candidates are evaluated for binding affinity, epitope, and generally biophysical qualities (expression, purity, developability, etc.).
- ABSs having individual binding affinities ranging from IOhM-ImM, or preferably 50nM-250nM, which bind both Antigen 1 and Antigen 2 are identified.
- VL and VH domains from the parental IgG candidates for Tumor Antigen 1 and Tumor Antigen 2 are reformatted into the 1x2 B-Body format below, along with the third ABS specific for CD3 ( e.g ., SP34, OKT3, etc., and humanized variants thereof).
- Exemplary 1x2 B-body scaffold chains are described by SEQ ID NOs: 78, 79, 81, and 82. The combinations of candidates are expressed via transient mammalian expression, purified, and tested for the ability to simultaneously co-engage both antigens on the cell surface.
- T cell killing and proliferation assays are performed to characterize antibody efficacy.
- Candidates have the following binding properties:
- Monovalent KD to Antigen 1 50 to 100 nM
- Chain 1 VL TAi -CH3-CH2-CH3 Hoie
- Chain 2 and Chain 6 VHTAI/TA2 -common- CH3
- VLcD3-CLl and VHcD 3 -CHl can be swapped, and all domains may possess any of the orthogonal mutations previously described
- Trivalent trispecific binding molecules are identified, starting from a parent ABS sequence with known specificity, that have two new antigen binding sites (ABSs) that share either a common light chain variable sequence or a common heavy chain variable sequence.
- ABSs new antigen binding sites
- a common light chain library restricts the diversification of CDRs to the heavy chain variable domain (VH), while common heavy chain library restricts the diversification of CDRs to the heavy chain variable domain (VL).
- Common light or heavy chain libraries are created for in vitro display (phage display, yeast display, mammalian display, etc) or in humanized animal models.
- VH or VL sequences including germline sequences, that are agnostic regarding binding specificity
- the screen performed here starts from an ABS with a known specificity that can include CDR sequences other than germline sequences.
- the parent VH or VL sequence is paired, respectively, with either VL or VH sequences having diversity introduced into their CDRs, as previously described.
- Non-cognate VH/VL pairs i.e., VH and VL pairs not from the parent ABS
- One of the antigens can be the same antigen bound by the parent ABS. Additional reformatting of the VH and VL sequences to further characterize the candidate ABSs is performed, as previously described.
- the screening and characterization results in trivalent trispecific binding molecules with two new ABSs, each specific for a different antigen or epitope, that share a common VL region or VH region sequence.
- the trivalent trispecific antibody also has a third ABS, which does not share the common VL or VH region, that is specific for a third distinct antigen.
- New antigen binding sites specific for the antigen human 0X40 were determined starting from parent ABS sequences with known specificity for human 0X40.
- VH domain isolated from a phage panning campaign against human 0X40 was used as a common heavy chain variable domain sequence and paired with the VL domains of 39 other ABS candidates, as well as its parent cognate VL domain, isolated from an 0X40 campaign.
- the diversity of the VL domains was limited to the CDR3 sequence, keeping CDR1 and CDR2 constant.
- the VL CDR3 sequences of the candidates are presented in Table 7.
- the VH of 0X40-13 was initially chosen for its relative lack of bulky residues in positions L92-L94 (CDRH1 : GFTFSSYIIHW; CDRH2:
- ABS candidates were expressed in small-scale as monoclonal antibodies in Expi293 cells in a volume of 2 mL. After 5 days of expression, cleared supernatants were diluted 3 -fold in PBST-BSA and tested for retained binding to biotinylated human 0X40 via biolayer interferometry (Octet). Here, streptavidin sensors were immobilized with biotinylated 0X40 until a binding response of ⁇ 0.8 nm was reached. After establishing the baseline, the diluted supernatants were assessed for antigen binding.
- FIG. 56 shows the Octet binding analysis for the VL domains paired with the 0X40- 13 VH domain, with non-cognate VL domains 1-12 and 21-24 shown in FIG. 56 A, non cognate VL domains 25-40 shown in FIG. 56B, and non-cognate VL domains 14-20 and cognate VL domain VL13 shown in FIG. 56C.
- Several of the non-cognate VL domains demonstrated binding comparable to parent 0X40-13 ABS, including the VL of 0X40-1 and 0X40-27. Others did not demonstrate detectable binding comparable to parent 0X40-13 ABS. While still others demonstrated a range of intermediate binding between the parent 0X40-13 ABS and the limit of detectable binding.
- several of the sequences, such as 0X40-1 and 0X40-27 diverge noticeably from the parent 0X40-13 VL sequence suggesting many VL sequences may retain antigen recognition of the parent VH.
- Trivalent trispecific binding molecules are identified, starting from a parent ABS sequence with known specificity, which have a new antigen binding site (ABS) that shares either a common light chain variable sequence or a common heavy chain variable sequence with the parent ABS.
- ABS antigen binding site
- a common light chain library restricts the diversification of CDRs to the heavy chain variable domain (VH), while common heavy chain library restricts the diversification of CDRs to the heavy chain variable domain (VL).
- Common light or heavy chain libraries are created for in vitro display (phage display, yeast display, mammalian display, etc) or in humanized animal models.
- VH or VL sequences start de novo from VH or VL sequences, including germline sequences, which are agnostic regarding binding specificity.
- the screen performed here starts from a parent ABS with a known specificity to discover new ABSs having a different antigen specificity while sharing a common VH or VL sequence with the parent ABS.
- the parent VH or VL sequence is paired, respectively, with either VL or VH sequences having diversity introduced into their CDRs, as previously described.
- the pairs are screened for binding to an antigen of interest, as previously described. Additional reformatting of the VH and VL sequences to further characterize the candidate ABSs is performed, as previously described.
- the screening and characterization results in trivalent trispecific binding molecules with a known parent ABS specific for a known antigen and a new ABS specific for a different antigen, where the ABSs share a common VL region or VH region sequence.
- the trivalent trispecific antibody also has a third ABS, which does not share the common VL or VH region, that is specific for a third distinct antigen.
- a phage display campaign using a common light chain library is created using the light chain VL sequence of Trastuzumab specific for HER2.
- Human VH3-23 CDR sequences are diversified to match the positional amino acid frequency by CDR length found the in the human antibody repertoire and phage expressing paired VL/VH sequences are screened for binding to an antigen of interest (A2), as described previously.
- ABSs are reformatted into full length human bivalent monospecific native IgGl architecture for characterization.
- Candidates are evaluated for binding affinity, epitope, and generally biophysical qualities (expression, purity, developability, etc.). ABSs having individual binding affinities ranging from 10hM-1mM, or preferably 50nM-250nM, which bind both Antigen 1 and Antigen 2 are identified.
- VL and VH domains from the parental IgG candidates for the antigen of interest are reformatted into the 1x2 antibody format below, along with the third ABS specific for CD3 (e.g., SP34, OKT3, etc., and humanized variants thereof).
- the combinations of candidates are expressed via transient mammalian expression, purified, and tested for the ability to simultaneously co-engage both antigens on the cell surface. Additional functional assays, such as T cell killing and proliferation assays, are performed to characterize antibody efficacy. Candidates have the following binding properties:
- Chain 1 VHtrastuzumab-CH3-CH2-CH3Hoie
- Chain 2 and Chain 6 VLtrastuzumab-CH3
- VLcD 3 -CLl and VHcD 3 -CHl can be swapped, and all domains may possess any of the orthogonal mutations previously described
- VFDKTHTCPPCP W A J ⁇ GGPSVFl .FPPKPKDTT ⁇ MISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK E Y KC K VS N KA L PA P I EKT I S KA KGOPRFPO IX Jl.P SRFFMTKNO VSLSC A VK GFYPSDIA VEWESNGOPENNYKTTPP VLDSDGSFFL VSKL TVDKSR WOOGNVFSC
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112020021279-2A BR112020021279A2 (pt) | 2018-04-17 | 2019-04-17 | Constructos de anticorpos trispecíficos trivalentes |
| CN201980040529.7A CN112384243A (zh) | 2018-04-17 | 2019-04-17 | 三价三特异性抗体构建体 |
| EP19789409.0A EP3781205A4 (en) | 2019-04-17 | Trivalent trispecific antibody constructs | |
| CA3097605A CA3097605A1 (en) | 2018-04-17 | 2019-04-17 | Trivalent trispecific antibody constructs |
| KR1020207032932A KR20200143730A (ko) | 2018-04-17 | 2019-04-17 | 3가 삼중 특이성 항체 구조물 |
| MX2020011027A MX2020011027A (es) | 2018-04-17 | 2019-04-17 | Constructos de anticuerpos biespecíficos trivalentes. |
| US17/048,482 US20210179734A1 (en) | 2018-04-17 | 2019-04-17 | Trivalent trispecific antibody constructs |
| JP2020557151A JP2021521781A (ja) | 2018-04-17 | 2019-04-17 | 三価三重特異性抗体構築物 |
| AU2019255270A AU2019255270A1 (en) | 2018-04-17 | 2019-04-17 | Trivalent trispecific antibody constructs |
| IL278073A IL278073A (en) | 2018-04-17 | 2020-10-15 | Structures of trispecific trivalent antibodies |
| US18/335,995 US20250026861A1 (en) | 2018-04-17 | 2023-06-15 | Trivalent trispecific antibody constructs |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862659047P | 2018-04-17 | 2018-04-17 | |
| US62/659,047 | 2018-04-17 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/048,482 A-371-Of-International US20210179734A1 (en) | 2018-04-17 | 2019-04-17 | Trivalent trispecific antibody constructs |
| US18/335,995 Continuation US20250026861A1 (en) | 2018-04-17 | 2023-06-15 | Trivalent trispecific antibody constructs |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019204398A1 true WO2019204398A1 (en) | 2019-10-24 |
Family
ID=68240367
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/027816 Ceased WO2019204398A1 (en) | 2018-04-17 | 2019-04-17 | Trivalent trispecific antibody constructs |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20210179734A1 (https=) |
| JP (1) | JP2021521781A (https=) |
| KR (1) | KR20200143730A (https=) |
| CN (1) | CN112384243A (https=) |
| AU (1) | AU2019255270A1 (https=) |
| BR (1) | BR112020021279A2 (https=) |
| CA (1) | CA3097605A1 (https=) |
| IL (1) | IL278073A (https=) |
| MX (1) | MX2020011027A (https=) |
| WO (1) | WO2019204398A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114349866A (zh) * | 2020-04-29 | 2022-04-15 | 丹生医药技术(上海)有限公司 | 一种PD-1/TGF-beta四价双特异性抗体、其制备方法和用途 |
| JP2024507693A (ja) * | 2021-02-07 | 2024-02-21 | チア タイ ティエンチン ファーマシューティカル グループ カンパニー リミテッド | 二重特異性抗体 |
| EP4178615A4 (en) * | 2020-07-10 | 2024-07-24 | Biomolecular Holdings LLC | TETRAHEDRAL ANTIBODIES |
| WO2025059037A1 (en) * | 2023-09-11 | 2025-03-20 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting b7-h4 and cd3 and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX2018005232A (es) * | 2015-11-03 | 2018-08-15 | Ambrx Inc | Anticuerpos anti-cd3 novedosos y sus usos. |
| CN110177805B (zh) * | 2016-10-19 | 2024-04-02 | 英温拉公司 | 抗体构建体 |
| JP2024527977A (ja) | 2021-07-27 | 2024-07-26 | ノヴァブ, インコーポレイテッド | 免疫エフェクター機能を有する操作されたvlrb抗体 |
| TW202506725A (zh) * | 2023-04-07 | 2025-02-16 | 美商麥迪紐有限責任公司 | 三特異性工程化抗體 |
| EP4702058A2 (en) * | 2023-04-28 | 2026-03-04 | Xencor, Inc. | Orthogonal multimeric proteins |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090162380A1 (en) * | 2005-01-05 | 2009-06-25 | Scott Glaser | Multispecific binding molecules comprising connecting peptides |
| WO2017064221A1 (en) * | 2015-10-13 | 2017-04-20 | Affimed Gmbh | Multivalent fv antibodies |
| WO2017180813A1 (en) * | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
| US20170320967A1 (en) * | 2016-04-13 | 2017-11-09 | Sanofi | Trispecific and/or trivalent binding proteins |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014116846A2 (en) * | 2013-01-23 | 2014-07-31 | Abbvie, Inc. | Methods and compositions for modulating an immune response |
| LT2961771T (lt) * | 2013-02-26 | 2020-03-10 | Roche Glycart Ag | Bispecifinės t ląstelę aktyvinančios antigeną surišančios molekulės, specifinės cd3 ir cea antigenams |
| SG11201608054YA (en) * | 2014-04-02 | 2016-10-28 | Hoffmann La Roche | Method for detecting multispecific antibody light chain mispairing |
| EA035419B9 (ru) * | 2014-05-29 | 2020-08-07 | Мэкроудженикс, Инк. | Триспецифичные связывающие молекулы и способы их применения |
| DK3221357T3 (da) * | 2014-11-20 | 2020-08-10 | Hoffmann La Roche | Fælles letkæder og fremgangsmåder til anvendelse |
| EP4141032B1 (en) * | 2014-11-20 | 2024-05-29 | F. Hoffmann-La Roche AG | Combination therapy of t cell activating bispecific antigen binding molecules and pd-1 axis binding antagonists |
| WO2016087650A1 (en) * | 2014-12-05 | 2016-06-09 | Merck Patent Gmbh | Domain-exchanged antibody |
| CN107531788B (zh) * | 2015-06-24 | 2022-06-21 | 豪夫迈·罗氏有限公司 | 对her2和血脑屏障受体特异性的三特异性抗体及使用方法 |
| JP2018536389A (ja) * | 2015-10-02 | 2018-12-13 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | メソテリンとcd3に結合する二重特異性細胞活性化抗原結合分子 |
-
2019
- 2019-04-17 CN CN201980040529.7A patent/CN112384243A/zh active Pending
- 2019-04-17 KR KR1020207032932A patent/KR20200143730A/ko not_active Ceased
- 2019-04-17 CA CA3097605A patent/CA3097605A1/en active Pending
- 2019-04-17 BR BR112020021279-2A patent/BR112020021279A2/pt unknown
- 2019-04-17 JP JP2020557151A patent/JP2021521781A/ja active Pending
- 2019-04-17 AU AU2019255270A patent/AU2019255270A1/en not_active Abandoned
- 2019-04-17 WO PCT/US2019/027816 patent/WO2019204398A1/en not_active Ceased
- 2019-04-17 US US17/048,482 patent/US20210179734A1/en not_active Abandoned
- 2019-04-17 MX MX2020011027A patent/MX2020011027A/es unknown
-
2020
- 2020-10-15 IL IL278073A patent/IL278073A/en unknown
-
2023
- 2023-06-15 US US18/335,995 patent/US20250026861A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090162380A1 (en) * | 2005-01-05 | 2009-06-25 | Scott Glaser | Multispecific binding molecules comprising connecting peptides |
| WO2017064221A1 (en) * | 2015-10-13 | 2017-04-20 | Affimed Gmbh | Multivalent fv antibodies |
| US20170320967A1 (en) * | 2016-04-13 | 2017-11-09 | Sanofi | Trispecific and/or trivalent binding proteins |
| WO2017180813A1 (en) * | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114349866A (zh) * | 2020-04-29 | 2022-04-15 | 丹生医药技术(上海)有限公司 | 一种PD-1/TGF-beta四价双特异性抗体、其制备方法和用途 |
| EP4050028A1 (en) * | 2020-04-29 | 2022-08-31 | Dansheng Pharmaceutical Technology (Shanghai) Co., Ltd. | Tetravalent bispecific antibody against pd-1/tgf-beta, preparation method therefor, and use thereof |
| CN114349866B (zh) * | 2020-04-29 | 2023-06-02 | 三生国健药业(上海)股份有限公司 | 一种PD-1/TGF-beta四价双特异性抗体、其制备方法和用途 |
| EP4178615A4 (en) * | 2020-07-10 | 2024-07-24 | Biomolecular Holdings LLC | TETRAHEDRAL ANTIBODIES |
| JP2024507693A (ja) * | 2021-02-07 | 2024-02-21 | チア タイ ティエンチン ファーマシューティカル グループ カンパニー リミテッド | 二重特異性抗体 |
| WO2025059037A1 (en) * | 2023-09-11 | 2025-03-20 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting b7-h4 and cd3 and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| IL278073A (en) | 2020-11-30 |
| US20210179734A1 (en) | 2021-06-17 |
| CN112384243A (zh) | 2021-02-19 |
| MX2020011027A (es) | 2021-01-15 |
| US20250026861A1 (en) | 2025-01-23 |
| BR112020021279A2 (pt) | 2021-04-13 |
| EP3781205A1 (en) | 2021-02-24 |
| JP2021521781A (ja) | 2021-08-30 |
| CA3097605A1 (en) | 2019-10-24 |
| AU2019255270A1 (en) | 2020-11-19 |
| KR20200143730A (ko) | 2020-12-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7591015B2 (ja) | 抗体構築物 | |
| US20250026861A1 (en) | Trivalent trispecific antibody constructs | |
| AU2019256431B2 (en) | Anti-ror antibody constructs | |
| US20210163594A1 (en) | Binding molecules | |
| US20220213225A1 (en) | Multispecific treg binding molecules | |
| US20210363265A1 (en) | Multivalent receptor-clustering agonist antibody constructs | |
| US20220153844A1 (en) | Multispecific treg binding molecules | |
| CN114340737B (zh) | 激活性抗gal9结合分子 | |
| WO2019183406A1 (en) | Multispecific antibody purification with ch1 resin | |
| AU2026202585A1 (en) | Anti-ror antibody constructs |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19789409 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3097605 Country of ref document: CA Ref document number: 2020557151 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020021279 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20207032932 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019255270 Country of ref document: AU Date of ref document: 20190417 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019789409 Country of ref document: EP Effective date: 20201117 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112020021279 Country of ref document: BR Free format text: APRESENTE O COMPLEMENTO DO TEXTO EM PORTUGUES, ADAPTADO A NORMA VIGENTE, DO PEDIDO CONFORME DEPOSITO INTERNACIONAL INICIAL (RELATORIO DESCRITIVO E DESENHO, SE HOUVER), CONFORME DETERMINA A RESOLUCAO INPI PR NO 77/2013 DE 18/03/2013, ART. 5O E 7O |
|
| ENP | Entry into the national phase |
Ref document number: 112020021279 Country of ref document: BR Kind code of ref document: A2 Effective date: 20201016 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 278073 Country of ref document: IL |