WO2019203600A1 - 스위치 분자 및 스위처블 키메라 항원 수용체 - Google Patents

스위치 분자 및 스위처블 키메라 항원 수용체 Download PDF

Info

Publication number
WO2019203600A1
WO2019203600A1 PCT/KR2019/004720 KR2019004720W WO2019203600A1 WO 2019203600 A1 WO2019203600 A1 WO 2019203600A1 KR 2019004720 W KR2019004720 W KR 2019004720W WO 2019203600 A1 WO2019203600 A1 WO 2019203600A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
chimeric antigen
switch molecule
antigen receptor
antibody
Prior art date
Application number
PCT/KR2019/004720
Other languages
English (en)
French (fr)
Inventor
이종서
울렌칼에릭마티아스
Original Assignee
앱클론(주)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 앱클론(주) filed Critical 앱클론(주)
Priority to US17/048,739 priority Critical patent/US11945878B2/en
Priority to CN201980026597.8A priority patent/CN111989342A/zh
Priority to EP19787870.5A priority patent/EP3783026A4/en
Priority to JP2020557989A priority patent/JP2021517907A/ja
Publication of WO2019203600A1 publication Critical patent/WO2019203600A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464403—Receptors for growth factors
    • A61K39/464406—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411—Immunoglobulin superfamily
    • A61K39/464412—CD19 or B4
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46—Hybrid immunoglobulins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23—On/off switch
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2318/00—Antibody mimetics or scaffolds
    • C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Definitions

  • the present invention relates to a switch molecule for activating a chimeric antigen receptor effector cell, a polypeptide or a fusion protein binding thereto, and a chimeric antigen receptor.
  • CAR-T chimeric antigen receptor T cells
  • scFv single chain antibody variable domain
  • CAR-T cells have limitations in their inability to control activation and expansion in vivo.
  • CAR-T cells to rapidly proliferate to 10 4 drainage when meeting with the patient's antigen-positive cells caused by tumor lysis syndrome (tumor lysis syndrome, TLS) and lethal cytokine release syndrome (cytokine release syndrome, CRS) causes serious symptoms.
  • Additional complications can be caused by persistent on-target activity of the CAR-T cells' antigens.
  • engineered T cells indiscriminately kill normal B cells as well as malignant B cells, resulting in long-term B cell aplasia.
  • fixed antigen specificity of existing CAR-T cells excludes targeting to antigen-loss escapte mutants that have been found to be the source of relapse by up to 10% of all patients receiving CART-19 treatment. do.
  • the present inventors have made diligent research efforts to develop novel switch molecules capable of modulating the activity of CAR-T cells and mediating the interaction between CAR-T cells and target cells.
  • the present invention was completed by identifying that affibody pairs (Zb pairs) that specifically bind to each other can be used as a switch molecule and a CAR receptor.
  • Another object of the invention is (a) a switch molecule for activating a chimeric antigen receptor-effector cell and (b) a polypeptide or fusion protein that specifically binds to the switch molecule.
  • Still another object of the present invention is to provide a chimeric antigen receptor (CAR) comprising the switch molecule or fusion protein.
  • CAR chimeric antigen receptor
  • the present invention provides the following inventions 1 to 47.
  • the switch molecule of 2 wherein the antibody is an antibody selected from the group consisting of monoclonal antibodies, polyclonal antibodies, synthetic antibodies, human antibodies, humanized antibodies, single domain antibodies, and single chain variable fragments.
  • the switch of 1 to 4, wherein the effector cell is selected from the group consisting of dendritic cells, killer dendritic cells, mast cells, natural killer cells, B lymphocytes, T lymphocytes, macrophages and their progenitor cells. molecule.
  • the targeting moiety is an antibody or antigen-binding fragment which specifically binds to the HER2 antigen and comprises the 1st to 243th amino acid sequences of SEQ ID NO: 12. molecule.
  • the targeting moiety is an antibody or antigen-binding fragment which binds specifically to the CD19 antigen and comprises amino acids 1 to 252 of SEQ ID NO: 18. molecule.
  • switch molecule of 1 wherein the switch molecule comprises the amino acid sequence of SEQ ID NO: 10 sequence.
  • switch molecule of 1 wherein the switch molecule is a switch molecule, characterized in that the 74-131 amino acid sequence of the amino acid sequence of SEQ ID NO: 10 is replaced with the 1 to 58 amino acid sequence of SEQ ID NO: 4.
  • switch molecule of 1 wherein the switch molecule comprises the amino acid sequence of SEQ ID NO: 12.
  • switch molecule of 1 wherein the switch molecule is a 259-316 amino acid sequence of the amino acid sequence of SEQ ID NO: 12 sequence is replaced with a 1 to 58 amino acid sequence of SEQ ID No. 4 sequence.
  • switch molecule of 1 wherein the switch molecule comprises an amino acid sequence of SEQ ID NO: 14 and an amino acid sequence of SEQ ID NO: 16.
  • switch molecule of 1 wherein the switch molecule is characterized in that the 466-523th amino acid sequence of the amino acid sequence of SEQ ID NO: 14 is replaced with the 1 to 58th sequence of SEQ ID NO: 4.
  • switch molecule of 1, wherein the switch molecule comprises an amino acid sequence of SEQ ID NO: 18, 20, 22, or 24.
  • composition comprising the switch molecule of any one of 1-20.
  • a pharmaceutical composition for immunotherapy comprising the switch molecule of any one of 1 to 20 and a pharmaceutically acceptable carrier.
  • a switch molecule for activating a chimeric antigen receptor-effector cell comprising:
  • cc a chimeric antigen receptor (CAR), comprising an intracellular signaling domain.
  • transmembrane domain is a T-cell receptor, CD27, CD28, CD3, epsilon, CD45, CD4, CD5, CD8 (CD8 ⁇ ), CD9, CD16, CD22, CD33, CD37, A chimeric antigen receptor, characterized in that the transmembrane domain of a protein selected from the group consisting of CD64, CD80, CD86, CD134, CD137 and CD154.
  • An effector cell expressing a chimeric antigen receptor, wherein the chimeric antigen receptor targets (b) a chimeric antigen receptor binding polypeptide of any of the switch molecules of 1-20.
  • the effector cell of 33 wherein the effector cell is selected from the group consisting of dendritic cells, killer dendritic cells, mast cells, natural killer cells, B lymphocytes, T lymphocytes, macrophages and their progenitor cells.
  • T lymphocytes are selected from the group consisting of inflammatory T lymphocytes, cytotoxic T lymphocytes, regulatory T lymphocytes or helper T lymphocytes.
  • a method comprising administering to a subject in need thereof an effector cell expressing any one of 29 to 32 and a switch molecule of any one of 1 to 20 that binds to said chimeric antigen receptor.
  • a nucleic acid molecule comprising a nucleotide sequence encoding the switch molecule of any one of 1-20.
  • a nucleic acid molecule comprising a nucleotide sequence encoding the complex of any one of 23 to 27.
  • a nucleic acid molecule comprising a nucleotide sequence encoding the chimeric antigen receptor of any one of 28 to 32.
  • a recombinant vector comprising a nucleic acid molecule of any one of 42 to 44.
  • the invention provides a switch molecule for activating a chimeric antigen receptor-effector cell comprising:
  • the (a) targeting moiety is a target binding polypeptide such as an antibody, an antigen binding fragment of the antibody or an affibody.
  • the (a) targeting moiety is a target binding polypeptide that specifically binds to the HER2 antigen and comprises the 1 to 58th amino acid sequence of SEQ ID NO: 10.
  • the 1 to 58 th amino acid sequence of the SEQ ID NO: 10 sequence may be encoded into the 1 to 174 nucleotide sequence of the SEQ ID NO: 9 sequence, but is not limited thereto.
  • the (a) targeting moiety is an antibody or antigen-binding fragment which specifically binds to the HER2 antigen and comprises the 1st to 243th amino acid sequences of SEQ ID NO: 12.
  • the 1st to 243th amino acid sequences of the 12th sequence may be encoded as 1 to 729th nucleotide sequences of the 11th sequence, but are not limited thereto.
  • the (a) targeting moiety specifically binds to the HER2 antigen and comprises the 1 to 119th amino acid sequence of SEQ ID NO: 14 as a heavy chain variable region, An antibody or antigen-binding fragment comprising the 1-107th amino acid sequence of the 16 sequence as a light chain variable region.
  • the 1 th to 119 th amino acid sequences of SEQ ID NO: 14 may be encoded into the 1 th to 357 th nucleotide sequences of SEQ ID NO: 13, and the 1 th to 107 th amino acid sequences of SEQ ID NO: 16 are set forth in SEQ ID NO: It may be encoded into the 1 to 321 nucleotide sequence of the 15 sequence, but is not limited thereto.
  • the polypeptide (b) that binds to the chimeric antigen receptor of the present invention is a target binding polypeptide such as an antibody, an antigen-binding fragment, or an affibody. to be.
  • the polypeptide that binds to the chimeric antigen receptor on the effector cell is a target binding polypeptide comprising the 1 to 58 th amino acid sequence of SEQ ID NO: 2 sequence.
  • the amino acid sequence of 1 to 58 of the second sequence may be encoded as the nucleotide sequence of the 1st to 174 of the first sequence, but is not limited thereto.
  • the polypeptide that binds to the chimeric antigen receptor on the effector cell is a target binding polypeptide comprising the 1 to 58 th amino acid sequence of SEQ ID NO: 4 sequence.
  • the 1 to 58 th amino acid sequence of the SEQ ID NO: 4 sequence may be encoded into the 1 to 174 nucleotide sequence of the third sequence, but is not limited thereto.
  • the switch molecule is a switch molecule comprising the amino acid sequence of SEQ ID NO: 10 sequence, the 74-131 amino acid sequence of the amino acid sequence of SEQ ID NO: 10 sequence is SEQ ID NO: 4 to SEQ ID NO: 1 to 58 may be substituted.
  • the amino acid sequence of SEQ ID NO: 10 may be encoded into the nucleotide sequence of SEQ ID NO: 9, but is not limited thereto.
  • the switch molecule is a switch molecule comprising the amino acid sequence of SEQ ID NO: 12 sequence, the 259-316 amino acid sequence of the amino acid sequence of SEQ ID NO: 12 is SEQ ID NO: 4 to SEQ ID NO: 1 to 58 may be substituted.
  • the amino acid sequence of SEQ ID NO: 12 may be encoded into the nucleotide sequence of SEQ ID NO: 11, but is not limited thereto.
  • the switch molecule is a switch molecule comprising an amino acid sequence of SEQ ID NO: 14 and the amino acid sequence of the 16th sequence, of the amino acid sequence of SEQ ID NO: 14
  • the 466-523th amino acid sequence may be substituted with the 1-58th sequence of the fourth sequence.
  • the amino acid sequences of SEQ ID NO: 14 and 16 may be encoded into the nucleotide sequences of SEQ ID NO: 13 and 15, but is not limited thereto.
  • antibody refers to an antibody that specifically binds to a specific antigen, and includes not only complete antibody forms but also antigen binding fragments of the antibody molecule.
  • a complete antibody is a structure having two full length light chains and two full length heavy chains, each of which is linked by heavy and disulfide bonds.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) and epsilon ( ⁇ ) types and subclasses gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), and gamma 3 ( ⁇ 3). ), Gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) and alpha 2 ( ⁇ 2).
  • the constant regions of the light chains have kappa ( ⁇ ) and lambda ( ⁇ ) types (Cellular and Molecular Immunology, Wonsiewicz, MJ, Ed., Chapter 45, pp. 41-50, WB Saunders Co. Philadelphia, PA (1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4, pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
  • the antibody includes an antibody selected from the group consisting of monoclonal antibodies, polyclonal antibodies, synthetic antibodies, human antibodies, humanized antibodies, single domain antibodies, and single chain variable fragments.
  • the term "antigen binding fragment” refers to a fragment having antigen binding function and includes Fab, F (ab '), F (ab') 2, Fv and the like.
  • Fab fragment antigen binding
  • Fab fragment antigen binding
  • CH1 first constant region
  • Fab 'differs from Fab in that it has a hinge region comprising at least one cysteine residue at the C-terminus of the heavy chain CH1 domain.
  • F (ab ') 2 antibodies are produced when the cysteine residues of the hinge region of Fab' form disulfide bonds.
  • Fv is the smallest fragment of antibody having only the heavy and light chain variable regions, and recombinant techniques for generating Fv fragments are described in PCT International Patent Applications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086. And WO 88/09344.
  • Double-chain Fv is non-covalently linked to the heavy chain variable region and the light chain variable region.
  • the single-chin variable fragment (scFv) is generally a variable region of the heavy chain and a short chain variable through a peptide linker. The regions may be covalently linked or directly linked at the C-terminus to form a dimer-like structure such as a double stranded Fv.
  • Such antibody fragments can be obtained using proteolytic enzymes (for example, restriction digestion of the entire antibody with papain can yield Fab, cleavage with pepsin can yield F (ab ') 2 fragments), or It can be produced through genetic recombination technology.
  • proteolytic enzymes for example, restriction digestion of the entire antibody with papain can yield Fab, cleavage with pepsin can yield F (ab ') 2 fragments
  • It can be produced through genetic recombination technology.
  • the antibody or antigen-binding fragment is specifically Fab, scFv form or a complete antibody form.
  • the heavy chain constant region may be selected from any one isotype of gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) or epsilon ( ⁇ ).
  • the heavy chain constant region is gamma 1 (IgG1), gamma 3 (IgG3) or gamma 4 (IgG4), most specifically the gamma 1 (IgG1) isotype.
  • the light chain constant region may be of kappa or lambda type, specifically kappa type. Therefore, the antibody of the present invention is a Fab, scFv form or IgG1 form having a kappa ( ⁇ ) light chain and a gamma 1 ( ⁇ 1) heavy chain, but is not necessarily limited thereto.
  • the term “heavy chain” refers to the full-length heavy chain comprising the variable region domain VH and three constant region domains CH1, CH2 and CH3 of an antibody comprising an amino acid sequence having sufficient variable region sequence to confer specificity to the antigen. And fragments thereof.
  • the term “light chain” herein also refers to both the full-length light chain and fragments thereof including the variable region domain VL and the constant region domain CL of an antibody comprising an amino acid sequence having sufficient variable region sequence to confer specificity to the antigen. do.
  • complementarity determining region refers to the amino acid sequences of the hypervariable regions of immunoglobulin heavy and light chains (Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., US Department of Health and Human Services, National Institutes of Health (1987)).
  • the heavy chains (CDRH1, CDRH2 and CDRH3) and light chains (CDRL1, CDRL2 and CDRL3) each contain three CDRs. CDRs provide key contact residues for the antibody to bind antigen or epitope.
  • humanized antibody refers to a chimeric immunoglobulin containing a minimum sequence derived from a non-human immunoglobulin of a non-human (eg murine) antibody, an immunoglobulin chain or fragment thereof (eg Fv , Fab, Fab ', F (ab') 2 or other antigen-binding subsequence of the antibody).
  • humanized antibodies are those in which the residues of the complementarity-determining regions (CDRs) of the recipient are of a non-human species (donor antibody), eg, mouse, rat or rabbit, having the desired specificity, affinity and ability. Human immunoglobulin (receptor antibody) replaced by a residue of a CDR.
  • the Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • Humanized antibodies can also include residues that are not found in the recipient antibody or in the imported CDR or framework sequences. Such modifications are made to further refine and optimize antibody performance.
  • the humanized antibody will comprise at least one, and typically two substantially all variable domains, in which all or substantially all of the CDR regions correspond to the CDR regions of non-human immunoglobulins, All or substantially all of the FR region has the sequence of the FR region of human immunoglobulin.
  • the humanized antibody comprises at least a portion of an immunoglobulin constant region (Fc region) to a constant region of an actual human immunoglobulin (Fc region).
  • Affibody® molecule is Z-domain (Z domain), which is a site that is affinity for IgG in Protein A of Staphylococcus aureus.
  • affibody is also expressed as “Z body” or "Zb”.
  • Affibody is a small protein consisting of 58 amino acid residues. 13 amino acids that form a binding surface with IgG in the protein sequence of the Affibody molecule is capable of binding to a variety of target antigens according to the amino acid sequence, and can be arranged randomly to build a library.
  • Affibody molecules can screen affibody molecules that can bind to a variety of target antigens through screening methods, such as phage display, yeast protein hybrid (Y2H), and the like from antibodies to the library. .
  • Affibodies that specifically bind to HER2 and amyloid beta (amyloid- ⁇ ) have been developed by using properties of affibody molecules capable of binding to target antigens (Orlova et al. 2006, Cancer Res., Gronwall et. al., 2007, J. Biotechnol.).
  • Affibody has a very small molecular weight of 6 kDa, which is generally diffused systemically upon human administration, and rapidly removed by kidney filtration compared to an IgG type antibody having a molecular weight of 150 kDa. Therefore, the body is mainly applied to diagnostic sample research and development (Goldstein R et al., 2013, Expert Rev Anticancer Ther.). Affibody has also been developed in the form of double antibodies combined with normal IgG (Yu F et al., 2014, MAbs).
  • Polypeptide scaffolds based on first generation Z variants have been disclosed in PCT Publication WO95 / 19374, and inventions relating to polypeptide scaffolds based on second generation Z variants are disclosed in PCT Publication WO2009 /. As disclosed in 080811.
  • target binding polypeptide refers to a non-immunoglobulin polypeptide molecule that has a binding affinity for a target antigen or hapten, such as an antibody, but is structurally unrelated to the antibody.
  • the target binding polypeptide is also called antibody-like molecule or antibody mimetics, and unlike antibodies having a molecular weight of about 150 kDa, it generally has a molecular weight of 3-20 kDa.
  • the target binding polypeptide is affili derived from Affilin derived from Z-domain of protein A, gamma-B crystallin, or ubiquitin, and astatin derived from cystatin.
  • the target binding polypeptides described above may be engineered to have binding affinity for any target antigen or hapten through various screening methods known in the art such as phage display, ribosome display.
  • antibody As used herein, the terms "antibody”, “antigen binding fragment”, and
  • target binding polypeptide is as described above.
  • cancer is defined herein as a disease characterized by the rapid and uncontrolled growth of abnormal cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Such cancers include solid tumors and nonsolid tumors (eg hematologic tumors).
  • tumor refers to the abnormal growth of benign, pre-cancerous, malignant or metastatic tissues.
  • target binding polypeptide refers to a non-immunoglobulin polypeptide molecule that has a binding affinity for a target antigen or hapten, such as an antibody, but is structurally unrelated to the antibody.
  • the target binding polypeptide is also called antibody-like molecule or antibody mimetics, and unlike antibodies having a molecular weight of about 150 kDa, it generally has a molecular weight of 3-20 kDa.
  • the target binding polypeptide is affili derived from Affilin derived from Z-domain of protein A, gamma-B crystallin, or ubiquitin, and astatin derived from cystatin.
  • the target binding polypeptides described above may be engineered to have binding affinity for any target antigen or hapten through various screening methods known in the art such as phage display, ribosome display.
  • antibody As used herein, the terms "antibody”, “antigen binding fragment”, and
  • target binding polypeptide is as described above.
  • cancer is defined herein as a disease characterized by the rapid and uncontrolled growth of abnormal cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Such cancers include solid tumors and nonsolid tumors (eg hematologic tumors).
  • tumor refers to the abnormal growth of benign, pre-cancerous, malignant or metastatic tissues.
  • Solid tumors are usually abnormal masses of tissue that do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named according to the type of cells that form the tumor (eg sarcomas, carcinomas and lymphomas).
  • solid tumors such as sarcomas and carcinomas
  • solid tumors such as sarcomas and carcinomas
  • fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas synoviomas Mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, pancreatic cancer, breast cancer Lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma
  • carcinoma adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, chromaffin cell sebaceous gland carcinoma, papilloma carcinoma carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, chorionic carcinoma (choriocarcinoma), Wilms' tumor, cervical cancer, testicular tumor, seminoma, bladder carcinoma, melanoma, and CNS tumors (eg Glioma (e.g.
  • glioblastoma also known as glioblastoma multiforme
  • Astrocytoma CNS lymphoma, germinoma, medulloblastoma, Schwannoma craniopharyogioma, epitopyoma, pinealoma, angioblastoma (pinealoma) hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, neuroblastoma, retinoblastoma and brain metastases.
  • Hematologic tumors or hematologic cancers are cancers of the blood or bone marrow.
  • hematopoietic (or hematopoietic) cancers include leukemia, eg acute leukemias (eg acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia).
  • chronic myeloid chronic myelocytic leukemia chronic myeloid leukemia, and chronic myelogenous leukemia
  • polycythemia vera lymphoma
  • Hodgkin's disease non-Hodgkin's lymphoma non-Hodgkin's lymphoma (delayed and high grade forms)
  • multiple myeloma Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome (m) yelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
  • autoimmune disease is defined as a disease resulting from an autoimmune response. Autoimmune diseases are the result of inappropriate and excessive reactions to self-antigens. Examples of autoimmune diseases include, but are not limited to, especially Addision's disease, alopecia areata, ankylosing spondylitis, autoimmune hepatitis, autoimmune parotitis, Crohn's disease.
  • cytotoxic refers to killing or damaging cells.
  • cytotoxicity of activated cells to target cells means, for example, increased cytolytic activity of T lymphocytes.
  • the targeting moiety constituting the switch molecule and (b) the polypeptide binding to the chimeric antigen receptor are covalently linked to each other.
  • conjugates in which two or more polypeptide chains are covalently linked through expression of a recombinant fused protein, or two or more polypeptide chains are linked by chemical conjugation. It can be implemented in the form of.
  • the targeting moiety and (b) the polypeptide binding to the chimeric antigen receptor can be linked directly or indirectly via a linker (eg an amino acid linker).
  • a linker eg an amino acid linker
  • Linkers may involve the use of linkers between functional moieties to be fused, usually in the construction of fusion proteins, and include other types of linkers with different properties, such as flexible amino acid linkers, non-flexible It will be appreciated that there are linkers and cleavable amino acid linkers. Linkers have been used to increase the expression level of fusion proteins, to enhance biological activity, to enable targeting, to alter pharmacokinetics, or to increase the stability and to enhance the folding of fusion proteins.
  • the complex may further include at least one linker selected from at least one linker, such as a flexible amino acid linker, a non-flexible linker, and a cleavable amino acid linker.
  • said linker is arranged between said (a) targeting moiety and (b) a polypeptide that binds to a chimeric antigen receptor.
  • the a) targeting moiety of the switch molecule and (b) the polypeptide binding to the chimeric antigen receptor are linked by at least one linker.
  • the linker may consist of an amino acid sequence represented by the general formula (G n S m ) p or (S m G n ) p :
  • n, m and p are independently
  • n is an integer ranging from 1 to 7;
  • n is an integer ranging from 0 to 7;
  • n and m are integers 8 or less;
  • p is an integer ranging from 1 to 7.
  • said linker is VDGS. In another specific embodiment, said linker is ASGS.
  • the polypeptide or fusion protein expressed herein, including the switch molecule may include at least one additional amino acid at the C-terminus and / or N-terminus of the polypeptide / fusion protein.
  • additional amino acid residues may be added individually or collectively, for example, for the purpose of improving productivity, purification, stabilization in vivo or ex vivo, coupling or detection of the complex.
  • the polypeptide or fusion protein may further include cysteine residues at the C-terminus and / or N-terminus of the polypeptide or fusion protein. Additional amino acid residues may provide a “tag” for purification or detection of the polypeptide, for example the tag is for interaction of the tag with a specific antibody.
  • IMAC immobilized metal affinity chromatography
  • the present invention provides a nucleic acid molecule comprising a nucleotide sequence encoding the switch molecule described above.
  • the nucleotide sequence encoding the switch molecule of the present invention is sufficient to be a nucleotide sequence encoding an amino acid sequence constituting the switch molecule, it is not limited to any particular nucleotide sequence Self-explanatory This is because even if the nucleotide sequence occurs, the expression of the nucleotide sequence with the mutated protein does not bring about a change in the protein sequence. This is called degeneracy of the codon.
  • the nucleotide sequence may be a functionally equivalent codon or a codon that encodes the same amino acid (e.g., by degeneracy of the codon, six codons for arginine or serine), or a codon that encodes a biologically equivalent amino acid. It comprises a nucleotide sequence comprising a.
  • nucleic acids has the meaning of encompassing DNA (gDNA and cDNA) and RNA molecules inclusively, and the nucleotides that are the basic structural units in nucleic acid molecules are not only natural nucleotides, but also sugar or base sites. Modified analogues (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, 90: 543-584 (1990)).
  • the nucleic acid molecule of the present invention encoding the amino acid sequence constituting the switch molecule is interpreted to include a sequence exhibiting substantial identity thereof. Such substantial identity is minimal when the sequence of the present invention is aligned with the maximal correspondence with any other sequence, and the aligned sequence is analyzed using algorithms commonly used in the art. At least 60% homology, more specifically at least 70% homology, more specifically at least 80% homology, even more specifically at least 90% homology, most specifically at least 95% homology Refers to the sequence. Alignment methods for sequence comparison are known in the art. Various methods and algorithms for alignment are described in Smith and Waterman, Adv. Appl. Math. 2: 482 (1981); Needleman and Wunsch, J.
  • the invention provides a recombinant vector comprising a nucleic acid molecule encoding the above-described switch molecule.
  • vector refers to a plasmid vector as a means for expressing a gene of interest in a host cell; Cosmid vector; And viral vectors such as bacteriophage vectors, adenovirus vectors, retrovirus vectors, and adeno-associated virus vectors, and the like.
  • the nucleic acid molecule encoding the switch molecule in the vector of the present invention is operatively linked with the promoter of the vector.
  • operably linked means a functional binding between a nucleic acid expression control sequence (eg, an array of promoters, signal sequences, or transcriptional regulator binding sites) and other nucleic acid sequences, thereby The regulatory sequence will control the transcription and / or translation of said other nucleic acid sequence.
  • a nucleic acid expression control sequence eg, an array of promoters, signal sequences, or transcriptional regulator binding sites
  • the recombinant vector system of the present invention can be constructed through various methods known in the art, and specific methods thereof are disclosed in Sambrook et al., Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory Press (2001). This document is incorporated herein by reference.
  • Vectors of the invention can typically be constructed as vectors for gene cloning or for expression of proteins.
  • the vector of the present invention can be constructed using prokaryotic or eukaryotic cells as hosts.
  • promoters derived from the genome of mammalian cells e.g., metallothionine promoter, ⁇ -actin promoter, human heroglobin promoter and Human muscle creatine promoter
  • promoters derived from mammalian viruses e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter, tk promoter of HSV, mouse breast tumor virus (MMTV) promoter, LTR promoter of HIV, promoter of Moroni virus, promoter of Epstein Barr virus (EBV) and promoter of Loews Sacoma virus (RSV)
  • adenovirus late promoter vaccinia virus 7.5K promoter
  • SV40 promoter cytomegalovirus promoter
  • tk promoter of HSV e.g., mouse breast tumor virus (MMTV) promoter
  • LTR promoter of HIV e.g., promoter of Moroni virus, promoter of Epstein Barr
  • Vectors of the present invention may also be fused with other sequences to facilitate purification of the polypeptide or protein expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA).
  • the expression vector of the present invention as an optional marker, and includes antibiotic resistance genes commonly used in the art, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neo There are genes resistant to mycin and tetracycline.
  • the present invention provides a host cell transformed with the recombinant vector.
  • Host cells capable of stable and continuous cloning and expression of the vectors of the present invention are known in the art, and any host cell may be used.
  • suitable eukaryotic host cells of the vector include monkey kidney cells (COS7), NSO cells, SP2 / 0, Chinese hamster ovary (CHO) cells, W138, young hamster kidneys (BHK: baby hamster kidney) cells, MDCK, myeloma cell line, HuT 78 cells and HEK-293 cells.
  • transformed As used herein, the terms “transformed,” “transduced,” or “transfected” refer to the process by which exogenous nucleic acid is delivered or introduced into a host cell.
  • Infected cells are cells that have been transformed, transduced or transfected with an exogenous nucleic acid, which cells include the cells and progeny cells due to passage passage thereof.
  • the present invention provides a composition comprising the switch molecule described above.
  • the composition is a pharmaceutical composition for immunotherapy comprising the switch molecule and a pharmaceutically acceptable carrier.
  • immunotherapy is a method of treating cancer that helps the immune system get rid of cancer. Immunotherapy is divided into active and passive immunotherapy. Active immunotherapy includes: i) cancer vaccine therapy that activates the immune system by injecting cancer cells or substances produced by cancer cells into the human body, ii) cytokines (interferon, interleukin, etc.), immunomodulators such as growth factors ( immune-modulating therapies that activate specific white blood cells by administering immune-modulating agents. Passive immunotherapy includes therapeutic antibodies and immune cell therapy that bind to specific cancer cells. Immune cell therapies include dendritic cell vaccine therapy, chimeric antigen receptor T cell therapy, natural killer cell therapy, cytotoxic T lymphocyte therapy, and adoptive cells. Transfer cell (adoptive cell transfer) and the like, but is not limited thereto. In the present invention, the immunotherapy mainly means the immune cell treatment described above.
  • the pharmaceutical composition of the present invention comprises a switch molecule comprising a targeting moiety that binds to the cell surface molecule of the target cell, manipulation of the target antigen of the targeting moiety is effective in preventing or treating various diseases.
  • the target antigen to which the targeting moiety binds is 4-1BB, 5T4, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B lymphoma cell, C242 antigen, CA-125, carbonic anhydrase 9 (CA-IX), C-MET , CCR4, CD152, CD19, CD20, CD200, CD22, CD221, CD23 (IgE receptor), CD28, CD30 (TNFRSF8), CD33, CD4, CD40, CD44 v6, CD51, CD52, CD56, CD74, CD80, CEA, CNT0888 , CTLA-4, DR5, EGFR, EpCAM, CD3, FAP, Fibronectin Extra Domain-B, Folate Receptor 1, GD2, GD3 Ganglioside, Glycoprotein 75, GPNMB, HER2 / neu, HGF, Human Scattering Factor Receptor Kinase, IGF-1 Receptor, IGF-I, IgG1, LI-CAM
  • the disease that can be treated using the pharmaceutical composition of the present invention is a disease of humans and mammals associated with cells expressing CD19.
  • the disease includes chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), pro-lymphocytic leukemia, hairy cell leukemia, general Common acute lymphocytic leukemia (CALLA), Null-acute lymphoblastic leukemia, non-Hodgkin's lymphoma, diffuse large B cell lymphoma (DLBCL), multiple myeloma, follicular lymphoma, B cells selected from the group consisting of splenic lymphoma, marginal zone lymphoma, mantle cell lymphoma, indolent B cell lymphoma, and Hodgkin lymphoma Malignancy (B cell malignancy).
  • CLL chronic lymphocytic leukemia
  • ALL acute lymphocytic leukemia
  • CALLA general Common acute lymphocytic leukemia
  • the disease also includes autoimmune diseases and inflammatory diseases associated with inappropriate or enhanced B cell numbers and / or activation.
  • autoimmune diseases and inflammatory diseases include multiple sclerosis, rheumatoid arthritis and systemic lupus erythematosus (SLE).
  • Pharmaceutically acceptable carriers included in the pharmaceutical compositions of the present invention are those commonly used in the preparation, such as lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia rubber, calcium phosphate, alginate, gelatin, Calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like It doesn't happen.
  • the pharmaceutical composition of the present invention may further include a lubricant, a humectant, a sweetener, a flavoring agent, an emulsifier, a suspending agent, a preservative, and the like.
  • a lubricant e.g., talc, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, a kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mann
  • compositions of the present invention may be administered orally or parenterally, such as intravenous, subcutaneous, intradermal, intramuscular, intraperitoneal, intrasternal, intratumoral, topical, intranasal, intracranial.
  • Administration, intracranial administration, pulmonary administration and rectal administration may be administered, but is not limited thereto.
  • Suitable dosages of the pharmaceutical compositions of the present invention vary depending on factors such as the formulation method, mode of administration, age, weight, sex, morbidity, food, time of administration, route of administration, rate of excretion and reaction sensitivity of the patient, Usually a skilled practitioner can easily determine and prescribe a dosage effective for the desired treatment or prophylaxis.
  • the daily dose of the pharmaceutical composition of the present invention is 0.0001-100 mg / kg.
  • pharmaceutically effective amount means an amount sufficient to prevent or treat the aforementioned diseases.
  • prevention refers to the prevention or protective treatment of a disease or condition.
  • treatment refers to the reduction, inhibition, sedation or eradication of a disease state.
  • compositions of the present invention may be prepared in unit dosage form by formulating with a pharmaceutically acceptable carrier and / or excipient according to methods which can be easily carried out by those skilled in the art. Or may be prepared by incorporation into a multi-dose container.
  • the formulations may be in the form of solutions, suspensions or emulsions in oils or aqueous media or in the form of extracts, powders, suppositories, powders, granules, tablets or capsules, and may further comprise dispersants or stabilizers.
  • compositions of the present invention may also contain other pharmaceutically active agents or drugs in addition to the switch molecules described above, such as asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine.
  • chemotherapeutic agents such as hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, and the like.
  • the invention provides a complex comprising:
  • a switch molecule for activating a chimeric antigen receptor-effector cell comprising:
  • the (aa) targeting moiety and the polypeptide binding to the chimeric antigen receptor on the (bb) effector cell are an antibody, an antigen binding fragment or affibody of the antibody.
  • a target binding polypeptide such as a), and (b) the polypeptide or fusion protein is also a target binding polypeptide such as an antibody targeting the switch molecule, an antigen-binding fragment of the antibody, or affibody. Chimeric antigen receptors.
  • the present invention (a) an extracellular domain comprising a target binding polypeptide, such as an antibody targeting the above-described switch molecule, an antigen-binding fragment of the antibody, or apibody ); (b) transmembrane domain; And (c) provides a chimeric antigen receptor (CAR) comprising an intracellular signaling domain.
  • a target binding polypeptide such as an antibody targeting the above-described switch molecule, an antigen-binding fragment of the antibody, or apibody
  • transmembrane domain a chimeric antigen receptor (CAR) comprising an intracellular signaling domain.
  • CAR chimeric antigen receptor
  • the invention provides a CAR-effector cell therapy comprising (a) the switch molecule of the invention described above, and (b) the chimeric antigen receptor targeting the switch molecule of the invention described above Provide an enemy system.
  • a switch molecule that specifically binds to a surface antigen (eg CD19) of a particular cancer cell, and (b) an effector that expresses a chimeric antigen receptor that targets the switch molecule
  • Cells eg T cells, dendritic cells
  • cancer eg cancer of cells associated with CD19 expression
  • chimeric antigen receptor refers to a target binding domain (eg single chain) linked to an effector cell signaling or effector cell activation domain (eg T-cell signaling or T-cell activation domain).
  • Chimeric antigen receptors generally have the ability to reinduce T-cell specificity and responsiveness to selected targets in a non-MHC-limited manner, utilizing the antigen-binding properties of monoclonal antibodies.
  • Non-MHC-restricted antigen recognition provides T-cells expressing CARs with the ability to recognize antigens independent of antigen treatment, thereby avoiding the main mechanism of tumor escape.
  • TCR T-cell receptor
  • the chimeric antigen receptor of the invention is a switchable chimeric antigen receptor (sCAR).
  • the extracellular domain of a typical conventional classical chimeric antigen receptor includes antibodies or antigen-binding fragments that target specific antigens (eg, tumor associated antigens (TAAs) such as HER2 antigen, CD19 antigen). do.
  • TAAs tumor associated antigens
  • the extracellular domain of the chimeric antigen receptor of the invention comprises an antibody, an antigen binding fragment of the antibody, or a target binding polypeptide.
  • the antibody, antigen-binding fragment, or target binding polypeptide of the extracellular domain does not directly target the cell surface antigen of the target cell, but the above-described switch molecule (specifically, CAR binding poly of the switch molecule). Peptides).
  • the chimeric antigen receptor of the present invention comprises a Zb2 or Zb1 which recognizes Zb1 (first sequence, second sequence) or Zb2 (third sequence, fourth sequence) CAR of the switch molecule Binding polypeptides can be targeted.
  • the intracellular signaling domain is an intracellular signaling domain of a stimulatory molecule, a costimulatory molecule, responsible for the activation of the cell expressing the CAR.
  • the intracellular signaling domains include, but are not limited to, TCR, CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, CD86, conventional FcR gamma, FcR beta (Fc epsilon R1b), CD79a, CD79b, Fcgamma RIIa, DAP10, DAP12 , T cell receptor (TCR), CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, Lymphocyte Function-Related Antigen-1 (LFA-1), CD2, CD7, LIGHT, Ligands that specifically bind to NKG2C, B7-H3, CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8 alpha, CD8beta , IL2R Beta, IL2
  • the (bb) transmembrane domain is T-cell receptor, CD27, CD28, CD3, epsilon, CD45, CD4, CD5, CD8 (CD8 ⁇ ), CD9, CD16, CD22, CD33, CD37 , CD64, CD80, CD86, CD134, CD137 and CD154, transmembrane domain of a protein selected from the group consisting of alpha, beta or zeta chains.
  • the (cc) intracellular signaling domain is a domain derived from a CD3 ⁇ (CD3 zeta) chain.
  • the (cc) intracellular signaling domains are OX40 (CD134), CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a / CD18) and 4-1BB (CD137) may further include a costimulatory molecule selected from the group consisting of.
  • the intracellular signaling domain may be obtained or derived from other intracellular signaling molecules known in the art, in addition to the domains described above, and may include all or a fragment thereof of the molecule from which the intracellular signaling domain is derived.
  • the transmembrane domain and intracellular signaling domain of the chimeric antigen receptor of the invention may be included in a combination of one or more of the specific transmembrane domains and intracellular signaling domains described above.
  • the chimeric antigen receptor of the invention may comprise a CD8 ⁇ transmembrane domain and intracellular signaling domains of CD28 and CD3 ⁇ .
  • the “switch molecule” refers to a T cell therapy using the chimeric antigen receptor, that is, a cell therapy called CAR-T, which separates the target recognition domain of the CAR from the cell signaling domain of the CAR, Means an adapter molecule to mediate.
  • Switch molecules allow for the reduction of CAR cell activity through administration of the switch molecule in the event of side effects due to the replacement of the CAR target for Heterogenous target, or resistant tumor, or due to excessive activation of the CAR expressing cells (Cao et al. , Angew Chem Int Ed Engl. 2016 June 20; 55 (26): 7520-7524.).
  • the present invention is an effector cell expressing a chimeric antigen receptor, wherein the chimeric antigen receptor is (b) a chimeric antigen receptor binding polypeptide of a switch molecule described above (e.g., skin Body molecules), thereby providing effector cells.
  • the present invention provides a CAR-effector cell therapeutic system comprising:
  • An effector cell expressing (a) the switch molecule of the invention described above, and (b) the chimeric antigen receptor targeting the switch molecule of the invention described above.
  • a switch molecule that specifically binds to a surface antigen (eg CD19) of a particular cancer cell, and (b) a chimeric antigen receptor that targets the switch molecule
  • a surface antigen eg CD19
  • a chimeric antigen receptor that targets the switch molecule
  • Expressing effector cells eg T cells, dendritic cells
  • the effector cells are selected from the group consisting of dendritic cells, killer dendritic cells, mast cells, natural killer cells, B lymphocytes, T lymphocytes, macrophages and their progenitor cells.
  • the T lymphocytes may be selected from the group consisting of inflammatory T lymphocytes, cytotoxic T lymphocytes, regulatory T lymphocytes or helper T lymphocytes.
  • the present invention provides an effector cell expressing the chimeric antigen receptor; And administering a switch molecule that binds to the chimeric antigen receptor to a subject in need thereof.
  • the method is a method for treating a disease or condition associated with a tumor or cancer.
  • the method is a method for treating a disease or condition associated with autoimmunity.
  • the method for treating a disease or condition associated with a tumor or cancer further comprises administering to the subject one or more switch molecules that bind to a cell surface molecule of a target cell different from the switch molecule administered first to the subject. Steps.
  • the method for treating a disease or condition associated with a tumor or cancer of the present invention is a method of commonly using the effector cell expressing the above-described CAR and the switch molecule that binds the CAR as an active ingredient, the descriptions of the present specification will be repeated. The description is omitted to avoid excessive complexity.
  • the present invention (a) a subject in need of treatment of the above-described effector cell (CAR-effector cell) expressing the chimeric antigen receptor and the switch molecule of the present invention to bind the chimeric antigen receptor Administering to; And (b) additionally administering to the subject one or more switch molecules that bind to a cell surface molecule of a target cell different from the switch molecule administered first to the subject, or a polypeptide that binds to a chimeric antigen receptor lacking a targeting moiety.
  • CAR-effector cell expressing the chimeric antigen receptor and the switch molecule of the present invention to bind the chimeric antigen receptor Administering to;
  • additionally administering to the subject one or more switch molecules that bind to a cell surface molecule of a target cell different from the switch molecule administered first to the subject, or a polypeptide that binds to a chimeric antigen receptor lacking a targeting moiety.
  • the effector cell expressing the CAR does not directly recognize the cell surface molecule of the cancer cell, but through a switch molecule comprising a polypeptide that binds to the CAR. Recognize indirectly.
  • the CAR when an additional administration of one or more switch molecules that bind to a cell surface molecule of a target cell different from a switch molecule administered first to a subject, or a polypeptide that binds to a chimeric antigen receptor without a targeting moiety, the CAR is no longer present in the existing cancer cells. Can not be targeted, thereby inhibiting excessive activity of CAR-T cells.
  • the present invention provides a switch molecule for activating a chimeric antigen receptor-effector cell.
  • the invention also provides (a) a switch molecule for activating a chimeric antigen receptor-effector cell and (b) a polypeptide or fusion protein that specifically binds to the switch molecule. do.
  • the present invention also provides a chimeric antigen receptor (CAR) comprising the switch molecule or fusion protein.
  • CAR chimeric antigen receptor
  • the activity of CAR-T cells can be modulated by administering a switch molecule lacking a targeting moiety when severe toxicity is indicated to improve the safety of CAR-T cells, and (ii ) When a mutation of an antigen occurs, or by treating a patient with a switch molecule that targets a new antigen resulting from the mutation or a switch molecule that targets a different tumor-associated antigen (TAA) instead of an existing switch molecule to treat various carcinomas.
  • TAA tumor-associated antigen
  • FIG. 1 is a diagram showing that affiliates specifically binding to each other (Zb) were produced in an expected size through SDS-PAGE analysis after production in His or Fc-bound form.
  • Figure 2a-2b is a diagram showing the specific binding of Zb1 and Zb2 using the BLI test method.
  • 2a shows the binding of the Zb1-Fc protein to the sensor chip immobilized switch molecules
  • FIG. 2b shows the binding of the Zb2-Fc protein.
  • FIG. 3 is a diagram illustrating the production of a switch molecule in which Zb1 is combined with affibody (zHER2) and IgG antibody (igHER2) that target HER2, and analyzed by SDS-PAGE analysis.
  • FIG. 4 is a diagram showing the results of analyzing the binding directly Zb2-Fc to the switch molecule targeting HER2 by the BLI test method.
  • FIG. 5a-5c is a diagram showing that a switch molecule targeting HER2 and Zb2-Fc protein can be used to target HER2 protein and HER2 expressing cancer cells.
  • 5a is a diagram illustrating the binding of Zb2-Fc to a HER2 protein through a switch molecule in a BLI test method.
  • FIG. 5B shows that OE-19, which is a HER2-positive cell
  • FIG. 5C which can selectively target only HER2-positive cells using a switch molecule and Zb2-Fc using HER2 negative cells, MDA-MB-231. .
  • FIG. 6 is a schematic of various switch molecules targeting CD19.
  • FIG. 7A-7B show that CD19 expressing cancer cells can be selectively targeted by using a switch molecule and ape body that target CD19.
  • FIG. 7A shows that Raji, a CD19 positive cell
  • FIG. 7B can selectively target a switch molecule containing Zb1 or Zb2 using Zb2-Fc or Zb1-Fc, respectively, using Jurkat, a CD19 negative cell. to be.
  • FIGS. 8A-8B show HER2-positive cells, SK-OV3 cells, using T cells (Zb2.CART) expressing chimeric antigen receptors comprising Zb2 aphibodies and HER2 target switch molecules (zHER2-Zb1) comprising Zb1.
  • Figure showing HER2 specific CAR-T cell activity for. Activity was measured by SK-OV3 cells and Zb2.CART cells co-cultured with a switch molecule (zHER2-Zb1) at a ratio of 1: 5 for 24 hours.
  • Figure 8a is the result of measuring the interferon gamma of the culture medium by ELISA test method
  • Figure 8b is a result of confirming the cytotoxicity by measuring the cell viability by the luminescence test method.
  • % used to indicate the concentration of a particular substance is (weight / weight)% solids / solids, (weight / volume)%, unless otherwise indicated, and Liquid / liquid is (volume / volume)%.
  • the novel switchable chimeric antigen receptor system (sCAR system) of the present invention is a switch molecule that binds to the antigen binding site of the CAR receptor and the antigen binding site of the CAR receptor in a conventional switchable CAR system.
  • Affibody abbreviated herein as "Z body” and "Zb" is used.
  • the present inventors confirmed whether the affibody pair can be used as a switch molecule that binds the antigen binding site of the CAR receptor and the antigen binding site of the CAR receptor by the following experiment.
  • the present inventors have expressed histidine-tagged proteins (Zb1-His, Zb2-His) and proteins expressing the Fc region (Zb1-Fc, Zb2-) in two kinds of affibodies (Zb1, Zb2) that specifically bind to each other.
  • Fc was prepared using bacterial cells and animal cells, respectively, and the binding between them was confirmed by BioLayer Interferometry (BLI) analysis.
  • Zb1-His SEQ ID NO: 1, 2) and Zb2-His (SEQ ID NO: 3, 4) genes were used in pET21a (Novagen, Cat No. 69740-3) using NcoI and XhoI restriction enzymes. Cloned. The cloned vector was transformed into BL21 (DE3) Competent cells (Novagen, Cat No. 69450) and expressed using 1 mM IPTG (LPS solution, Cat No. IPTG025). Zb-His protein was purified from the cytoplasm of cultured cells using Ni-NTA resin (Qiagen, Cat No. 30410).
  • Zb1-Fc (SEQ ID NO: 5) and Zb2-Fc (SEQ ID NO: 8) genes were cloned into pCEP4 vectors (Invitrogen, Cat. No. V044-50) using SfiI restriction enzymes. Subsequently, the cloned vector was transiently transfected into FreeStyle 293F (Invitroen, Cat. No. R790-07) cells using polyethyleneimine (Polyscience Inc, Cat. No. 23966), and protein- Purification using A ceramic HyperD F resin (PALL, Cat. No. 20078-028). Purified protein was quantified using Protein assay dye (Bio-Rad, Cat. No.
  • Zb1-Fc or Zb2-Fc protein was bound to the Zb protein-fixed sensor chip at a concentration of 10 mg / mL for 15 minutes (FIGS. 2A and 2B). As shown in FIGS. 2A and 2B, Zb1-Fc protein bound to Zb2-His and Zb2-Fc proteins, and Zb2-Fc protein bound to Zb1-His and Zb1-Fc proteins.
  • Affibody pairs (eg, Zb1 and Zb2) that specifically bind to each other may be usefully used as switch molecules that bind to the antigen-binding site of the CAR receptor of the present invention and the antigen-binding site of the CAR receptor. Can be.
  • the switchable CAR system of the present invention utilizes a CAR molecule comprising a switch molecule comprising Affibody (Zb) that targets specific cancer cells and affibody specifically binding to the switch molecule.
  • a CAR molecule comprising a switch molecule comprising Affibody (Zb) that targets specific cancer cells and affibody specifically binding to the switch molecule.
  • Zb Affibody
  • the inventors have prepared three HER2-targeting switch molecules comprising aphibodies (eg Zb1), and the binding and switch molecules between the switch molecule and the aphibody molecule (antigen binding site of CAR)- Affibody complexes (switch molecules and CARs) were confirmed for targeting.
  • aphibodies eg Zb1
  • the binding and switch molecules between the switch molecule and the aphibody molecule antigen binding site of CAR
  • switch molecules and CARs switch molecules and CARs
  • ZHER2-Zb1, scHER2-Zb1, igHER2- a switch molecule that binds Zb1 to apibody (zHER2) targeting HER2, scFv (scHER2) of trastuzumab targeting HER2, and IgG-type antibody (igHER2) Zb1 was cloned and produced respectively.
  • HER2-Zb1 and scHER2-Zb1 included His tag at the C-terminus for purification.
  • zHER2-Zb1 and scHER2-Zb1 were purified using Ni-NTA resin after expression in bacteria as in Example 1 above.
  • igHER2-Zb1 was purified using protein-A resin after expression in animal cells. Purified protein was confirmed using SDS-PAGE to generate the expected size (Zb1-His 7.3 kDa; zHER2-Zb1 14.4 kDa; scHER2-Zb1 49.5 kDa; igHER2-Zb1 heavy chain chain 57.5 kDa) (Fig. 3).
  • Example 2-2 HER2 Targeting With three switch molecules Afbody molecule( Switchable Binding of the antigen binding site of the CAR)
  • the present inventors specifically bind to three kinds of switch molecules (zHER2-Zb1, scHER2-Zb1, igHER2-Zb1) including affibody prepared in Example 2-1 and affibody (Zb1) of the switch molecule. affiliate (eg Zb2) was confirmed whether the binding.
  • switch molecules including zirbody (Zb1) (zHER2-Zb1, scHER2-Zb1, igHER2-Zb1) and the paired aphibody molecule (Zb2) specifically bind to each other
  • Switchable CAR systems can be constructed that comprise affibody pairs as switch molecules that bind to the antigen binding site of the CAR and the antigen binding site of the CAR, respectively.
  • Affibody (Zb2) to a switch molecule including Affibody (Zb1) was confirmed using BLI analysis.
  • switch molecules zHER2-Zb1, scHER2-Zb1, igHER2-Zb1 were fixed to the AR2G sensor chip in the same manner as in Example 1 by an amine coupling method using EDC / NHS at a concentration of 200 nM.
  • Zb2-Fc protein was bound to the sensor chip fixed with the switch molecule protein at a concentration of 200 nM for 15 minutes.
  • Zb1-His protein was used as a positive control and bovine serum albumin (BSA) as a negative control. The results are shown in FIG.
  • Zb2-Fc protein specifically binds to all three switch molecules including Zb1.
  • Affiy pairs that specifically bind to each other from the above results can be usefully used in a switchable CAR system comprising the affibody pairs as switch molecules that bind to the antigen-binding site of the CAR and the antigen-binding site of the CAR, respectively. Able to know.
  • switch molecules including aphibodies of the present invention (eg zHER2-Zb1, scHER2-Zb1, and igHER2 -Zb1) and a protein (eg Zb2-Fc) conjugated protein containing affibodies that specifically bind to affibodies of the switch molecule can be subjected to the BLI assay. It confirmed using.
  • Immobilized hHER2-ECD-His human HER2 extracellular domain-His tag
  • Zb2-Fc-Biotin was treated at a concentration of 1 mg / mL for binding for 15 minutes (FIG. 5A).
  • Biotinylation of Zb2-Fc protein was made using EZ-Link sulfo-NHS-LC-Biotin (Thermo Fisher Scientific, Cat. No. 21335). From the above results, it was confirmed that the Affibody pair (Abbody pair, Zb pair) of the present invention can target the HER2 protein using the switch molecule and the antigen binding site of the CAR, respectively.
  • the switch molecule eg zHER2-Zb1, scHER2-Zb1, and igHER2-Zb1 including the aphibodies targeting HER2 and a protein containing aphibodies specifically binding to the aphibody (eg Zb2-Fc It was confirmed by flow cytometry whether the conjugated complex) could selectively target HER2-positive cancer cells.
  • HER2-positive cells OE-19 (ECACC, Cat. No. 96071721) was used, and as HER2-negative cells, MDA-MB-231 (Korea Cell Line Bank, Cat. No. 30026) was used.
  • the antibody (antigen binding fragment, scFv) that recognizes CD19, a marker of B cell-derived carcinoma, and Affibody of the present invention were used to determine whether CD19-positive cancer cells could be targeted.
  • scFv antigen binding fragment
  • Affibody of the present invention were used to determine whether CD19-positive cancer cells could be targeted.
  • the difference in the binding properties according to the type of linker connecting the site and cancer body to target the cancer marker confirmed the difference in the target ability according to the type of api body.
  • CD19 target antibody which was previously invented in Korean Patent Application No.
  • 10-2017-0178559 was prepared in scFv form, and the above-described apebody Zb1 (first sequence, second sequence) or Zb2 (third sequence, fourth sequence) And a switch molecule connected with (G 4 S) 3 linker or (S 4 G) 3 linker were prepared, and His tag was connected to C-terminus for purification (FIG. 6).
  • the switch molecules were expressed in bacteria as in Example 1 and purified using Ni-NTA resin.
  • switch molecules and apibody protein prepared using Raji cells (ATCC, CCL-86), which are CD19 positive cancer cells, and Jurkat cells (ATCC, TIB-152), which are CD19 negative cells, were used. After binding, it was confirmed by flow cytometry.
  • switch molecules [scCD19- (S 4 G) 3 -Zb1, scCD19- (G 4 S) 3 -Zb1, scCD19- (S 4 G) on Raji, CD19-positive cancer cells, and Jurkat cells, CD19-negative cells ) 3 -Zb2, and scCD19- (G 4 S) 3 -Zb2], followed by Zb1-Fc or Zb2-Fc, and anti-hIgG-FITC (Invitrogen, Cat. No. A11013) Detection was performed (FIGS. 7A and 7B). As shown in FIGS.
  • switch molecules comprising scFv targeting CD19 and different apibodies (Zb1 or Zb2) targeted CD19-positive Raji cells but did not target CD19-negative Jurkat cells.
  • the CD19-targeting switch molecule comprising aphibodies of the present invention can specifically target CD19.
  • a switch molecule of the present invention comprising (a) an antibody, an antigen-binding fragment, or a targeting moiety that binds to a target antigen such as affibody, and (b) a polypeptide that binds to a CAR. It can be seen that by specifically replacing the targeting moiety (targeting moiety) it can specifically bind to a variety of target antigens.
  • the switch molecule of the present invention is a polypeptide that binds to a CAR, and all combinations are possible regardless of the type of apibody (eg Zb1, Zb2) and the type of linker [(S4G) 3, (G4S) 3]. have.
  • Example 4 Afbody Connected chimera Containing antigen receptors Lentivirus making
  • Chimeric antigens comprising Zb2 to confirm cytokine secretion activity and cytotoxicity against target cells of chimeric antigen receptor T cells developed using Zb1 and Zb2 Affibody combinations and CAR-T cells prepared using switch molecules The receptor was developed.
  • the chimeric antigen receptor consisted of a CD8 leader, Zb2, a CD8 hinge and transmembrane region, a CD137 cytoplasmic region, and a cytoplasmic region of CD3 zeta.
  • the promoter was cleaved and bound with SpeI / PacI in a pLenti6.3 / V5-TOPO lentiviral vector (Invitrogen, K5315-20) whose promoter was changed to EF-1 alpha.
  • the prepared construct was confirmed by sequencing.
  • T cells with chimeric antigen receptors comprising Zb2 presented on the surface were prepared.
  • T cells from human blood are isolated and stimulated using Dynabeads TM Human T-Activator CD3 / CD28 (Thermofisher scientific, 11131D), and polybrene (Sigma-Aldrich, H9268) and the lentivirus are added to the cells.
  • the cells were incubated for 24 hours and transduced.
  • the medium was replaced with a medium containing IL-2 (Gibco, CTP0021) and cultured at 5% CO 2 , 37 ° C.
  • Cancer cells removal and cytokine secretion activity using a switch molecule containing Zb1 was analyzed using T cells (Zb2.CART cells) on which the chimeric antigen receptor including Zb2 prepared was presented on the surface.
  • SK-OV3, a HER2-positive cell line was used for the experiment.
  • the SK-OV3 cell line was dispensed such that the dog 3x10 4 per well in a 96-well plate in the form of a rounded bottom.
  • Cytotoxic T cells prepared so that SK-OV3: cytotoxic T cells in a ratio of 1: 5 were added to the plate into which the SK-OV3 cell line was dispensed.
  • zHER2-Zb1 at the concentration to be treated was incubated for 24 hours under conditions of 5% CO 2 and 37 ° C.
  • the amount of interferon gamma secreted in the medium was measured according to the manufacturer's protocol using Human IFN- ⁇ ELISA set (BD Bioscience, 555142), and the toxic effects of cytotoxic T cells were measured by luminescence assay (CytoTox-Glo Cytotoxicity). Assay, Promega, G9292) was confirmed.
  • cytotoxic effect of chimeric antigen receptor comprising Zb2, affiliation of the present invention was confirmed using CytoTox-Glo Cytotoxicity Assay after co-culture of cytotoxic T cells, SK-OV3 and zHER2-Zb1.
  • the lysis ratio was determined by setting the signal from the well in which only SK-OV3 cells were cultured to 100%.
  • Chimeric antigen receptor T cells containing Zb2 of the present invention was confirmed that the cytotoxic effect in the experimental group treated with zHER2-Zb1 (Fig. 8b).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Hematology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

본 발명은 키메라 항원 수용체 효과기 세포를 활성화하기 위한 스위치 분자, 이에 결합하는 폴리펩타이드 또는 융합단백질, 및 키메라 항원 수용체에 관한 것이다. (i) 본 발명의 스위치 분자를 이용하는 경우, CAR-T 세포의 안전성 향상시키기 위하여 심각한 독성이 나타나는 경우 표적화 모이어티가 결여된 스위치 분자를 투여함으로써 CAR-T 세포의 활성을 조절할 수 있고, (ii) 항원의 돌연변이가 일어나는 경우, 또는 다양한 암종을 치료하기 위하여 기존의 스위치 분자 대신 돌연변이로 인해 발생한 새로운 항원을 표적화하는 스위치 분자나, 상이한 종양관련 항원(TAA)을 표적화하는 스위치 분자를 환자에 투여함으로써 보다 효과적으로 암을 치료할 수 있다.

Description

스위치 분자 및 스위처블 키메라 항원 수용체
본 출원은 2018년 4월 18일에 대한민국 특허청에 제출된 대한민국 특허출원 제10-2018-0045228호에 대하여 우선권을 주장하며, 상기 특허출원의 개시사항은 본 명세서에 참조로서 삽입된다.
본 발명은 키메라 항원 수용체 효과기 세포를 활성화하기 위한 스위치 분자, 이에 결합하는 폴리펩타이드 또는 융합단백질, 및 키메라 항원 수용체에 관한 것이다.
B 세포 악성 종양을 가진 환자에서 키메라 항원 수용체 T 세포 (chimeric antigen receptor T cell, CAR-T)에 대한 최근의 임상 연구는 지연된 관해(sustained remission)가 나타남을 입증하였다. CAR는 세포 내 공동자극 도메인(costimulatory domain) 및 활성화 도메인(activation domain)과 결합된 세포 표면에 디스플레이 된 scFv(single chain antibody variable domain)을 통하여 환자-유래 T 세포에 암 세포를 인식하고 제거하는 능력을 부여한다. 항체 인식의 특이성을 T 세포-매개 세포 독성(T cell-mediated cytotoxicity)과 연관시킴으로써 CAR-T 세포는 항원 양성 종양 세포에 대해서 인간 림프구 항원(human lymphocyte antigen, HLA)에 독립적인 방식으로 매우 효과적으로 작용한다. 지금까지 CAR-T는 재발성 급성 림프구성 백혈병(ALL) 환자에서 범-B 세포 항원인 CD19 (CART-19)를 표적으로 함으로써 가장 큰 임상적 성공을 이루었다. CD19 이중특이적(bispecific) 블리나투모맙(blinatumomab)으로 치료에 실패한 환자에게 CART-19를 투여하여 치료에 성공한 사례는 종양에 대한 세포 면역 반응을 향상시키는 유전공학적 접근법의 이점을 입증한다.
초기 단계의 임상 시험에서 인상적인 성공을 거두었음에도 불구하고, 기존의 CAR-T 세포는 생체 내에서의 활성화 및 확장에 대한 제어가 불가하다는 점에서 한계를 가진다. 예를 들어, CAR-T 세포는 환자의 항원 양성 세포와 만났을 때 104 배수까지 급속하게 증식하여 종양 용해 증후군 (tumor lysis syndrome, TLS)과 치명적인 사이토카인 방출 증후군 (cytokine release syndrome, CRS)으로 인한 심각한 증세를 초래한다. 추가적인 합병증은 CAR-T 세포의 항원에 대한 지속적인 활성화(persistent on-target activity)에 의해 야기 될 수 있다. 예를 들어, CART-19의 경우, 조작된 T 세포가 악성 B 세포뿐만 아니라 정상 B 세포를 무차별적으로 죽여 장기간의 B 세포 무형성(B cell aplasia)을 야기한다. 마지막으로, 기존 CAR-T 세포의 고정된 항원특이성은 CART-19 치료를 받는 모든 환자의 10%까지 재발의 근원인 것으로 밝혀진 항원-손실 탈출 돌연변이체(antigen-loss escapte mutant)에 대한 표적화가 배제된다.
따라서, CAR-T 세포의 안전성을 향상시키기 위하여 심각한 독성이 나타나는 경우 CAR-T 세포의 활성을 조절할 수 있고, 항원의 돌연변이가 일어나는 경우 CAR-T 세포와 표적세포 사이의 상호작용을 중재할 수 있는 스위치 분자의 개발에 대한 요구가 점차 증가하고 있다.
본 발명자들은 CAR-T 세포의 활성을 조절할 수 있고, CAR-T 세포와 표적세포 사이의 상호작용을 중개할 수 있는 신규한 스위치 분자를 개발하고자 예의 연구 노력하였다. 그 결과 서로 특이적으로 결합하는 어피바디 쌍(affibody pair, Zb pair)을 스위치 분자와 CAR 수용체로서 사용할 수 있음을 규명함으로써, 본 발명을 완성하게 되었다.
본 발명의 목적은 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule)를 제공하는 것이다.
본 발명의 다른 목적은 (a) 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule) 및 (b) 상기 스위치 분자에 특이적으로 결합하는 폴리펩타이드 또는 융합단백질을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 스위치 분자 또는 융합단백질을 포함하는 키메라 항원 수용체(chimeric antigen receptor, CAR)를 제공하는 것이다.
본 발명은 다음 1 내지 47의 발명을 제공한다.
1. 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule):
(a) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및
(b) 효과기 세포 상에서 키메라 항원 수용체(chimeric antigen receptor, CAR)에 결합하는 폴리펩타이드.
2. 1에 있어서, 상기 (a) 표적화 모이어티는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 스위치 분자.
3. 2에 있어서, 상기 항체는 단일클론항체, 다클론항체, 합성 항체, 인간 항체, 인간화 항체, 단일 도메인 항체, 및 단쇄 가변 단편으로 이루어진 군으로부터 선택된 항체인 것을 특징으로 하는 스위치 분자.
4. 1 내지 3에 있어서, 상기 효과기 세포의 활성화는 표적세포에 대한 세포독성, 사이토카인 분비, 및 이들의 조합인 것을 특징으로 하는 스위치 분자.
5. 1 내지 4에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것을 특징으로 하는 스위치 분자.
6. 1 내지 5에 있어서, 상기 (a) 표적화 모이어티는 HER2 또는 CD19 항원에 특이적으로 결합하는 것을 특징으로 하는 스위치 분자.
7. 1 내지 5에 있어서, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제10서열의 1 내지 58번째 아미노산 서열을 포함하는 타겟 결합 폴리펩타이드인 것을 특징으로 하는 스위치 분자.
8. 1 내지 5에 있어서, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제12서열의 1 내지 243 번째 아미노산 서열을 포함하는 항체 또는 항원결합단편인 것을 특징으로 하는 스위치 분자.
9. 1 내지 5에 있어서, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제14서열의 1 내지 119 번째 아미노산 서열을 중쇄 가변 영역으로서 포함하고, 서열목록 제16서열의 1 내지 107 번째 아미노산 서열을 경쇄 가변영역으로서 포함하는 항체 또는 항원결합단편인 것을 특징으로 하는 스위치 분자.
10. 1 내지 5에 있어서, 상기 (a) 표적화 모이어티는 CD19 항원에 특이적으로 결합하며 서열목록 제18서열의 1 내지 252 번째 아미노산 서열을 포함하는 항체 또는 항원결합단편인 것을 특징으로 하는 스위치 분자.
11. 1 내지 10에 있어서, 상기 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 스위치 분자.
12. 1 내지 11에 있어서, 상기 (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드는 서열목록 제2서열의 1 내지 58 번째 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
13. 1 내지 11에 있어서, 상기 (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드는 서열목록 제4서열의 1 내지 58 번째 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
14. 1에 있어서, 상기 스위치 분자는 서열목록 제10서열의 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
15. 1에 있어서, 상기 스위치 분자는 상기 서열목록 제10서열의 아미노산 서열 중 74-131번째 아미노산 서열이 서열목록 제4서열의 1 내지 58번째 아미노산 서열로 치환된 것을 특징으로 하는 스위치 분자.
16. 1에 있어서, 상기 스위치 분자는 서열목록 제12서열의 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
17. 1에 있어서, 상기 스위치 분자는 상기 서열목록 제12서열의 아미노산 서열 중 259-316번째 아미노산 서열이 서열목록 제4서열의 1 내지 58번째 아미노산 서열로 치환된 것을 특징으로 하는 스위치 분자.
18. 1에 있어서, 상기 스위치 분자는 서열목록 제14서열의 아미노산 서열 및 제16서열의 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
19. 1에 있어서, 상기 스위치 분자는 상기 서열목록 제14서열의 아미노산 서열 중 466-523번째 아미노산 서열이 서열목록 제4서열의 1 내지 58번째 서열로 치환된 것을 특징으로 하는 스위치 분자.
20. 1에 있어서, 상기 스위치 분자는 서열목록 제18서열, 제20서열, 제22서열, 또는 제24서열의 아미노산 서열을 포함하는 것을 특징으로 하는 스위치 분자.
21. 1 내지 20중 어느 하나의 스위치 분자를 포함하는 조성물.
22. 1 내지 20 중 어느 하나의 스위치 분자 및 약제학적으로 허용되는 담체를 포함하는 면역치료용 약제학적 조성물.
23. 다음을 포함하는 복합체:
(a) 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule):
(aa) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및
(bb) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드, 및
(b) 상기 스위치 분자에 특이적으로 결합하는 폴리펩타이드 또는 융합단백질.
24. 23에 있어서, 상기 (a) 스위치 분자는 1 내지 20 중 어느 하나의 스위치 분자인 것을 특징으로 하는 복합체.
25. 23에 있어서, 상기 (aa) 표적화 모이어티는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 복합체.
26. 23에 있어서, 상기 (bb) 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 복합체.
27. 23에 있어서, 상기 (b) 폴리펩타이드 또는 융합단백질은 상기 스위치를 표적화하는 항체, 항체의 항원결합단편, 타겟 결합 폴리펩타이드 또는 이들을 포함하는 키메라 항원 수용체인 것을 특징으로 하는 복합체.
28. (aa) 1 내지 20 중 어느 하나의 스위치 분자를 표적화하는 항체, 항체의 항원결합단편, 또는 타겟 결합 폴리펩타이드를 포함하는 세포외 도메인(extracellular domain);
(bb) 막관통 도메인(transmembrane domain); 및
(cc) 세포내 신호전달 도메인을 포함하는 것을 특징으로 하는 키메라 항원 수용체(chimeric antigen receptor, CAR).
29. 28에 있어서, 상기 세포내 신호전달 도메인은 자극 분자, 보조자극분자의 세포내 신호전달 도메인인 것을 특징으로 하는 키메라 항원 수용체.
30. 28 또는 29에 있어서, 상기 (bb) 막관통 도메인은 T-세포 수용체, CD27, CD28, CD3, 엡실론, CD45, CD4, CD5, CD8(CD8α), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154의 알파, 베타 또는 제타 사슬로 이루어진 군으로부터 선택된 단백질의 막관통 도메인인 것을 특징으로 하는 키메라 항원 수용체.
31. 28 내지 30 중 어느 하나에 있어서, 상기 (cc) 세포내 신호전달 도메인은 CD3ζ(CD3 제타) 사슬로부터 유래된 도메인인 것을 특징으로 하는 키메라 항원 수용체.
32. 28 내지 31 중 어느 하나에 있어서, 상기 (cc) 세포내 신호전달 도메인은 OX40 (CD134), CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 공동자극 분자(costimulatory molecule)를 추가적으로 포함하는 것을 특징으로 하는 키메라 항원 수용체.
33. 키메라 항원 수용체를 발현하는 효과기 세포(effector cell)로서, 상기 키메라 항원 수용체는 1 내지 20 중 어느 하나의 스위치 분자의 (b) 키메라 항원 수용체 결합 폴리펩타이드를 표적화하는 것을 특징으로 하는 효과기 세포.
34. 33에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것을 특징으로 하는 효과기 세포.
35. 34에 있어서, 상기 T 림프구는 염증성 T 림프구, 세포독성 T 림프구, 조절 T 림프구 또는 헬퍼 T 림프구로 이루어진 군으로부터 선택되는 것을 특징으로 하는 효과기 세포.
36. 29 내지 32 중 어느 하나의 키메라 항원 수용체를 발현하는 효과기 세포 및 상기 키메라 항원 수용체와 결합하는 1 내지 20 중 어느 하나의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계를 포함하는 방법.
37. 36에 있어서, 상기 단계에서 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자를 대상체에 추가적으로 투여하는 단계를 포함하는 방법.
38. 36 또는 37에 있어서, 상기 방법은 종양 또는 암과 관련된 질병 또는 상태를 치료하는 방법.
39. 36 또는 37에 있어서, 상기 방법은 자가면역과 관련된 질병 또는 상태를 치료하는 방법.
40. (a) 제 25 항의 키메라 항원 수용체를 발현하는 효과기 세포(CAR-effector cell) 및 상기 키메라 항원 수용체와 결합하는 1 내지 20 중 어느 하나의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계; 및
(b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드를 대상체에 추가적으로 투여하는 단계를 포함하는 대상체 내 CAR-효과기 세포의 활성을 억제하는 방법.
41. 1 내지 20 중 어느 하나의 스위치 분자; 및 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 포함하는 키메라 항원 수용체-효과기 세포 치료 시스템.
42. 1 내지 20 중 어느 하나의 스위치 분자를 코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
43. 23 내지 27 중 어느 하나의 복합체를 코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
44. 28 내지 32 중 어느 하나의 키메라 항원 수용체를 코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
45. 42 내지 44 중 어느 하나의 핵산분자를 포함하는 재조합 벡터.
46. 45의 재조합 벡터로 형질전환된 숙주세포.
47. 46의 숙주세포를 배양하는 단계를 포함하는 방법.
본 발명의 일 양태에 따르면, 본 발명은 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule)를 제공한다:
(a) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및 (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드.
본 발명의 일 구현예에 따르면, 상기 (a) 표적화 모이어티는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 어피바디(affibody)와 같은 타겟 결합 폴리펩타이드(target binding polypeptide)이다.
본 발명의 구체적인 구현예에 따르면, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제10서열의 1 내지 58번째 아미노산 서열을 포함하는 타겟 결합 폴리펩타이드이다. 상기 서열목록 제10서열의 1 내지 58번째 아미노산 서열은 서열목록 제9서열의 1 내지 174번째의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 다른 구체적인 구현예에 따르면, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제12서열의 1 내지 243 번째 아미노산 서열을 포함하는 항체 또는 항원결합단편이다. 상기 서열목록 제12서열의 1 내지 243번째 아미노산 서열은 서열목록 제11서열의 1 내지 729번째의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 구체적인 구현예에 따르면, 상기 (a) 표적화 모이어티는 HER2 항원에 특이적으로 결합하며 서열목록 제14서열의 1 내지 119 번째 아미노산 서열을 중쇄 가변 영역으로서 포함하고, 서열목록 제16서열의 1 내지 107 번째 아미노산 서열을 경쇄 가변영역으로서 포함하는 항체 또는 항원결합단편이다. 상기 서열목록 제14서열의 1 내지 119번째 아미노산 서열은 서열목록 제13서열의 1 내지 357번째의 뉴클레오타이드 서열로 인코딩될 수 있고, 상기 서열목록 제16서열의 1 내지 107번째 아미노산 서열은 서열목록 제15서열의 1 내지 321번째 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
또한, 본 발명의 다른 구현예에 따르면, 본 발명의 상기 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항원 결합 단편, 또는 어피바디(affibody)와 같은 타겟 결합 폴리펩타이드(target binding polypeptide)이다.
본 발명의 구체적인 구현예에 따르면 상기 (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드는 서열목록 제2서열의 1 내지 58 번째 아미노산 서열을 포함하는 타겟 결합 폴리펩타이드이다. 상기 서열목록 제2서열의 1 내지 58번째 아미노산 서열은 서열목록 제1서열의 1 내지 174번째의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 다른 구체적인 구현예에 따르면 상기 (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드는 서열목록 제4서열의 1 내지 58 번째 아미노산 서열을 포함하는 타겟 결합 폴리펩타이드이다. 상기 서열목록 제4서열의 1 내지 58번째 아미노산 서열은 서열목록 제3서열의 1 내지 174번째의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 구체적인 구현예에 따르면, 상기 스위치 분자는 서열목록 제10서열의 아미노산 서열을 포함하는 스위치 분자이고, 상기 서열목록 제10서열의 아미노산 서열 중 74-131번째 아미노산 서열은 서열목록 제4서열의 1 내지 58번째 아미노산 서열로 치환될 수 있다. 상기 서열목록 제10서열의 아미노산 서열은 서열목록 제9서열의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 다른 구체적인 일 구현예에 따르면, 상기 스위치 분자는 서열목록 제12서열의 아미노산 서열을 포함하는 스위치 분자이고, 상기 서열목록 제12서열의 아미노산 서열 중 259-316번째 아미노산 서열은 서열목록 제4서열의 1 내지 58번째 아미노산 서열로 치환될 수 있다. 상기 서열목록 제12서열의 아미노산 서열은 서열목록 제11서열의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
또한, 본 발명의 또 다른 구체적인 일 구현예에 따르면, 상기 스위치 분자는 서열목록 제14서열의 아미노산 서열 및 제16서열의 아미노산 서열을 포함하는 스위치 분자이고, 상기 서열목록 제14서열의 아미노산 서열 중 466-523번째 아미노산 서열은 서열목록 제4서열의 1 내지 58번째 서열로 치환될 수 있다. 상기 서열목록 제14서열 및 제16서열의 아미노산 서열은 서열목록 제13서열 및 제15서열의 뉴클레오타이드 서열로 인코딩될 수 있으나, 이에 한정되는 것은 아니다.
본 명세서에서, 용어 “항체(antibody)”는 특정 항원에 특이적으로 결합하는 항체로서, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다. 완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(κ) 및 람다(λ) 타입을 가진다 (Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA(1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4,pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
본 명세서에서, 상기 항체는 단일클론항체, 다클론항체, 합성 항체, 인간 항체, 인간화 항체, 단일 도메인 항체, 및 단쇄 가변 단편으로 이루어진 군으로부터 선택된 항체를 포함한다.
본 명세서에서, 용어 “항원 결합 단편(antigen binding fragment)”은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab(fragment antigen binding)는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로서, Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chin variable fragment, scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻거나(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고, 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 또는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명의 일 구현예에 따르면, 상기 항체 또는 항원 결합 단편은 구체적으로 Fab, scFv 형태이거나 완전한 항체 형태이다. 또한, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 또는 엡실론(ε) 중의 어느 한 이소타입으로부터 선택될 수 있다. 구체적으로는, 중쇄 불변 영역은 감마1(IgG1), 감마 3(IgG3) 또는 감마 4(IgG4)이고, 가장 구체적으로는 감마 1(IgG1) 이소타입이다. 경쇄 불변 영역은 카파 또는 람다 형일 수 있으며, 구체적으로는 카파형이다. 따라서 본 발명의 항체는 카파(κ) 경쇄와 감마1(γ1) 중쇄를 가지는 Fab, scFv 형태 또는 IgG1 형태이나 반드시 이에 한정되는 것은 아니다.
본 명세서에서, 용어 “중쇄”는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VH 및 3개의 불변 영역 도메인 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한 본 명세서에서 용어 “경쇄”는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 “CDR(complementarity determining region)”은 면역글로블린 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산서열을 의미한다 (Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(CDRH1, CDRH2 및 CDRH3) 및 경쇄(CDRL1, CDRL2 및 CDRL3)에는 각각 3개의 CDRs이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 명세서에서 용어 “인간화 항체”란, 비-인간(예를 들어 쥐) 항체의 비-인간 면역글로불린으로부터 유래된 최소 서열을 함유하는 키메릭 면역글로불린, 그의 면역글로불린 쇄 또는 단편(예를 들어 Fv, Fab, Fab', F(ab')2 또는 항체의 다른 항원-결합 하위서열)이다. 대부분의 경우에, 인간화된 항체는 수용자의 상보성-결정 영역(CDR)의 잔기가, 목적하는 특이성, 친화성 및 능력을 갖는 비-인간 종(공여자 항체), 예를 들어 마우스, 래트 또는 토끼의 CDR의 잔기에 의해 대체된 인간 면역글로불린(수용자 항체)이다. 일부의 경우에, 상기 인간 면역글로불린의 Fv 프레임워크 영역(FR) 잔기는 상응하는 비-인간 잔기에 의해 대체된다. 또한, 인간화된 항체는 수용자 항체에서도 또는 수입된 CDR 또는 프레임워크 서열에서도 발견되지 않는 잔기를 포함할 수 있다. 이러한 변형은 항체 성능을 추가로 개선 및 최적화하기 위해 이루어진다. 일반적으로, 상기 인간화된 항체는 적어도 하나, 및 전형적으로 2개의 실질적으로 모든 가변 도메인을 포함할 것이며, 상기 도메인에서 상기 CDR 영역의 전부 또는 실질적 전부는 비-인간 면역글로불린의 CDR 영역에 상응하고, 상기 FR 영역의 전부 또는 실질적 전부는 인간 면역글로불린의 FR 영역의 서열을 가진다. 상기 인간화된 항체는 면역글로불린 불변 영역(Fc region)의 적어도 일부 내지 실질적인 인간 면역글로불린의 불변 영역(Fc region)서열을 포함한다.
본 명세서에서, 어피바디(Affibody®) 분자는 황색포도상구균 (Staphylococcus aureus)의 단백질 A (Protein A) 중 IgG에 친화성이 있는 부위인 Z-도메인(Z domain)이다. 본 명세서에서 "어피바디(affibody)"는 "Z body" 또는 "Zb"로도 표현된다. 어피바디는 58개의 아미노산 잔기로 이루어진 작은 단백질이다. 이러한 어피바디 분자의 단백질 서열에서 IgG와 결합면을 형성하는 13개의 아미노산은 아미노산 서열에 따라 다양한 타겟 항원에 대한 결합이 가능하며, 무작위적인 배열이 가능하여 라이브러리(library)를 구축할 수 있다. 어피바디 분자는 항체와 유사하게 라이브러리로부터 파아지 디스플레이(phage display), 효모단백질 잡종법(yeast two hybrid, Y2H) 등의 스크리닝 방법을 통해서 다양한 타겟 항원에 대하여 결합할 수 있는 어피바디 분자들을 선별할 수 있다. 타겟 항원과 결합이 가능한 어피바디 분자의 특성을 이용하여 최근 HER2 및 아밀로이드 베타(amyloid-β)에 특이적으로 결합하는 어피바디가 개발된 바 있다(Orlova et al. 2006, Cancer Res., Gronwall et al., 2007, J. Biotechnol.). 또한, 어피바디는 분자량이 6 kDa 으로 매우 작아, 일반적으로 150 kDa의 분자량을 가진 IgG 형태의 항체와 비교하여 인체 투여시 전신적으로 확산되고, 신장여과로 빠르게 제거되는 특징이 있다. 따라서, 어피바디는 주로 진단시료 연구개발에 응용되고 있다(Goldstein R et al., 2013, Expert Rev Anticancer Ther.). 어피바디는 일반 IgG와 결합된 이중항체의 형태 로도 개발되어 지고 있다(Yu F et al., 2014, MAbs). 제1 세대 Z 변이체(Z domain의 변이체)에 기반한 폴리펩티드 스캐폴드에 관한 발명이 PCT 공개공보 WO95/19374에 개시된 바 있고, 제2 세대 Z 변이체에 기반한 폴리펩티드 스캐폴드에 관한 발명이 PCT 공개공보 WO2009/080811에 개시된 바 있다.
본 명세서에서, 용어 "타겟 결합 폴리펩타이드(target binding polypeptide)"는 항체와 같이 타겟 항원 또는 합텐에 대한 결합 친화성을 가지나, 항체와는 구조적으로 관련성이 없는 비면역글로불린 폴리펩타이드 분자를 말한다. 상기 타겟 결합 폴리펩타이드는 항체 유사 분자(antibody-like molecule) 또는 항체유사체(antibody mimetics)라고도 불리우며, 약 150 kDa의 분자량을 가지는 항체와는 달리 일반적으로는 3-20 kDa의 분자량을 가진다. 상기 타겟 결합 폴리펩타이드는 상기한 단백질 A(protein A)의 Z-도메인에서 유래한 어피바디, 감마-B 크리스탈린 또는 유비퀴틴에서 유래한 어필린(Affilin), 시스타틴(cystatin)에서 유래한 어피머(Affimer), Sulfolobus acidocaldarius의 Sac7d로부터 유래한 어피틴(Affitin), 트리플 헬릭스 코일드 코일로부터 유래한 알파바디(Alphabody), 리포칼린(lipocalin)으로부터 유래한 안티칼린(Anticalin), 세포막 수용체의 도메인으로부터 유래한 아비머(Avimer), 안키린 반복 모티프(ankyrin repeat motif)로부터 유래한 DARPin, Fyn의 SH3 도메인으로부터 유래한 피노머(Fynomer), 프로테아제 억제제(protease inhibitor)의 쿠니츠 도메인으로부터 유래한 쿠니츠 도메인 펩타이드(Kunits domain peptide), 피브로넥틴의 10번째 타입 3 도메인(10th type III domain of fibronectin)으로부터 유래한 모노바디(Monobody), Clostridium perfringens의 NagH의 탄수화물 결합 모듈 32-2(carbohydrate binding module 32-2)로부터 유래한 나노클램프(nanoCLAMP) 등을 포함하나, 이에 한정되는 것은 아니다. 상기한 타겟 결합 폴리펩타이드는 파아지 디스플레이, 리보솜 디스플레이 등 당업계에 알려진 다양한 스크리닝 방법을 통하여 임의의 타겟 항원 또는 합텐에 대한 결합친화성을 갖도록 엔지니어링 될 수 있다.
이하에서 사용되는 본 명세서의 용어, "항체", "항원 결합 단편", 및
"타겟 결합 폴리펩타이드"의 정의는 상술한 바와 같다.
본 명세서에서 용어 “암”은 이상 세포의 급속하고 통제되지 않는 성장을 특징으로 하는 질병으로서 정의된다. 암세포는 국소적으로 또는 혈류 및 림프계를 통해 신체의 다른 부분으로 확산될 수 있다. 상기 암은 고형 종양과 비고형 종양(예를 들면 혈액성 종양)을 포함한다.
본 명세서에서 용어 “종양”이란, 양성, 전-암성, 악성 또는 전이성의 조직의 이상 성장을 의미한다.
본 명세서에서, 용어 "타겟 결합 폴리펩타이드(target binding polypeptide)"는 항체와 같이 타겟 항원 또는 합텐에 대한 결합 친화성을 가지나, 항체와는 구조적으로 관련성이 없는 비면역글로불린 폴리펩타이드 분자를 말한다. 상기 타겟 결합 폴리펩타이드는 항체 유사 분자(antibody-like molecule) 또는 항체유사체(antibody mimetics)라고도 불리우며, 약 150 kDa의 분자량을 가지는 항체와는 달리 일반적으로는 3-20 kDa의 분자량을 가진다. 상기 타겟 결합 폴리펩타이드는 상기한 단백질 A(protein A)의 Z-도메인에서 유래한 어피바디, 감마-B 크리스탈린 또는 유비퀴틴에서 유래한 어필린(Affilin), 시스타틴(cystatin)에서 유래한 어피머(Affimer), Sulfolobus acidocaldarius의 Sac7d로부터 유래한 어피틴(Affitin), 트리플 헬릭스 코일드 코일로부터 유래한 알파바디(Alphabody), 리포칼린(lipocalin)으로부터 유래한 안티칼린(Anticalin), 세포막 수용체의 도메인으로부터 유래한 아비머(Avimer), 안키린 반복 모티프(ankyrin repeat motif)로부터 유래한 DARPin, Fyn의 SH3 도메인으로부터 유래한 피노머(Fynomer), 프로테아제 억제제(protease inhibitor)의 쿠니츠 도메인으로부터 유래한 쿠니츠 도메인 펩타이드(Kunits domain peptide), 피브로넥틴의 10번째 타입 3 도메인(10th type III domain of fibronectin)으로부터 유래한 모노바디(Monobody), Clostridium perfringens의 NagH의 탄수화물 결합 모듈 32-2(carbohydrate binding module 32-2)로부터 유래한 나노클램프(nanoCLAMP) 등을 포함하나, 이에 한정되는 것은 아니다. 상기한 타겟 결합 폴리펩타이드는 파아지 디스플레이, 리보솜 디스플레이 등 당업계에 알려진 다양한 스크리닝 방법을 통하여 임의의 타겟 항원 또는 합텐에 대한 결합친화성을 갖도록 엔지니어링 될 수 있다.
이하에서 사용되는 본 명세서의 용어, "항체", "항원 결합 단편", 및
"타겟 결합 폴리펩타이드"의 정의는 상술한 바와 같다.
본 명세서에서 용어 “암”은 이상 세포의 급속하고 통제되지 않는 성장을 특징으로 하는 질병으로서 정의된다. 암세포는 국소적으로 또는 혈류 및 림프계를 통해 신체의 다른 부분으로 확산될 수 있다. 상기 암은 고형 종양과 비고형 종양(예를 들면 혈액성 종양)을 포함한다.
본 명세서에서 용어 “종양”이란, 양성, 전-암성, 악성 또는 전이성의 조직의 이상 성장을 의미한다.
고형 종양은 대개 낭종 또는 액체 영역을 함유하지 않는 조직의 이상 덩어리이다. 고형 종양은 양성 또는 악성일 수 있다. 상이한 유형의 고형 종양은 상기 종양을 형성하는 세포의 유형에 따라 명명된다(예를 들어 육종, 암종 및 림프종). 고형 종양, 예를 들어 육종 및 암종의 예로는 섬유육종(fibrosarcoma), 점액육종(myxosarcoma), 지방육종(liposarcoma), 연골육종(chondrosarcoma), 골육종(osteosarcoma), 및 다른 육종, 활막종(synovioma), 중피종(mesothelioma), 유잉 종양(Ewing's tumor), 평활근육종(leiomyosarcoma), 횡문근육종(rhabdomyosarcoma), 결장 암종(colon carcinoma), 악성 림프구(lymphoid malignancy), 췌장암(pancreaticcancer), 유방암(breast cancer), 폐암(lung cancers), 난소암(ovarian cancer), 전립선암(prostate cancer), 간세포 암종(hepatocellular carcinoma), 편평세포 암종(squamous cell carcinoma), 기저세포 암종(basal cell
carcinoma), 선암종(adenocarcinoma), 땀샘 암종(sweat gland carcinoma), 수질 갑상선 암종(medullary thyroid carcinoma), 유두 갑상선 암종(papillary thyroid carcinoma), 크롬친화세포종 피지선 암종(pheochromocytomas sebaceous gland carcinoma), 유두 암종(papillary carcinoma), 유두 선암종(papillary adenocarcinomas), 수질 암종(medullary carcinoma), 기관지유래 암종(bronchogenic carcinoma), 신세포 암종(renal cell carcinoma), 간세포암(hepatoma), 담관암종(bile duct carcinoma), 융모막암종(choriocarcinoma), 빌름 종양(Wilms' tumor), 자궁경부암(cervical cancer), 고환 종양(testicular tumor), 정상피종(seminoma), 방광 암종(bladder carcinoma), 흑색종(melanoma), 및 CNS 종양 (예를 들어 신경교종(glioma) (예를 들어 뇌간 신경교종(brainstem glioma) 및 혼합 신경교종(mixed gliomas)), 교모세포종(glioblastoma) (또한 다형성 교모세포종(glioblastoma multiforme)으로서 공지됨), 성상세포종(astrocytoma), CNS 림프종(lymphoma), 배아세포종(germinoma), 수모세포종(medulloblastoma), 슈반종(Schwannoma) 두개인두종(craniopharyogioma), 상의세포종(ependymoma), 송과체종(pinealoma), 혈관모세포종(hemangioblastoma), 청신경 종양(acoustic neuroma), 핍지교종(oligodendroglioma), 뇌수막종(menangioma), 신경모세포종(neuroblastoma), 망막모세포종(retinoblastoma) 및 뇌 전이(brain metastases)를 포함한다.
혈액성 종양 또는 혈액암은 혈액 또는 골수의 암이다. 혈액(또는 조혈)암의 예는 백혈병, 예를 들어 급성 백혈병(acute leukemias) (예를 들어 급성 림프구성 백혈병(acute lymphocytic leukemia), 급성 골수구성 백혈병(acute myelocytic leukemia), 급성 골수성 백혈병(acute myelogenous leukemia) 및 골수모구성(myeloblastic), 전골수구성(promyelocytic), 골수단핵구성(myelomonocytic), 단핵구성(monocytic) 및 적백혈병(erythroleukemia), 만성 백혈병(chronic leukemias) (예를 들어 만성 골수구성(chronic myelocytic) (과립구성(granulocytic)) 백혈병, 만성 골수성 백혈병, 및 만성 골수구성 백혈병), 진성 적혈구증가증(polycythemia vera), 림프종(lymphoma), 호지킨병(Hodgkin's disease), 비-호지킨 림프종(non-Hodgkin's lymphoma) (지연성 및 고등급 형태), 다발성 골수종(multiple myeloma), 발덴스트롬 마크로글로불린혈증(Waldenstrom's macroglobulinemia), 중쇄 질병(heavy chain disease), 골수이형성 증후군(myelodysplastic syndrome), 털세포 백혈병(hairy cell leukemia) 및 골수이형성증(myelodysplasia)을 포함한다.
본 명세서에서 용어 “자가면역 질병”이란, 자가면역 반응으로부터 생성되는 질환으로 정의된다. 자가면역 질병은 자기-항원에 대한 부적합하고 과도한 반응의 결과이다. 자가면역 질병의 예는 비제한적으로, 특히 애디슨병(Addision's disease), 원형 탈모증(alopecia areata), 강직성 척추염(ankylosing spondylitis), 자가면역 간염(autoimmune hepatitis), 자가면역 이하선염(autoimmune parotitis), 크론병(Crohn's disease), 당뇨병(diabetes)(I형), 이영양성 수포성 표피 박리증(dystrophic epidermolysis bullosa), 부고환염(epididymitis), 사구체신염(glomerulonephritis), 그레이브스병(Graves' disease), 길랑-바레 증후군(Guillain-Barr syndrome), 하시모토병(Hashimoto's disease), 용혈성 빈혈(hemolytic anemia), 전신 홍반성 루푸스(systemic lupus erythematosus), 다발성 경화증(multiple sclerosis), 중증 근무력증(myasthenia gravis), 심상성 천포창(pemphigus vulgaris), 건선(psoriasis), 류머티스열(rheumatic fever), 류머티스성 관절염(rheumatoid arthritis), 유육종증(sarcoidosis), 경피증(scleroderma), 쇼그렌 증후군(Sjogren's syndrome), 척추관절증(spondyloarthropathies), 갑상선염(thyroiditis), 혈관염(vasculitis), 백반증(vitiligo), 점액수종(myxedema), 악성 빈혈(pernicious anemia), 궤양성 대장염(ulcerative colitis)을 포함한다.
본 명세서에서 용어 “세포독성”이란 세포를 살해하거나 손상시킴을 지칭한다. 본 발명의 일 구현예에 있어서, 활성화된 세포의 타겟 세포에 대한 세포독성은 예를 들면 T 림프구의 증가된 세포용해 활성을 의미한다.
본 발명에서 상기 스위치 분자를 구성하는 (a) 표적화 모이어티와 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 서로 공유결합으로 연결된다. 예를 들면 2 이상의 폴리펩타이드 체인이 재조합 융합단백질(recombinant fused protein)로 발현되는 것을 통해 공유결합에 의해 연결되거나, 또는 화학적 컨쥬게이션(conjugation)에 의해 2 이상의 폴리펩타이드 체인이 연결된 컨쥬게이트(conjugate)의 형태로 구현될 수 있다.
본 발명의 다른 구현예에 따르면, 상기 스위치 분자에서 (a) 표적화 모이어티와 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 직접적으로 연결되거나, 또는 링커(예컨대 아미노산 링커)를 통해 간접적으로 연결될 수 있다.
통상의 기술자라면, 융합 단백질의 제작시 보통 융합하고자 하는 기능적 일부분(moiety) 사이에 링커를 사용하는 것을 포함할 수 있으며, 서로 다른 특성을 가진 다른 종류의 링커, 예를 들어 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커가 있다는 것을 알고 있을 것이다. 링커는 융합단백질의 발현량 증가, 생물학적 활성 향상, 타겟팅을 가능하게 하거나, 약동학을 변경시키기 위한 목적으로, 또는 융합단백질의 안정성을 증가시키고 폴딩(folding)을 향상시키기 위해 사용되어 왔다.
따라서 본 발명의 구체적인 구현예에 따르면, 상기 복합체는 적어도 하나의 링커, 예컨대 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커로부터 선택되는 적어도 하나의 링커를 더 포함할 수 있다. 본 발명의 가장 구체적인 일 구현예에 따르면, 상기 링커는 상기 (a) 표적화 모이어티와 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드의 사이에 배열된다.
본 발명의 구체적인 구현예에 따르면, 상기 스위치 분자의 a) 표적화 모이어티와 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 적어도 하나의 링커로 연결된다.
이 경우 상기 링커는 일반식 (GnSm)p 또는 (SmGn)p로 표시되는 아미노산 서열로 이루어질 수 있다:
여기에서 상기 n, m 및 p는 독립적으로,
n은 1 내지 7 범위의 정수이고;
m은 0 내지 7 범위의 정수이며;
n과 m의 합은 8 이하의 정수이고; 및
p는 1 내지 7 범위의 정수이다.
본 발명의 다른 구체적인 구현예에 따르면, 상기 링커는 n = 1 내지 5이고, m = 0 내지 5이다. 보다 구체적인 구현예의 경우, n = 4이고, m = 1이다. 보다 더 구체적인 구현예의 경우, 상기 링커는 (G4S)3 또는 (S4G)3 이다. 또 다른 구현예의 경우, 상기 링커는 GGGGS이다.
또 다른 구체적인 구현예의 경우, 상기 링커는 VDGS이다. 또 다른 구체적인 구현예의 경우, 상기 링커는 ASGS이다.
본 명세서에서, 상기 스위치 분자를 비롯한 본 명세서에서 발현되는 폴리펩타이드 또는 융합단백질은 폴리펩타이드/융합단백질의 C-말단 및/또는 N-말단에 적어도 하나의 추가적인 아미노산을 포함할 수 있다. 상기의 추가적인 아미노산 잔기는 예를 들어, 생산성, 정제(purification), 생체 내 또는 생체 외에서의 안정화, 복합체의 커플링 또는 검출을 향상시키기 위한 목적으로 개별적 또는 집합적으로 추가될 수 있다. 예컨대 상기 폴리펩타이드 또는 융합단백질은 상기 폴리펩타이드 또는 융합단백질의 C-말단 및/또는 N-말단에 시스테인 잔기를 추가적으로 포함할 수 있다. 추가적인 아미노산 잔기는 정제 또는 폴리펩티드의 검출을 위한 "태그(tag)"를 제공할 수도 있으며, 예를 들어 그 태그는 그 태그와 특이적인 항체와의 상호작용을 위한 것이다. His6 태그의 경우 고정화된 금속 친화성 크로마토그래피(IMAC)를 위하여, His6 태그, (HisGlu)3 태그 ("HEHEHE" tag) 또는 "myc"(c-myc) 태그 또는 "FLAG" 태그와 같은 태그를 제공할 수 있다.
본 발명의 다른 양태에 따르면, 본 발명은 상기한 스위치 분자를 코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공한다.
본 발명의 일 구현예에 있어서, 본 발명의 상기 스위치 분자를 코딩하는 뉴클레오타이드 서열은, 상기 스위치 분자를 구성하는 아미노산 서열을 코딩하는 뉴클레오티드 서열인 것으로 족하며, 어느 특정 뉴클레오티드 서열에 한정되지 않는다는 것은 당업자에게 자명하다. 이는 뉴클레오티드 서열의 변이가 발생하더라도 변이된 뉴클레오타이드 서열을 단백질로 발현하면 단백질 서열에서 변화를 가져오지 않는 경우도 있기 때문이다. 이를 코돈의 축퇴성이라고 한다. 따라서 상기 뉴클레오타이드 서열은 기능적으로 균등한 코돈 또는 동일한 아미노산을 코딩하는 코돈 (예를 들어, 코돈의 축퇴성에 의해, 아르기닌 또는 세린에 대한 코돈은 여섯 개이다), 또는 생물학적으로 균등한 아미노산을 코딩하는 코돈을 포함하는 뉴클레오타이드 서열을 포함한다.
본 명세서에서 용어 "핵산(nucleic acids)"은 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 상기 스위치 분자를 구성하는 아미노산 서열을 코딩하는 본 발명의 핵산 분자는 이와 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60% 이상의 상동성, 보다 구체적으로는 70% 이상의 상동성, 보다 더 구체적으로는 80% 이상의 상동성, 보다 더욱 더 구체적으로는 90% 이상의 상동성, 가장 구체적으로는 95% 이상의 상동성을 나타내는 서열을 의미한다. 서열비교를 위한 얼라인먼트(alignment) 방법은 당업계에 공지되어있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio. 48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있지만, 이에 한정되는 것은 아니다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기한 스위치 분자를 코딩하는 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 숙주 세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터 등을 포함한다.
본 발명의 구체적인 구현예에 따르면, 본 발명의 벡터에서 상기 스위치 분자를 코딩하는 핵산 분자는 상기 벡터의 프로모터와 작동적으로 결합(operatively linked)되어 있다.
본 명세서에서, 용어 "작동적으로 결합된"은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 유전자 클로닝을 위한 벡터 또는 단백질의 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스,의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 이들은 일반적으로 전사 종결 서열로서 폴리아데닐화 서열을 갖는다.
본 발명의 벡터는 그로부터 발현되는 폴리펩타이드 또는 단백질의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.
한편, 본 발명의 발현 벡터는 선택표지로서, 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 제네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기 재조합 벡터로 형질전환 된 숙주세포를 제공한다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 있으며, 어떠한 숙주 세포도 이용할 수 있다. 예컨대, 상기 벡터의 적합한 진핵세포 숙주 세포는 원숭이 신장 세포7(COS7: monkey kidney cells), NSO 세포, SP2/0, 차이니즈 햄스터 난소(CHO: Chinese hamster ovary) 세포, W138, 어린 햄스터 신장(BHK: baby hamster kidney) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK-293 세포를 포함하나 이에 한정되지 않는다.
본 명세서에서 용어 "형질전환된", "형질도입된" 또는 "형질감염된”은 외인성 핵산이 숙주세포 내로 전달되거나 도입되는 과정을 지칭한다. "형질전환된”, "형질도입된" 또는 "형질감염된" 세포는 외인성 핵산으로 형질전환, 형질도입 또는 형질감염된 세포이며, 상기 세포는 당해 세포 및 그의 계대 배양으로 인한 자손 세포를 포함한다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기한 스위치 분자를 포함하는 조성물을 제공한다.
본 발명의 일 구현예에 따르면, 상기 조성물은 상기한 스위치 분자 및 약제학적으로 허용되는 담체를 포함하는 면역치료용 약제학적 조성물이다.
본 명세서에서 "면역치료(immunotherapy)"란, 면역체계가 암을 제거하도록 돕는 암의 치료방법이다. 면역치료는 능동적 면역치료와 수동적 면역치료로 구분된다. 능동적 면역치료는 i) 암세포 또는 암세포에 의해 생성된 물질을 인체에 주입하여 면역체계를 활성화시키는 암 백신 치료(cancer vaccine therapy), ii) 사이토카인(인터페론, 인터류킨 등), 성장인자 등 면역조절제(immune-modulating agents)를 투여하여 특정 백혈구를 활성화시키는 면역조절 치료를 포함한다. 수동적 면역치료는 특정 암세포에 결합하는 치료적 항체(therapeutic antibody)와 면역세포치료(immune cell therapy)를 포함한다. 면역세포치료는 구체적으로 수지상세포 백신 치료(dendritic cell vaccine therapy)와 CAR-T(chimeric antigen receptor T cell) 치료, NK 세포 치료(natural killer cell therapy), CTL 치료(cytotoxic T lymphocyte therapy), 입양 세포 전이(adoptive cell transfer) 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명에서 면역치료는 주로 상술한 면역세포치료를 의미한다.
본 발명의 약제학적 조성물은 표적세포의 세포표면 분자에 결합하는 표적화 모이어티를 포함하는 스위치 분자를 포함하므로, 표적화 모이어티의 표적항원의 조작이 가능하여 다양한 질환의 예방 또는 치료에 효과적이다.
상기 표적화 모이어티가 결합하는 표적 항원은 4-1BB, 5T4, 선암종 항원, 알파-태아단백질, BAFF, B 림프종 세포, C242 항원, CA-125, 탄산 탈수 효소 9(CA-IX), C-MET, CCR4, CD152, CD19, CD20, CD200, CD22, CD221, CD23(IgE 수용체), CD28, CD30(TNFRSF8), CD33, CD4, CD40, CD44 v6, CD51, CD52, CD56, CD74, CD80, CEA, CNT0888, CTLA-4, DR5, EGFR, EpCAM, CD3, FAP, 피브로넥틴 여분 도메인-B, 엽산염 수용체 1, GD2, GD3 강글리오사이드, 당단백 75, GPNMB, HER2/neu, HGF, 인간 산란 인자 수용체 키나아제, IGF-1 수용체, IGF-I, IgG1, LI-CAM, IL-13, IL-6, 인슐린 유사 성장 인자 I 수용체, 인테그린 α5β1, 인테그린 αvβ3, MORAb-009, MS4A1, MUC1, 뮤신 CanAg, N-글리콜일뉴라민산, NPC-1C, PDGF-Ra, PDL192, 포스파티딜세린, 전립선 암종 세포, RANKL, RON, ROR1, SCH900105, SDC1, SLAMF7, TAG-72, 테나신 C, TGF 베타 2, TGF-베타, TRAIL-R1, TRAIL-R2, 종양 항원 CTAA16.88, VEGF-A, VEGFR-1, VEGFR2 및 비멘틴을 포함하는 군으로 선택될 수 있으나, 반드시 여기에 한정되는 것은 아니다.
상기 표적화 모이어티가 특이적으로 결합하는 표적 항원이 CD19인 경우, 본 발명의 약제학적 조성물을 사용하여 치료할 수 있는 질환은 CD19를 발현하는 세포와 연관된 인간 및 포유동물의 질환이다. 구체적으로 상기 질환은 만성 림프구성 백혈병(chronic lymphocytic leukemia, CLL), 급성 림프구성 백혈병 (acute lymphocytic leukemia, ALL), 전림프구성 백혈병(pro- lymphocytic leukemia), 털세포 백혈병(hairy cell leukemia), 일반 급성 림프구성 백혈병(common acute lymphocytic leukemia, CALLA), Null-acute lymphoblastic leukemia, 비-호지킨 림프종, 미만성 거대 B세포 림프종(diffuse large B cell lymphoma, DLBCL), 다발성 골수종, 여포 림프종(follicular lymphoma), 비장 림프종(splenic lymphoma), 변연부 림프종(marginal zone lymphoma), 외투세포 림프종(mantle cell lymphoma), 저위험군 B 세포 림프종(indolent B cell lymphoma), 호지킨 림프종(Hodgkin lymphoma)으로 이루어진 군으로부터 선택된 B 세포 악성종양(B cell malignancy)을 포함한다. 또한 상기 질환은 부적절하거나 증강된 B 세포수 및/또는 활성화와 연관된 자가면역 질환 및 염증 질환을 포함한다. 상기 자가면역 질환 및 염증질환의 예로는 다발성 경화증, 류마티스성 관절염 및 전신성 홍반성 루푸스 (systemic lupus erythematosus, SLE) 등를 포함한다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 예컨대 정맥내 주입, 피하 주입, 피내 주입, 근육내 주입, 복강내 주입, 흉골 내 주입, 종양 내 주입, 국소 투여, 비내 투여, 뇌내 투여, 두개골 내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있으나 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.0001-100 ㎎/㎏이다. 본 명세서에서 용어 "약제학적 유효량"은 상술한 질환을 예방 또는 치료하는 데 충분한 양을 의미한다.
본 명세서에서 용어 “예방”은 질환 또는 질환 상태의 방지 또는 보호적인 치료를 의미한다. 본 명세서에서 용어 “치료”는 질환상태의 감소, 억제, 진정 또는 근절을 의미한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 약제학적 조성물은 또한 상술한 스위치 분자 이외에 다른 약제학적 활성 약제 또는 약물, 예를 들어, 아스파라기나제, 부설판, 카보플라틴, 시스플라틴, 다우노루비신, 독소루비신, 플루오로우라실, 겜시타빈, 하이드록시우레아, 메토트렉세이트, 파클리탁셀, 리툭시맙, 빈블라스틴, 빈크리스틴 등의 화학치료제를 포함할 수 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 다음을 포함하는 복합체를 제공한다:
(a) 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule):
(aa) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및
(bb) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드, 및
(b) 상기 스위치 분자에 특이적으로 결합하는(표적화하는) 폴리펩타이드 또는 융합단백질.
본 발명의 일 구현예에 따르면, 상기 (aa) 표적화 모이어티와 상기 (bb) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 어피바디(affibody)와 같은 타겟 결합 폴리펩타이드(target binding polypeptide)이며, 상기 (b) 폴리펩타이드 또는 융합단백질 또한 상기 스위치 분자를 표적화하는 항체, 항체의 항원결합단편, 어피바디와 같은 타겟 결합 폴리펩타이드이거나, 또는 이들을 포함하는 키메라 항원 수용체이다.
또한, 본 발명의 다른 일 양태에 따르면, 본 발명은 (a) 상술한 스위치 분자를 표적화하는 항체, 항체의 항원결합단편, 또는 어피바디와 같은 타겟 결합 폴리펩타이드를 포함하는 세포외 도메인(extracellular domain); (b) 막관통 도메인(transmembrane domain); 및 (c) 세포내 신호전달 도메인을 포함하는 것을 특징으로 하는 키메라 항원 수용체(chimeric antigen receptor, CAR)를 제공한다.
또한 본 발명의 또 다른 일 양태에 따르면, 본 발명은 (a) 상술한 본 발명의 스위치 분자, 및 (b) 상술한 본 발명의 스위치 분자를 표적화하는 키메라 항원 수용체를 포함하는 CAR-효과기 세포 치료적 시스템을 제공한다.
본 발명의 따른 CAR-효과기 세포 치료적 시스템을 이용하면, 특정 암세포의 표면 항원(e.g. CD19)에 특이적으로 결합하는 스위치 분자, 및 (b) 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포(e.g. T 세포, 수지상 세포)를 투여가 필요한 환자에게 투여하여 암(e.g. CD19 발현과 관련된 세포의 암)을 치료할 수 있다.
본 명세서에서, 용어 “키메라 항원 수용체(chimeric antigen receptor, CAR)”는 효과기 세포 신호전달 또는 효과기세포 활성화 도메인(e.g. T-세포 신호전달 또는 T-세포 활성화 도메인)에 연결된 타겟 결합 도메인(e.g. 단일쇄 가변 단편(scFv))을 포함하는 인공적으로 제작된 하이브리드 단백질(융합 단백질) 또는 폴리펩타이드이다. 키메라 항원 수용체는 일반적으로 단일클론항체의 항원-결합 성질을 이용하여 비-MHC-제한 방식으로, 선택된 표적에 대한 T-세포 특이성 및 반응성을 재유도하는 능력을 갖는다. 비-MHC-제한된 항원 인식은 CAR을 발현하는 T-세포에게 항원 처리와 무관하게 항원을 인식하는 능력을 제공하여, 종양 도피의 주요 메카니즘을 회피시킨다. 또한, CAR은 T-세포에서 발현될 때, 유리하게는 내재성 T-세포 수용체(TCR) 알파 및 베타 사슬과 이량체화되지 않는다.
본 발명의 키메라 항원 수용체는 스위처블 키메라 항원 수용체(switchable chimeric antigen receptor, sCAR)이다. 일반적인 종래의 클래식 키메라 항원 수용체(classical chimeric antigen receptor)의 세포외 도메인은 특정 항원(예컨대, HER2 항원, CD19 항원 등 종양관련항원(tumor associated antigen, TAA))을 표적화하는 항체 또는 항원결합단편을 포함한다. 그러나 본 발명의 키메라 항원 수용체의 세포외 도메인은 항체, 항체의 항원결합단편, 또는 타겟 결합 폴리펩타이드를 포함한다. 또한 상기 세포외 도메인이 포함하는 항체, 항체의 항원결합단편, 또는 타겟 결합 폴리펩타이드는 직접적으로 표적세포의 세포표면 항원을 표적화하는 것이 아니라, 상술한 스위치 분자(구체적으로는 스위치 분자의 CAR 결합 폴리펩타이드)를 표적화한다.
본 발명의 일 실시예에 따르면, 본 발명의 키메라 항원 수용체는 Zb1(제1서열, 제2서열) 또는 Zb2(제3서열, 제4서열)를 인식하는 Zb2 또는 Zb1을 포함하여 스위치 분자의 CAR 결합 폴리펩타이드를 표적화할 수 있다.
본 발명의 일 구현예에 있어서, 상기 세포내 신호전달 도메인은 자극 분자, 보조자극 분자의 세포내 신호전달 도메인으로서, 상기 CAR가 발현되는 세포의 활성화를 담당한다.
상기 세포내 신호전달 도메인은 비제한적으로 TCR, CD3 제타, CD3 감마, CD3 델타, CD3 입실론, CD86, 통상적인 FcR 감마, FcR 베타 (Fc 입실론 R1b), CD79a, CD79b, Fc감마 RIIa, DAP10, DAP12, T 세포 수용체(TCR), CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, 림프구 기능-관련 항원-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, CD83과 특이적으로 결합하는 리간드, CDS, ICAM-1, GITR, BAFFR, HVEM(LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8알파, CD8베타, IL2R 베타, IL2R 감마, IL7R 알파, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96, CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, 본 명세서에 기재된 다른 공동자극 분자, 이들의 임의의 유도체, 변이체 또는 단편, 동일한 기능상 능력을 갖는 공동자극 분자의 임의의 합성 서열, 및 이들의 임의의 조합을 포함한다.
본 발명의 일 구현예에 따르면, 상기 (bb) 막관통 도메인은 T-세포 수용체, CD27, CD28, CD3, 엡실론, CD45, CD4, CD5, CD8(CD8α), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154의 알파, 베타 또는 제타 사슬로 이루어진 군으로부터 선택된 단백질의 막관통 도메인이다.
또한, 본 발명의 구체적인 구현예에 따르면, 상기 (cc) 세포내 신호전달 도메인은 CD3ζ(CD3 제타) 사슬로부터 유래된 도메인이다.
본 발명의 또 다른 구체적인 구현예에 따르면, 상기 (cc) 세포내 신호전달 도메인은 OX40 (CD134), CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 공동자극 분자(costimulatory molecule)를 추가적으로 포함할 수 있다. 상기 세포내 신호전달 도메인은 상술한 도메인 외에도 당해 분야에서 공지된 다른 세포내 신호전달 분자로부터 수득되거나 유래될 수 있고, 세포내 신호전달 도메인이 유래되는 분자의 전체 또는 그의 단편을 포함할 수 있다.
본 발명의 키메라 항원 수용체의 막관통 도메인 및 세포내 신호전달 도메인은 상술한 구체적인 막관통 도메인 및 세포내 신호전달 도메인들 중 1 이상 선택된 조합으로 포함될 수 있다. 예를 들어 본 발명의 키메라 항원 수용체는 CD8α 막관통 도메인 및 CD28 및 CD3ζ의 세포내 신호전달 도메인을 포함할 수 있다.
본 명세서에서 “스위치 분자(switch molecule)”는 상기 키메라 항원 수용체를 이용한 T 세포 치료제, 즉 CAR-T라고 불리는 세포치료제에 있어서, CAR의 타겟 인식 도메인과, CAR의 세포 시그널링 도메인을 분리하고, 이를 매개하는 어댑터 분자(adptor molecule)를 의미한다. 스위치 분자는 Heterogenous target, 또는 resistant tumor에 대해서 CAR의 타겟을 교체하거나, CAR를 발현하는 세포의 과도한 활성화로 인해 부작용 발생시, 스위치 분자의 투여를 통한 CAR 세포의 활성 감소를 가능케 한다(Cao et al., Angew Chem Int Ed Engl. 2016 June 20; 55(26): 7520-7524.).
본 발명의 또 다른 일 양태에 따르면, 본 발명은 키메라 항원 수용체를 발현하는 효과기 세포(effector cell)로서, 상기 키메라 항원 수용체는 상술한 스위치 분자의 (b) 키메라 항원 수용체 결합 폴리펩타이드(예컨대, 어피바디 분자)를 표적화하는 것을 특징으로 하는 효과기 세포를 제공한다.
또한 본 발명의 또 다른 일 양태에 따르면, 본 발명은 다음을 포함하는 CAR-효과기 세포 치료적 시스템을 제공한다:
(a) 상술한 본 발명의 스위치 분자, 및 (b) 상술한 본 발명의 스위치 분자를 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포.
본 발명에 따른 CAR-효과기 세포 치료적 시스템을 이용하면, 예를 들면 특정 암세포의 표면 항원(e.g. CD19)에 특이적으로 결합하는 스위치 분자, 및 (b) 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포(e.g. T 세포, 수지상 세포)를 투여가 필요한 환자에게 투여하여 암을 치료할 수 있다.
본 발명의 일 구현예에 따르면, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택된다.
본 발명의 구체적인 구현예에 따르면, 상기 T 림프구는 염증성 T 림프구, 세포독성 T 림프구, 조절 T 림프구 또는 헬퍼 T 림프구로 이루어진 군으로부터 선택될 수 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기의 키메라 항원 수용체를 발현하는 효과기 세포; 및 상기 키메라 항원 수용체와 결합하는 스위치 분자를 치료가 필요한 대상체에 투여하는 단계를 포함하는 방법을 제공한다.
본 발명의 일 구현예에 있어서, 상기 방법은 종양 또는 암과 관련된 질병 또는 상태를 치료하는 방법이다.
본 발명의 다른 일 구현예에 있어서, 상기 방법은 자가면역과 관련된 질병 또는 상태를 치료하는 방법이다.
본 발명의 일 구현예에 따르면, 상기 종양 또는 암과 관련된 질병 또는 상태의 치료방법은 대상체에 먼저 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자를 대상체에 추가적으로 투여하는 단계를 포함한다.
CAR-T를 이용한 종양 또는 암과 관련된 질병 또는 상태의 치료 도중, 암 세포의 세포표면 분자에 돌연변이가 생기는 경우에는 기존의 CAR가 돌연변이가 발생한 암 세포를 인식하지 못하므로 치료효과가 감소되거나, 치료가 불가하다. 이 경우, 돌연변이가 발생한 세포의 표면 분자를 표적화하는 신규한 스위치 분자를 대상체에 추가적으로 투여하면 먼저 투여된 스위치 분자를 대체하여 지속적인 암의 치료효과를 기대할 수 있을 것이다.
본 발명의 종양 또는 암과 관련된 질병 또는 상태의 치료방법은 유효성분으로서 상술한 CAR를 발현하는 효과기 세포와, 상기 CAR와 결합하는 스위치 분자를 공통적으로 사용하는 방법이므로 중복되는 내용에 대해서는 본 명세서의 과도한 복잡성을 피하기 위하여 그 기재를 생략한다.
또한, 본 발명의 다른 양태에 따르면, 본 발명은 (a) 상술한 키메라 항원 수용체를 발현하는 효과기 세포(CAR-effector cell) 및 상기 키메라 항원 수용체와 결합하는 본 발명의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계; 및 (b) 대상체에 먼저 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자, 또는 표적화 모이어티 없는 키메라 항원 수용체에 결합하는 폴리펩타이드를 대상체에 추가적으로 투여하는 단계를 포함하는 대상체 내 CAR-효과기 세포의 활성을 억제하는 방법을 제공한다.
CAR-T를 이용한 종양 또는 암과 관련된 질병 또는 상태의 치료 도중, CAR-T 세포의 활성화가 과도해지는 경우 종양 용해 증후군 (tumor lysis syndrome, TLS), 사이토카인 방출 증후군 (cytokine release syndrome, CRS) 등의 합병증이 발생할 수 있으며, 이는 환자에게 치명적이다. 본 발명의 스위치 분자를 이용하는 CAR-효과기 세포 치료 시스템을 이용하는 경우, CAR를 발현하는 효과기 세포가 직접적으로 암 세포의 세포표면 분자를 인식하지 않고, CAR에 결합하는 폴리펩타이드를 포함하는 스위치 분자를 통하여 간접적으로 인식한다. 따라서 대상체에 먼저 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자, 또는 표적화 모이어티 없는 키메라 항원 수용체에 결합하는 폴리펩타이드를 대상체에 추가적으로 투여하면 CAR가 더 이상 기존의 암세포를 표적화하지 못하고, 이것에 의해 CAR-T 세포의 과도한 활성을 억제할 수 있다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
본 발명은 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule)를 제공한다.
본 발명은 또한 (a) 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule) 및 (b) 상기 스위치 분자에 특이적으로 결합하는 폴리펩타이드 또는 융합단백질을 제공한다.
본 발명은 또한 상기 스위치 분자 또는 융합단백질을 포함하는 키메라 항원 수용체(chimeric antigen receptor, CAR)를 제공한다.
(i) 본 발명의 스위치 분자를 이용하는 경우, CAR-T 세포의 안전성 향상시키기 위하여 심각한 독성이 나타나는 경우 표적화 모이어티가 결여된 스위치 분자를 투여함으로써 CAR-T 세포의 활성을 조절할 수 있고, (ii) 항원의 돌연변이가 일어나는 경우, 또는 다양한 암종을 치료하기 위하여 기존의 스위치 분자 대신 돌연변이로 인해 발생한 새로운 항원을 표적화하는 스위치 분자나, 상이한 종양관련 항원(TAA)을 표적화하는 스위치 분자를 환자에 투여함으로써 보다 효과적으로 암을 치료할 수 있다.
도 1은 서로 특이적으로 결합하는 어피바디(Zb)를 His 또는 Fc가 결합된 형태로 생산 후 SDS-PAGE 분석을 통하여 예상 크기로 생산되었음을 나타낸 도이다.
도 2a-2b는 BLI 시험법을 이용하여 Zb1과 Zb2가 특이적으로 결합함을 나타낸 도이다. 도 2a는 스위치 분자를 immobilization한 센서칩에 Zb1-Fc 단백질의 결합을 확인하였으며, 도 2b는 Zb2-Fc 단백질의 결합을 확인한 도이다.
도 3은 HER2를 표적하는 어피바디 (zHER2) 및 IgG 항체 (igHER2)와 Zb1이 결합된 형태의 스위치 분자를 생산하고 SDS-PAGE 분석을 통하여 분석한 도이다.
도 4는 HER2를 표적하는 스위치 분자에 Zb2-Fc가 직접 결합함을 BLI 시험법으로 분석한 결과는 나타낸 도이다.
도 5a-5c는 HER2를 표적하는 스위치 분자와 Zb2-Fc 단백질을 이용하여 HER2 단백질 및 HER2 발현 암세포를 표적할 수 있음을 나타낸 도이다. 도 5a는 BLI 시험법으로 HER2 단백질에 스위치 분자를 통하여 Zb2-Fc가 결합함을 분석한 도이다. 도 5b는 HER2 양성 세포인 OE-19를, 도 5c는 HER2 음성 세포인 MDA-MB-231를 이용하여 스위치 분자와 Zb2-Fc를 이용하여 HER2 양성 세포만을 선택적으로 표적할 수 있음을 나타낸 도이다.
도 6은 CD19을 표적하는 다양한 스위치 분자에 대한 모식도를 나타낸 도이다.
도 7a-7b는 CD19을 표적하는 switch molecule과 어피바디를 이용하여 CD19 발현 암세포를 선택적으로 표적할 수 있음을 나타낸 도이다. 도 7a는 CD19 양성 세포인 Raji를, 도 7b는 CD19 음성 세포인 Jurkat을 이용하여 Zb1 또는 Zb2을 포함하는 스위치 분자를 각각 Zb2-Fc 또는 Zb1-Fc를 이용하여 선택적으로 표적할 수 있음을 나타낸 도이다.
도 8a-8b는 Zb2 어피바디를 포함하는 키메라 항원 수용체를 발현하는 T 세포(Zb2.CART)와 Zb1을 포함하는 HER2 표적 스위치 분자 (zHER2-Zb1)를 이용하여 HER2 양성 세포인 SK-OV3 세포에 대한 HER2 특이적 CAR-T 세포 활성을 나타낸 도이다. SK-OV3 세포와 Zb2.CART 세포를 1:5의 비율로 표시된 스위치 분자(zHER2-Zb1)와 24시간 동안 공동배양하여 활성을 측정하였다. 도 8a는 배양액의 인터페론 감마를 ELISA 시험법으로 측정한 결과이며, 도 8b는 세포생존율을 luminescence 시험법으로 측정하여 세포독성을 확인한 결과이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
본 명세서 전체에 걸쳐, 특정 물질의 농도를 나타내기 위하여 사용되는 "%"는 별도의 언급이 없는 경우, 고체/고체는 (중량/중량) %, 고체/액체는 (중량/부피) %, 그리고 액체/액체는 (부피/부피) %이다.
실시예 1. 스위처블 CAR의 항원결합 부위와 스위치 분자 간의 특이적 결합의 확인(어피바디 사이의 특이적 결합의 확인)
본 발명의 신규한 스위처블 CAR 시스템(switchable chimeric antigen receptor system, sCAR system)은, 종래의 스위처블 CAR 시스템에서 CAR 수용체의 항원결합 부위와, 상기 CAR 수용체의 항원결합부위와 결합하는 스위치 분자로서 어피바디(Affibody; 본 명세서에서는 "Z body", "Zb"로 약칭한다)를 이용한다.
본 발명자들은 상기 CAR 수용체의 항원결합 부위와 CAR 수용체의 항원결합부위와 결합하는 스위치 분자로서 어피바디 쌍(affibody pair)을 이용할 수 있는지 여부를 아래의 실험으로 확인하였다.
본 발명자들은 서로 특이적으로 결합하는 두 종류의 어피바디(Affibody: Zb1, Zb2)에 히스티딘으로 태깅한 단백질(Zb1-His, Zb2-His) 및 Fc 영역을 발현시킨 단백질(Zb1-Fc, Zb2-Fc)을 각각 박테리얼 세포와 동물세포를 이용하여 제작하고 이들 사이의 결합을 BioLayer Interferometry (BLI) 분석법으로 확인하였다.
서열번호 명칭 종류 서열(5'->3')
1 Zb1-His 뉴클레오타이드 GTCGATAACAAATTCAACAAAGAGCTGGGCTGGGCTACCTGGGAGATTTTTAATCTTCCGAATTTAAACGGTGTTCAAGTGAAAGCTTTTATCGATAGCCTGCGCGACGATCCTAGCCAGAGCGCAAATTTGCTGGCCGAAGCAAAAAAACTGAATGATGCGCAGGCGCCAAAGCTCGAGCACCACCACCACCACCAC
2 아미노산 VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPKLEHHHHHH
3 Zb2-His 뉴클레오타이드 GTCGATAACAAATTCAACAAAGAGCGCGTAATTGCAATCGGTGAAATTATGCGTCTGCCAAACCTGAATAGCCTGCAGGTTGTGGCCTTTATAAACTCTCTGCGCGATGACCCGAGTCAGTCAGCAAACCTGCTTGCGGAAGCGAAAAAGCTGAATGATGCCCAAGCTCCTAAACTCGAGCACCACCACCACCACCAC
4 아미노산 VDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPKLEHHHHHH
5 Zb1-Fc 뉴클레오타이드 GTCGATAACAAATTCAACAAAGAGCTGGGCTGGGCTACCTGGGAGATTTTTAATCTTCCGAATTTAAACGGTGTTCAAGTGAAAGCTTTTATCGATAGCCTGCGCGACGATCCTAGCCAGAGCGCAAATTTGCTGGCCGAAGCAAAAAAACTGAATGATGCGCAGGCGCCAAAGGGCCAGGCCGGCCAGGAGCCCAAATCTAGCGACAAAACTCACACAAGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCCCCGGGTAAA
6 아미노산 VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPKGQAGQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
7 Zb2-Fc 뉴클레오타이드 GTCGATAACAAATTCAACAAAGAGCGCGTAATTGCAATCGGTGAAATTATGCGTCTGCCAAACCTGAATAGCCTGCAGGTTGTGGCCTTTATAAACTCTCTGCGCGATGACCCGAGTCAGTCAGCAAACCTGCTTGCGGAAGCGAAAAAGCTGAATGATGCCCAAGCTCCTAAAGGCCAGGCCGGCCAGGAGCCCAAATCTAGCGACAAAACTCACACAAGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCCCCGGGTAAA
8 아미노산 VDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPKGQAGQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
구체적으로 Zb1-His(서열목록 제1서열, 제2서열) 및 Zb2-His(제3서열, 제4서열) 유전자를 pET21a(Novagen, Cat No. 69740-3)에 NcoI과 XhoI 제한효소를 이용하여 클로닝하였다. 클로닝된 벡터를 BL21(DE3) Competent cell(Novagen, Cat No. 69450)에 형질전환(transformation)시키고 1 mM IPTG(LPS solution, Cat No. IPTG025)를 이용하여 발현시켰다. 배양된 세포의 세포질로부터 Zb-His 단백질을 Ni-NTA 레진(Qiagen, Cat No. 30410)을 이용하여 정제하였다. Zb1-Fc(제5서열, 제6서열) 및 Zb2-Fc(제7서열, 제8서열) 유전자를 pCEP4 벡터 (Invitrogen, Cat. No. V044-50)에 SfiI 제한효소를 이용하여 클로닝하였다. 이어 FreeStyle 293F(Invitroen, Cat. No. R790-07) 세포에 폴리에틸렌이민(Polyscience Inc, Cat. No. 23966)을 이용하여 상기 클로닝된 벡터를 일시 형질전환(transient transfection)시키고, 세포 배양액으로부터 protein-A ceramic HyperD F 레진(PALL, Cat. No. 20078-028)를 이용하여 정제하였다. 정제된 단백질을 Protein assay dye(Bio-Rad, Cat. No. 500-0006)를 이용하여 정량하고 SDS-PAGE 후 쿠마시 블루 염색을 통하여 크기 및 순도를 확인하였다(도 1). 도 1에 나타낸 바와 같이, Zb-His 및 Zb-Fc 단백질 모두 예상되는 크기인 7.3 kDa, 32.5 kDa로 발현됨을 확인하였다.또한, Zb1과 Zb2 사이의 특이적 결합을 Octet QKe(PallForteBio, Cat. No. 30-5046)기기를 이용한 BLI 분석법을 이용하여 확인하였다. AR2G 센서칩(Fortebio, Cat. No. 18-5093)에 Zb1-His, Zb2-His, Zb1-Fc, Zb2-Fc 단백질을 10 mg/mL의 농도로 EDC/NHS를 이용한 아민 커플링 방법으로 고정시켰다. Zb 단백질이 고정된 센서칩에 Zb1-Fc 또는 Zb2-Fc 단백질을 10 mg/mL의 농도로 15분 동안 결합시켰다 (도 2a 및 도 2b). 도 2a 및 도 2b에 나타낸 바와 같이, Zb1-Fc 단백질은 Zb2-His 및 Zb2-Fc 단백질에 결합하였고, Zb2-Fc 단백질은 Zb1-His 및 Zb1-Fc 단백질에 결합하였다. 따라서 서로 특이적으로 결합하는 어피바디 쌍(Affibody pair; 예를 들면, 상기 Zb1 및 Zb2)은 본 발명의 CAR 수용체의 항원결합 부위와, CAR 수용체의 항원결합부위와 결합하는 스위치 분자로서 유용하게 사용될 수 있다.
실시예 2. 어피바디(Affibody, Zb)를 이용한 HER2 표적화 스위치 분자의 제조
본 발명의 스위처블 CAR 시스템은 특정 암세포를 표적화하는 어피바디(Affibody, Zb)를 포함하는 스위치 분자 및 상기 스위치 분자와 특이적으로 결합하는 어피바디를 포함하는 CAR 수용체를 이용한다.
본 발명자들은 어피바디(e.g. Zb1)를 포함하는 3종의 HER2-표적화 스위치 분자(HER2-targeting switch molecule)를 제조하고, 스위치 분자와 어피바디 분자(CAR의 항원결합 부위) 간의 결합 및 스위치 분자-어피바디 복합체(스위치 분자 및 CAR)의 표적화 여부를 확인하였다.
실시예 2-1. HER2-표적화 3종 스위치 분자의 제조
HER2를 표적하는 어피바디(zHER2), HER2를 표적하는 트라스투주맙(trastuzumab)의 scFv(scHER2), IgG 형태의 항체(igHER2)에 Zb1을 결합한 스위치 분자인 zHER2-Zb1, scHER2-Zb1, igHER2-Zb1를 각각 클로닝하고 생산하였다.
서열번호 명칭 종류 서열(5'->3')
9 zHER2-(S4G)3-Zb1 뉴클레오타이드 GTTGACAACAAGTTTAACAAGGAAATGCGTAACGCGTACTGGGAAATTGCCCTGCTGCCAAATCTGAATAACCAGCAGAAACGTGCTTTCATCCGCAGCCTGTATGACGATCCTAGCCAGAGCGCCAATCTGCTTGCTGAGGCAAAAAAATTGAATGATGCGCAAGCACCGAAATcatcaagcagtggaagttcttcatccggctcatcatcttcaggtgtcgataacaaattcaacaaagagctgggctgggctacctgggagatttttaatcttccgaatttaaacggtgttcaagtgaaagcttttatcgatagcctgcgcgacgatcctagccagagcgcaaatttgctggccgaagcaaaaaaactgaatgatgcgcaggcgccaaag
10 아미노산 VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPKSSSSGSSSSGSSSSGVDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
11 scHER2-(S4G)3-Zb1 뉴클레오타이드 GACATTCAGATGACGCAGTCACCATCGTCGTTGTCAGCGTCGGTAGGTGATCGCGTCACGATTACCTGTCGTGCATCCCAAGATGTGAACACTGCAGTAGCGTGGTACCAGCAGAAACCGGGGAAAGCTCCGAAACTTCTGATTTACTCGGCGAGTTTCCTGTATAGTGGCGTTCCAAGTCGCTTTAGCGGTTCCCGTTCTGGCACGGATTTCACACTGACCATCTCAAGCTTGCAGCCGGAAGATTTTGCCACCTATTACTGCCAACAGCACTATACCACTCCTCCGACCTTTGGCCAAGGCACCAAAGTGGAGATCAAACGCGGCGGAGGTGGTAGTGGTGGCGGTGGGTCTGGCGGCGGTGGGAGCGAAGTGCAGCTGGTCGAATCGGGTGGCGGATTAGTGCAGCCTGGAGGCTCCTTACGCCTGAGCTGTGCAGCGAGCGGCTTCAACATCAAGGACACCTACATACATTGGGTTCGCCAAGCTCCGGGCAAAGGTCTGGAGTGGGTTGCTCGTATCTATCCCACTAATGGGTATACACGCTATGCCGATAGCGTGAAAGGCCGGTTTACCATTAGCGCCGATACGAGCAAGAATACGGCGTATCTGCAGATGAACTCTCTGCGTGCCGAAGATACAGCGGTCTACTACTGCTCTCGTTGGGGTGGTGACGGGTTTTATGCAATGGACTATTGGGGCCAAGGAACCCTCGTGACGGTTTCCTCATcatcaagcagtggaagttcttcatccggctcatcatcttcaggtgtcgataacaaattcaacaaagagctgggctgggctacctgggagatttttaatcttccgaatttaaacggtgttcaagtgaaagcttttatcgatagcctgcgcgacgatcctagccagagcgcaaatttgctggccgaagcaaaaaaactgaatgatgcgcaggcgccaaag
12 아미노산 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSSSSGSSSSGSSSSGVDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
13 igHER2-(S4G)3-Zb1의 중쇄 뉴클레오타이드 AGGCCAAGGGCCAGCCCCGCGAGCCTCAGGTGTACACACTGCCCCCCAGCCGGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTCAAGGGCTTCTACCCCTCCGACATTGCCGTGGAATGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCATTCTTCCTGTACTCCAAGCTGACCGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCTCCTGCTCTGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGAGCCCCGGCAAGTcatcaagcagtggaagttcttcatccggctcatcatcttcaggtgtcgataacaaattcaacaaagagctgggctgggctacctgggagatttttaatcttccgaatttaaacggtgttcaagtgaaagcttttatcgatagcctgcgcgacgatcctagccagagcgcaaatttgctggccgaagcaaaaaaactgaatgatgcgcaggcgccaaag
14 아미노산 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSSSSGSSSSGSSSSGVDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
15 igHER2-(S4G)3-Zb1의 경쇄 뉴클레오타이드 GACATCCAGATGACCCAGTCCCCCTCCAGCCTGTCTGCCTCTGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGACGTGAACACCGCCGTGGCTTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACTCCGCCTCCTTCCTGTACTCCGGCGTGCCCTCCAGATTCTCCGGCTCCAGATCTGGCACCGACTTCACCCTGACCATCTCCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGCACTACACCACCCCCCCTACCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCTTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCTGTCGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
16 아미노산 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
HER2를 표적하는 부위와 Zb1은 (G4S)3링커를 이용하여 연결하였다. zHER2-Zb1과 scHER2-Zb1은 정제를 위하여 C-말단에 His tag을 포함시켰다. zHER2-Zb1과 scHER2-Zb1은 상기 실시예 1의 방법과 같이, 박테리아에서 발현 후 Ni-NTA 레진을 이용하여 정제하였다. igHER2-Zb1는 동물세포에서 발현 후 protein-A 레진을 이용하여 정제하였다. 정제된 단백질을 SDS-PAGE를 이용하여 예상 크기(Zb1-His 7.3 kDa; zHER2-Zb1 14.4 kDa; scHER2-Zb1 49.5 kDa; igHER2-Zb1의 중쇄사슬 57.5 kDa)로 생성되었음을 확인하였다(도 3).
실시예 2-2. HER2 표적화 3종 스위치 분자와 어피바디 분자( 스위처블 CAR의 항원결합 부위)의 결합
본 발명자들은 상기 실시예 2-1에서 제작한 어피바디를 포함하는 3종의 스위치 분자(zHER2-Zb1, scHER2-Zb1, igHER2-Zb1)와 상기 스위치 분자의 어피바디(Zb1)에 특이적으로 결합하는 어피바디(e.g. Zb2)의 결합여부를 확인하였다. 어피바디(Zb1)를 포함하는 3종의 스위치 분자(zHER2-Zb1, scHER2-Zb1, igHER2-Zb1)와, 짝지어진 어피바디 분자(Zb2)가 특이적으로 결합하는 경우, 서로 특이적으로 결합하는 어피바디 쌍(affibody pair)을 각각 CAR의 항원결합 부위 및 CAR의 항원결합부위와 결합하는 스위치 분자로서 포함하는 스위처블 CAR 시스템을 제작할 수 있다.
어피바디(Zb1)를 포함하는 스위치 분자에 대한 어피바디(Zb2)의 결합능력은 BLI 분석법을 이용하여 확인하였다. 먼저 실시예 1과 같은 방법으로 AR2G 센서칩에 스위치 분자(zHER2-Zb1, scHER2-Zb1, igHER2-Zb1)를 200 nM의 농도로 EDC/NHS를 이용한 아민 커플링 방법으로 고정시켰다. 스위치 분자 단백질이 고정된 센서칩에 Zb2-Fc 단백질을 200 nM의 농도로 15 분 동안 결합시켰다. Zb1-His 단백질은 양성대조군으로, 소혈청 알부민(bovine serum albumin, BSA)은 음성대조군으로 사용하였다. 결과는 도 4에 나타내었다.
도 4에 나타낸 바와 같이, Zb2-Fc 단백질은 Zb1을 포함하는 3종의 스위치분자 모두에 특이적으로 결합함을 확인하였다. 상기 결과로부터 서로 특이적으로 결합하는 어피바디 쌍은, 상기 어피바디 쌍을 각각 CAR의 항원결합 부위 및 CAR의 항원 결합부위와 결합하는 스위치 분자로서 포함하는 스위처블 CAR 시스템에 유용하게 사용될 수 있음을 알 수 있다.
실시예 2-3. HER2 표적화 3종 스위치 분자와 어피바디 복합체의 표적화 능력
서로 특이적으로 결합하는 어피바디 쌍을 스위치 분자와 스위치 분자를 인식하는 CAR로 사용할 수 있는지 여부를 확인하고자, 본 발명의 어피바디를 포함하는 스위치 분자(e.g. zHER2-Zb1, scHER2-Zb1, 및 igHER2-Zb1)와, 상기 스위치 분자의 어피바디에 특이적으로 결합하는 어피바디를 포함하는 단백질(e.g. Zb2-Fc)이 결합된 복합체가 특정 단백질(e.g. HER2 단백질)을 표적할 수 있는지를 BLI 분석법을 이용하여 확인하였다. AR2G 센서칩에 hHER2-ECD-His (human HER2 extracellular domain-His tag) 단백질을 10 mg/mL의 농도로 고정화(immobilization)하고 스위치 분자를 1 mM의 농도로 15분 동안 결합시키고, 추가로 15분간 HER2 단백질과 스위치 분자 사이의 결합을 안정화 시켰다. 안정화 이후, Zb2-Fc-Biotin를 1 mg/mL의 농도로 처리하여 15분 동안 결합시켰다(도 5a). Zb2-Fc 단백질의 비오티닐화(biotinylation)는 EZ-Link sulfo-NHS-LC-Biotin (Thermo Fisher Scientific, Cat. No. 21335)를 이용하여 제작되었다. 상기 결과로부터, 본 발명의 어피바디 쌍(Affibody pair, Zb pair)을 각각 스위치 분자와 CAR의 항원결합 부위로 이용하여 HER2 단백질을 표적할 수 있음을 확인하였다.
또한, HER2를 표적하는 어피바디를 포함하는 상기 스위치 분자(e.g. zHER2-Zb1, scHER2-Zb1, 및 igHER2-Zb1)와 상기 어피바디에 특이적으로 결합하는 어피바디를 포함하는 단백질(e.g. Zb2-Fc)이 결합된 복합체가 HER2 양성 암세포를 선택적으로 표적할 수 있는지를 유세포분석법(flow cytometry)으로 확인하였다. HER2-양성 세포로는 OE-19(ECACC, Cat. No. 96071721)을 사용하였고, HER2-음성 세포로는 MDA-MB-231(한국세포주은행, Cat. No. 30026)를 사용하였다. 정제된 1 mM의 3종 스위치 분자(zHER2-Zb1, scHER2-Zb1, 및 igHER2-Zb1)를 5x105개의 OE-19와 MDA-MB-231 세포에 각각 처리하고, 추가로 1 mg/mL의 Zb2-Fc-Biotin를 결합시켰다. Zb2-Fc-Biotin에 결합하는 Avidin-FITC(Thermo Fisher Scientific, Cat. No. 29994)를 이용하여 염색하였다. 세포에 대한 결합 여부는 Cytomics FC 500(Beckman Coulter)을 이용하여 측정하였다(도 5b 및 도 5c). 도 5B와 5C에 나타낸 바와 같이, 본 발명의 어피바디를 포함하는 스위치 분자와 이에 대응하는 어피바디(Zb) 단백질을 이용하여 HER2 양성 암세포만을 특이적으로 표적할 수 있음을 확인하였다.
실시예 3. 어피바디를 이용한 CD19 표적화 스위치 분자의 제조
B 세포 유래 암종의 마커인 CD19을 인지하는 항체(항원 결합 단편, scFv)와 본 발명의 어피바디를 이용하여 CD19-양성 암세포를 표적할 수 있는지 확인하였다. 이와 함께 스위치 분자를 개발함에 있어 암 마커를 표적하는 부위와 어피바디를 연결하는 링커의 종류에 따른 결합 특성 및 어피바디 종류에 따른 표적 능력의 차이를 확인하였다. 대한민국 특허출원 제10-2017-0178559호에서 기 발명된 CD19 표적 항체를 scFv 형태로 제작하고, 이를 상술한 어피바디 Zb1(제1서열, 제2서열) 또는 Zb2(제3서열, 제4서열)와 (G4S)3 링커 또는 (S4G)3 링커로 연결된 스위치 분자를 제작하였으며, 정제를 위하여 His tag을 C-말단에 연결하였다 (도 6).
서열번호 명칭 종류 서열(5'->3')
17 scCD19-(S4G)3-Zb1 뉴클레오타이드 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCGATTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATTATGATGGTTCGGCTAAGTATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGGTCCTAATTTTTGTAATGATCGGACTTGTTCTTATTATTATGCTATGGACGTCTGGGGCCAGGGTACACTGGTCACCGTGAGCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGATCCGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTATGGTCAGCCGTCTAATATTGGCAGTAATGCTGTCTACTGGTACCAGCAGCTACCAGGAACGGCCCCCAAACTCCTCATCTATGATGATAATCATCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTACCTGGGATTATAGCCTGAGTGGTTATGTCTTAGGCGGAGGCACCAAGCTGACGGTCCTATCATCAAGCAGTGGAAGTTCTTCATCCGGCTCATCATCTTCAGGTGTCGATAACAAATTCAACAAAGAGCTGGGCTGGGCTACCTGGGAGATTTTTAATCTTCCGAATTTAAACGGTGTTCAAGTGAAAGCTTTTATCGATAGCCTGCGCGACGATCCTAGCCAGAGCGCAAATTTGCTGGCCGAAGCAAAAAAACTGAATGATGCGCAGGCGCCAAAG
18 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSGIYYDGSAKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPNFCNDRTCSYYYAMDVWGQGTLVTVSSGGGGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCYGQPSNIGSNAVYWYQQLPGTAPKLLIYDDNHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLSSSSGSSSSGSSSSGVDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
19 scCD19-(G4S)3-Zb1 뉴클레오타이드 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCGATTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATTATGATGGTTCGGCTAAGTATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGGTCCTAATTTTTGTAATGATCGGACTTGTTCTTATTATTATGCTATGGACGTCTGGGGCCAGGGTACACTGGTCACCGTGAGCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGATCCGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTATGGTCAGCCGTCTAATATTGGCAGTAATGCTGTCTACTGGTACCAGCAGCTACCAGGAACGGCCCCCAAACTCCTCATCTATGATGATAATCATCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTACCTGGGATTATAGCCTGAGTGGTTATGTCTTAGGCGGAGGCACCAAGCTGACGGTCCTAGGTGGAGGTGGTAGTGGTGGTGGTGGTAGTGGTGGTGGAGGTAGTGTCGATAACAAATTCAACAAAGAGCTGGGCTGGGCTACCTGGGAGATTTTTAATCTTCCGAATTTAAACGGTGTTCAAGTGAAAGCTTTTATCGATAGCCTGCGCGACGATCCTAGCCAGAGCGCAAATTTGCTGGCCGAAGCAAAAAAACTGAATGATGCGCAGGCGCCAAAG
20 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSGIYYDGSAKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPNFCNDRTCSYYYAMDVWGQGTLVTVSSGGGGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCYGQPSNIGSNAVYWYQQLPGTAPKLLIYDDNHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLGGGGSGGGGSGGGGSVDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
21 scCD19-(S4G)3-Zb2 뉴클레오타이드 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCGATTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATTATGATGGTTCGGCTAAGTATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGGTCCTAATTTTTGTAATGATCGGACTTGTTCTTATTATTATGCTATGGACGTCTGGGGCCAGGGTACACTGGTCACCGTGAGCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGATCCGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTATGGTCAGCCGTCTAATATTGGCAGTAATGCTGTCTACTGGTACCAGCAGCTACCAGGAACGGCCCCCAAACTCCTCATCTATGATGATAATCATCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTACCTGGGATTATAGCCTGAGTGGTTATGTCTTAGGCGGAGGCACCAAGCTGACGGTCCTATCATCAAGCAGTGGAAGTTCTTCATCCGGCTCATCATCTTCAGGTGTCGATAACAAATTCAACAAAGAGCGCGTAATTGCAATCGGTGAAATTATGCGTCTGCCAAACCTGAATAGCCTGCAGGTTGTGGCCTTTATAAACTCTCTGCGCGATGACCCGAGTCAGTCAGCAAACCTGCTTGCGGAAGCGAAAAAGCTGAATGATGCCCAAGCTCCTAAA
22 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSGIYYDGSAKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPNFCNDRTCSYYYAMDVWGQGTLVTVSSGGGGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCYGQPSNIGSNAVYWYQQLPGTAPKLLIYDDNHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLSSSSGSSSSGSSSSGVDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPK
23 scCD19-(G4S)3-Zb2 뉴클레오타이드 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCGATTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATTATGATGGTTCGGCTAAGTATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGGTCCTAATTTTTGTAATGATCGGACTTGTTCTTATTATTATGCTATGGACGTCTGGGGCCAGGGTACACTGGTCACCGTGAGCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGATCCGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTATGGTCAGCCGTCTAATATTGGCAGTAATGCTGTCTACTGGTACCAGCAGCTACCAGGAACGGCCCCCAAACTCCTCATCTATGATGATAATCATCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTACCTGGGATTATAGCCTGAGTGGTTATGTCTTAGGCGGAGGCACCAAGCTGACGGTCCTAGGTGGAGGTGGTAGTGGTGGTGGTGGTAGTGGTGGTGGAGGTAGTGTCGATAACAAATTCAACAAAGAGCGCGTAATTGCAATCGGTGAAATTATGCGTCTGCCAAACCTGAATAGCCTGCAGGTTGTGGCCTTTATAAACTCTCTGCGCGATGACCCGAGTCAGTCAGCAAACCTGCTTGCGGAAGCGAAAAAGCTGAATGATGCCCAAGCTCCTAAA
24 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSGIYYDGSAKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPNFCNDRTCSYYYAMDVWGQGTLVTVSSGGGGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCYGQPSNIGSNAVYWYQQLPGTAPKLLIYDDNHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLGGGGSGGGGSGGGGSVDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPK
상기 스위치 분자들은 실시예 1에서와 같이 박테리아에서 발현시켰으며 Ni-NTA 레진을 이용하여 정제하였다. CD19 발현 암세포 표적화 여부를 확인하기 위하여, CD19 양성 암세포인 Raji 세포(ATCC, CCL-86)와 CD19 음성 세포인 Jurkat 세포(ATCC, TIB-152)를 이용하여 제작된 스위치 분자들과 어피바디 단백질을 결합시킨 후, 유세포 분석법(flow cytometry)으로 확인하였다. CD19-양성 암세포인 Raji 및 CD19-음성 세포인 Jurkat 세포에 2 mg의 스위치 분자들[scCD19-(S4G)3-Zb1, scCD19-(G4S)3-Zb1, scCD19-(S4G)3-Zb2, 및 scCD19-(G4S)3-Zb2]을 결합시키고, 이후 Zb1-Fc 또는 Zb2-Fc를 결합시켰으며, anti-hIgG-FITC(Invitrogen, Cat. No. A11013)를 이용하여 검출하였다(도 7a 및 도 7b). 도 7a 및 도 7b에 나타낸 바와 같이, CD19를 표적화 하는 scFv 및 서로 다른 어피바디(Zb1 또는 Zb2)를 포함하는 스위치 분자는 CD19-양성 Raji 세포는 표적하였지만 CD19-음성 Jurkat 세포를 표적하지 않았다. 따라서, 본 발명의 어피바디를 포함하는 CD19-표적화 스위치 분자는 CD19를 특이적으로 표적할 수 있음을 확인하였다.
상기 결과로부터, (a) 항체, 항원결합단편, 또는 어피바디 등 표적 항원에 결합하는 표적화 모이어티(targeting moiety) 및 (b) CAR에 결합하는 폴리펩타이드로서 어피바디를 포함하는 본 발명의 스위치 분자는, 표적화 모이어티(targeting moiety)를 다양하게 교체함으로써 여러 가지 표적 항원에 대해 특이적으로 결합할 수 있음을 알 수 있다. 또한, 본 발명의 스위치 분자는 CAR에 결합하는 폴리펩타이드로서 어피바디의 종류(e.g. Zb1, Zb2) 및 링커의 종류[(S4G)3, (G4S)3]에 관계 없이 모든 조합이 가능함을 알 수 있다.
실시예 4. 어피바디가 연결된 키메라 항원 수용체를 포함하는 렌티바이러스의 제작
Zb1과 Zb2 어피바디 조합을 이용하여 개발된 키메라 항원 수용체 T 세포와 스위치 분자를 이용하여 제조된 CAR-T 세포의 사이토카인 분비 활성 및 목표 세포에 대한 세포독성을 확인하기 위해서 Zb2를 포함하는 키메라 항원 수용체를 개발하였다. 키메라 항원 수용체는 CD8 리더, Zb2, CD8 힌지 및 막관통 영역, CD137 세포질 영역, 및 CD3제타의 세포질 영역으로 구성되었다. 키메라 항원 수용체에 대한 코돈 최적화한 후 프로모터가 EF-1 alpha로 변경된 pLenti6.3/V5-TOPO 렌티바이러스 벡터 (Invitrogen, K5315-20)에 SpeI/PacI으로 절단 및 결착시켰다. 제조된 컨스트럭트는 염기서열 분석을 통해 확인하였다.
서열번호 명칭 종류 서열(5'->3')
25 Codon-optimized Zb2 뉴클레오타이드 GTCGATAACAAATTCAATAAGGAACGCGTGATTGCCATTGGCGAGATCATGCGCCTGCCCAATCTGAATAGCTTGCAGGTGGTGGCCTTTATCAACTCCCTTCGGGATGACCCATCACAGTCTGCCAACCTCCTGGCTGAGGCAAAGAAGCTCAACGACGCGCAGGCTCCTAAA
26 아미노산 VDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPK
27 CAR construct(CD8 hinge-TM-CD137-CD3z) 뉴클레오타이드 ACCACAACTCCAGCTCCCCGGCCCCCTACCCCTGCACCAACAATCGCCAGCCAGCCTCTGTCCCTGAGACCAGAGGCATGTAGGCCAGCTGCAGGAGGAGCAGTGCATACAAGAGGCCTGGACTTCGCCTGCGATATCTACATTTGGGCTCCTCTGGCAGGAACTTGTGGCGTGCTGCTGCTGTCTCTGGTCATCACCCTGTACTGCAAAAGGGGCCGCAAGAAACTGCTGTATATTTTCAAGCAGCCCTTCATGCGGCCCGTGCAGACCACACAGGAGGAAGACGGGTGCTCCTGTAGATTCCCCGAGGAAGAGGAAGGCGGGTGTGAGCTGCGCGTCAAGTTCAGCCGATCAGCCGATGCTCCTGCATACAAGCAGGGCCAGAATCAGCTGTATAACGAGCTGAATCTGGGGCGCCGAGAGGAATACGACGTGCTGGATAAGCGGAGAGGGAGGGACCCCGAAATGGGAGGCAAACCTAGGCGCAAGAACCCACAGGAGGGACTGTACAATGAACTGCAGAAGGACAAAATGGCCGAGGCTTATTCCGAAATTGGGATGAAAGGAGAGCGACGGAGAGGGAAGGGACACGATGGGCTGTATCAGGGACTGTCTACCGCCACTAAAGATACCTACGACGCTCTGCACATGCAGGCTCTGCCACCTCGCTGA
28 아미노산 TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
29 CD8 leader 아미노산 MALPVTALLLPLALLLHAARP
제조된 렌티바이러스 컨스트럭트를 바이러스 외피 단백질인 VSV-G(vesicular stomatitis indiana virus G protein)를 코딩하는 핵산과 gag, pol 및 rev 유전자를 포함하는 플라스미드인 pCMV-dR8.91과 함께 Lenti-X 293T(Takara Bio Inc., 632180) 세포주에 형질도입시켰다. 형질도입은 리포펙타민 2000(Invitrogen, 11668019)을 사용하여 제조사의 프로토콜대로 수행하였다. 렌티바이러스가 함유된 배양액을 Lenti-X concentrator(Takara Bio Inc., 631232)를 사용하여 농축하여 -80℃에 냉동보관하였다.
실시예 5. 어피바디를 포함하는 키메라 항원 수용체가 표면에 제시된 T 세포의 제조 및 활성 확인
실시예 4에서 제조된 렌티바이러스를 이용하여, Zb2를 포함하는 키메라 항원 수용체가 표면에 제시된 T 세포를 제조하였다. 먼저, 인간 혈액으로부터 T 세포를 Dynabeads™ Human T-Activator CD3/CD28(Thermofisher scientific, 11131D)를 이용하여 분리 및 자극하고, 폴리브렌(Sigma-Aldrich, H9268) 및 상기 렌티바이러스를 상기 세포에 첨가하여 24시간 동안 배양하며 형질도입 시켰다. 이후, IL-2(Gibco, CTP0021)가 포함된 배지로 교체하여 5% CO2, 37℃의 조건에서 배양하였다. 제조된 Zb2를 포함하는 키메라 항원 수용체가 표면에 제시된 T 세포(Zb2.CART cell)를 이용하여 Zb1을 포함하는 스위치 분자를 활용한 암세포 제거 및 사이토카인 분비 활성을 분석하였다.
구체적으로, HER2 양성 세포주인 SK-OV3를 실험에 사용하였다. 먼저, SK-OV3 세포주를 바닥이 둥근 형태의 96-웰 플레이트에 웰 당 3x104개가 되도록 분주하였다. SK-OV3 세포주가 분주된 플레이트에 웰 당 SK-OV3:세포독성 T세포가 1:5의 비율이 되도록 제조한 세포독성 T세포를 첨가하였다. 각각의 웰에 처리하고자 하는 농도의 zHER2-Zb1을 넣고, 5% CO2 및 37℃의 조건으로 24시간 동안 배양하였다. 배양 후, 배지에 분비된 인터페론 감마의 양을 Human IFN-γ ELISA set(BD Bioscience, 555142)를 사용하여 제조사의 프로토콜대로 측정하였고, 세포독성 T세포의 독성 효과를 luminescence 시험법(CytoTox-Glo Cytotoxicity Assay, Promega, G9292)을 통하여 확인하였다.
도 8a에 나타난 바와 같이, 본 발명의 항체 단편을 포함하는 세포독성 T 세포와 SK-OV3가 처리된 실험군에서 zHER2-Zb1의 처리양에 따라 인터페론 감마의 분비가 유의적으로 증가함을 확인하였다.
본 발명의 어피바디인 Zb2를 포함하는 키메라 항원 수용체의 세포 독성 효과는 세포독성 T 세포, SK-OV3 및 zHER2-Zb1를 공동배양 후, CytoTox-Glo Cytotoxicity Assay를 이용하여 확인하였다. SK-OV3 세포만 배양한 웰에서 나오는 시그널을 100%로 하여 lysis 비율을 결정하였다. 본 발명의 Zb2가 포함된 키메라 항원 수용체 T 세포는 zHER2-Zb1이 처리된 실험군에서 세포 독성 효과가 나타나는 것을 확인할 수 있었다 (도 8b). 스위치 분자(zHER2-Zb1)를 처리하지 않은 경우에는 사이토카인 분비 및 세포독성이 나타나지 않았기 때문에 시험에서 보인 CAR-T 세포는 Zb1과 Zb2 어피바디의 조합에 의한 암 세포 표적에 의해 이루어짐을 확인할 수 있다.

Claims (20)

  1. 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule):
    (a) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및
    (b) 효과기 세포 상에서 키메라 항원 수용체(chimeric antigen receptor, CAR)에 결합하는 폴리펩타이드.
  2. 제1항에 있어서, 상기 (a) 표적화 모이어티는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 스위치 분자.
  3. 제1항에 있어서, 상기 효과기 세포의 활성화는 표적세포에 대한 세포독성, 사이토카인 분비, 및 이들의 조합인 것을 특징으로 하는 스위치 분자.
  4. 제1항에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것을 특징으로 하는 효과기 세포.
  5. 제1항에 있어서, 상기 (a) 표적화 모이어티는 HER2 또는 CD19 항원에 특이적으로 결합하는 것을 특징으로 하는 스위치 분자.
  6. 제1항에 있어서, 상기 (b) 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 스위치 분자.
  7. 제1항 내지 제6항 중 어느 한 항의 스위치 분자를 포함하는 조성물.
  8. 제1항 내지 제6항 중 어느 한 항의 스위치 분자 및 약제학적으로 허용되는 담체를 포함하는 면역치료용 약제학적 조성물.
  9. 다음을 포함하는 복합체:
    (a) 다음을 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule):
    (aa) 표적세포 상에서 세포표면 분자에 결합하는 표적화 모이어티(targeting moiety); 및
    (bb) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드, 및
    (b) 상기 스위치 분자에 특이적으로 결합하는 폴리펩타이드 또는 융합단백질.
  10. 제9항에 있어서, 상기 (aa) 표적화 모이어티는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 복합체.
  11. 제9항에 있어서, 상기 (bb) 키메라 항원 수용체에 결합하는 폴리펩타이드는 항체, 항체의 항원결합단편(antigen binding fragment) 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것을 특징으로 하는 복합체.
  12. 제9항에 있어서, 상기 (b) 폴리펩타이드 또는 융합단백질은 상기 스위치를 표적화하는 항체, 항체의 항원결합단편, 타겟 결합 폴리펩타이드 또는 이들을 포함하는 키메라 항원 수용체인 것을 특징으로 하는 복합체.
  13. (aa) 제1항 내지 제6항 중 어느 한 항의 스위치 분자를 표적화하는 항체, 항체의 항원결합단편, 또는 타겟 결합 폴리펩타이드를 포함하는 세포외 도메인(extracellular domain);
    (bb) 막관통 도메인(transmembrane domain); 및
    (cc) 세포내 신호전달 도메인을 포함하는 것을 특징으로 하는 키메라 항원 수용체(chimeric antigen receptor, CAR).
  14. 키메라 항원 수용체를 발현하는 효과기 세포(effector cell)로서, 상기 키메라 항원 수용체는 제1항 내지 제6항 중 어느 한 항의 스위치 분자의 (b) 키메라 항원 수용체 결합 폴리펩타이드를 표적화하는 것을 특징으로 하는 효과기 세포.
  15. 제 13 항에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것을 특징으로 하는 효과기 세포.
  16. 제 13 항의 키메라 항원 수용체를 발현하는 효과기 세포 및 상기 키메라 항원 수용체와 결합하는 제1항 내지 제6항 중 어느 한 항의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계를 포함하는 방법.
  17. 제 16 항에 있어서, 상기 단계에서 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자를 대상체에 추가적으로 투여하는 단계를 포함하는 방법.
  18. 제16항에 있어서, 상기 방법은 종양 또는 암과 관련된 질병 또는 상태를 치료하는 방법.
  19. 제18항에 있어서, 상기 방법은 자가면역과 관련된 질병 또는 상태를 치료하는 방법.
  20. (a) 제13항의 키메라 항원 수용체를 발현하는 효과기 세포(CAR-effector cell) 및 상기 키메라 항원 수용체와 결합하는 제1항 내지 제6항 중 어느 한 항의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계; 및
    (b) 효과기 세포 상에서 키메라 항원 수용체에 결합하는 폴리펩타이드를 대상체에 추가적으로 투여하는 단계를 포함하는 대상체 내 CAR-효과기 세포의 활성을 억제하는 방법.
PCT/KR2019/004720 2018-04-18 2019-04-18 스위치 분자 및 스위처블 키메라 항원 수용체 WO2019203600A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US17/048,739 US11945878B2 (en) 2018-04-18 2019-04-18 Switch molecule and switchable chimeric antigen receptor
CN201980026597.8A CN111989342A (zh) 2018-04-18 2019-04-18 开关分子以及可转换嵌合抗原受体
EP19787870.5A EP3783026A4 (en) 2018-04-18 2019-04-18 SWITCHING MOLECULE AND CHEMERICAL ANTIGENIC RECEIVER
JP2020557989A JP2021517907A (ja) 2018-04-18 2019-04-18 スイッチ分子及びスイッチャブルキメラ抗原受容体

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20180045228 2018-04-18
KR10-2018-0045228 2018-04-18

Publications (1)

Publication Number Publication Date
WO2019203600A1 true WO2019203600A1 (ko) 2019-10-24

Family

ID=68239637

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/004720 WO2019203600A1 (ko) 2018-04-18 2019-04-18 스위치 분자 및 스위처블 키메라 항원 수용체

Country Status (6)

Country Link
US (1) US11945878B2 (ko)
EP (1) EP3783026A4 (ko)
JP (1) JP2021517907A (ko)
KR (2) KR102251028B1 (ko)
CN (1) CN111989342A (ko)
WO (1) WO2019203600A1 (ko)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20210061907A1 (en) * 2017-12-22 2021-03-04 Abclon Inc. Antibody or antigen-binding fragment thereof that specifically recognizes b cell malignancies, chimeric antigen receptor comprising same, and uses thereof
WO2021151119A1 (en) * 2020-01-23 2021-07-29 Exuma Biotech Corp. Chimeric antigen receptors to her2 and methods of use thereof
CN113825772A (zh) * 2020-04-17 2021-12-21 艾克隆株式会社 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114574444B (zh) * 2020-12-01 2024-05-03 达达生物技术(北京)有限公司 自体纤维母细胞在制备抗类风湿关节炎药物中的应用

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1988000649A1 (fr) 1986-07-16 1988-01-28 Systems Water Motor S.N.C. Dispositif d'admission d'eau pour moteurs a combustion interne
WO1988006630A1 (en) 1987-03-02 1988-09-07 Genex Corporation Method for the preparation of binding molecules
WO1988007085A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Process for the purification of recombinant polypeptides
WO1988007086A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
WO1995019374A1 (en) 1994-01-14 1995-07-20 Pharmacia Ab Bacterial receptor structures
WO2009080811A1 (en) 2007-12-21 2009-07-02 Affibody Ab Polypeptide libraries with a predetermined scaffold
KR20160062760A (ko) * 2013-10-15 2016-06-02 더 캘리포니아 인스티튜트 포 바이오메디칼 리써치 펩타이드 키메라 항원 수용체 t 세포 스위치 및 이의 용도
US20180100026A1 (en) * 2015-04-15 2018-04-12 California Institute For Biomedical Research Optimized chimeric receptor t cell switches and uses thereof
KR20180045228A (ko) 2016-10-25 2018-05-04 삼성전자주식회사 전자 장치 및 이의 제어 방법

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX347078B (es) 2010-12-09 2017-04-10 Univ Pennsylvania Uso de celulas t modificadas por receptor de antigeno quimerico para tratar cancer.
US9957330B2 (en) * 2012-12-19 2018-05-01 Affibody Ab Polypeptides
CN110423282B (zh) 2013-02-15 2023-09-08 加利福尼亚大学董事会 嵌合抗原受体及其使用方法
JP6637415B2 (ja) * 2013-10-15 2020-01-29 ザ スクリプス リサーチ インスティテュート キメラ抗原受容体ｔ細胞スイッチおよびその使用
DK3186284T3 (da) * 2014-08-28 2022-05-09 Bioatla Inc Betinget aktive kimæriske antigenreceptorer til modificerede t-celler
ES2688035T3 (es) * 2014-08-29 2018-10-30 Gemoab Monoclonals Gmbh Receptor de antígeno universal que expresa células inmunes para direccionamiento de antígenos múltiples diversos, procedimiento para fabricación del mismo y utilización del mismo para tratamiento de cáncer, infecciones y enfermedades autoinmunes
US10800828B2 (en) * 2015-03-26 2020-10-13 The Scripps Research Institute Switchable non-scFv chimeric receptors, switches, and methods of use thereof to treat cancer
WO2016168773A2 (en) * 2015-04-15 2016-10-20 The California Institute For Biomedical Research Optimized pne-based chimeric receptor t cell switches and uses thereof
JP7208010B2 (ja) 2016-03-29 2023-01-18 ユニバーシティ オブ サザン カリフォルニア 癌を標的とするキメラ抗原受容体

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1988000649A1 (fr) 1986-07-16 1988-01-28 Systems Water Motor S.N.C. Dispositif d'admission d'eau pour moteurs a combustion interne
WO1988006630A1 (en) 1987-03-02 1988-09-07 Genex Corporation Method for the preparation of binding molecules
WO1988007085A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Process for the purification of recombinant polypeptides
WO1988007086A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
WO1995019374A1 (en) 1994-01-14 1995-07-20 Pharmacia Ab Bacterial receptor structures
WO2009080811A1 (en) 2007-12-21 2009-07-02 Affibody Ab Polypeptide libraries with a predetermined scaffold
KR20160062760A (ko) * 2013-10-15 2016-06-02 더 캘리포니아 인스티튜트 포 바이오메디칼 리써치 펩타이드 키메라 항원 수용체 t 세포 스위치 및 이의 용도
US20180100026A1 (en) * 2015-04-15 2018-04-12 California Institute For Biomedical Research Optimized chimeric receptor t cell switches and uses thereof
KR20180045228A (ko) 2016-10-25 2018-05-04 삼성전자주식회사 전자 장치 및 이의 제어 방법

Non-Patent Citations (24)

* Cited by examiner, † Cited by third party
Title
"Cellular and Molecular Immunology", 1991, W. B. SAUNDERS CO, pages: 41 - 50
"Remington's Pharmaceutical Sciences", 1995
ARCANGELI, S. ET AL.: "Switchable chimeric antigen receptor T cells: a novel universal chimeric antigen receptor platform for a safe control of T- cell activation", TRANSLATIONAL CANCER RESEARCH, vol. 5, no. S2, 2016, pages S174 - S177, XP055673479, DOI: 10.21037/tcr.2016.07.23 *
CAO ET AL., ANGEW CHEM INT ED ENGL, vol. 55, no. 26, 20 June 2016 (2016-06-20), pages 7520 - 7524
CORPET ET AL., NUC. ACIDS RES., vol. 16, 1988, pages 10881 - 90
EKLUND, M. ET AL.: "Anti-idiotypic protein domains selected from protein A-based affibody libraries", PROTEINS: STRUCTURE, FUNCTION, AND GENETICS, vol. 48, 2002, pages 454 - 462, XP055649949, DOI: 10.1002/prot.10169 *
GOLDSTEIN R ET AL., EXPERT REV ANTICANCER THER., 2013
GRONWALL ET AL., J. BIOTECHNOL., 2007
HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 - 3
HIGGINSSHARP, GENE, vol. 73, 1988, pages 237 - 44
HUANG ET AL., COMP. APPL. BIOSCI., vol. 8, 1992, pages 155 - 65
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1987, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES
NEEDLEMANWUNSCH, J. MOL. BIO., vol. 48, 1970, pages 443
NISONOFF, A.: "Introduction to Molecular Immunology", 1984, SINAUER ASSOCIATES, INC., pages: 45 - 65
ORLOVA ET AL., CANCER RES., 2006
PEARSON ET AL., METH. MOL. BIOL., vol. 24, pages 307 - 31
PEARSONLIPMAN, METHODS IN MOL. BIOL., vol. 24, 1988, pages 307 - 31
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual,", 2001, COLD SPRING HARBOR LABORATORY PRESS
SCHEIT: "Nucleotide Analogs", 1980, JOHN WILEY
See also references of EP3783026A4
SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
UHLMANPEYMAN, CHEMICAL REVIEWS, vol. 90, 1990, pages 543 - 584
YU F ET AL., MABS, 2014
ZHANG, E. ET AL.: "A new insight in chimeric antigen receptor-engineered T cells for cancer immunotherapy", JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 10, 2017, pages 1 - 11, XP002784908, DOI: 10.1186/s13045-016-0379-6 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20210061907A1 (en) * 2017-12-22 2021-03-04 Abclon Inc. Antibody or antigen-binding fragment thereof that specifically recognizes b cell malignancies, chimeric antigen receptor comprising same, and uses thereof
US11708409B2 (en) * 2017-12-22 2023-07-25 Abclon Inc. Antibody or antigen-binding fragment thereof that specifically recognizes B cell malignancies, chimeric antigen receptor comprising same, and uses thereof
WO2021151119A1 (en) * 2020-01-23 2021-07-29 Exuma Biotech Corp. Chimeric antigen receptors to her2 and methods of use thereof
CN113825772A (zh) * 2020-04-17 2021-12-21 艾克隆株式会社 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体
JP2022532468A (ja) * 2020-04-17 2022-07-15 アブクロン・インコーポレイテッド 抗ｈｅｒ２アフィボディ及びこれをスイッチ分子として用いるスウィチャブルキメラ抗原受容体
JP7237387B2 (ja) 2020-04-17 2023-03-13 アブクロン・インコーポレイテッド 抗ｈｅｒ２アフィボディ及びこれをスイッチ分子として用いるスウィチャブルキメラ抗原受容体
CN113825772B (zh) * 2020-04-17 2024-05-14 艾克隆株式会社 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体

Also Published As

Publication number Publication date
KR20190121716A (ko) 2019-10-28
US11945878B2 (en) 2024-04-02
JP2021517907A (ja) 2021-07-29
US20210130490A1 (en) 2021-05-06
KR102398701B1 (ko) 2022-05-17
EP3783026A1 (en) 2021-02-24
EP3783026A4 (en) 2021-08-11
CN111989342A (zh) 2020-11-24
KR20210058769A (ko) 2021-05-24
KR102251028B1 (ko) 2021-05-12

Similar Documents

Publication Publication Date Title
WO2019203600A1 (ko) 스위치 분자 및 스위처블 키메라 항원 수용체
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2014025199A2 (ko) 스테필로코칼 엔테로톡신 유래의 초항원 변이체 및 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2014025198A2 (ko) Lfa3 변이체 및 상기 변이체 또는 lfa3 cd2 결합영역과 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2019125070A1 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2019078699A2 (ko) 항-vista 항체 및 이의 용도
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2021060914A1 (ko) 항-클라우딘-3 키메라 항원 수용체
WO2022124866A1 (ko) 항-pd-1 항체 및 이의 용도
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2023171958A1 (ko) 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도
WO2024010118A1 (ko) 항 bdca-2 항체 및 이의 용도
WO2024101942A1 (ko) 유전자 조작된 세포 및 이의 용도
WO2021246637A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021060932A1 (ko) 항-c-met 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체, 및 이의 용도
WO2024101962A1 (ko) 유전자 조작된 세포 및 이의 용도
WO2022169269A1 (ko) 항 ctla-4 항체 및 이의 용도
WO2024117777A1 (ko) 면역세포의 면역학적 간극 형성 촉진을 통해 세포용해 활성을 향상시키기 위한 NgR1 단백질의 활성 또는 발현 억제제

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19787870

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2020557989

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019787870

Country of ref document: EP

Effective date: 20201118