WO2021246637A1 - Cd22에 특이적인 항체 및 이의 용도 - Google Patents

Cd22에 특이적인 항체 및 이의 용도 Download PDF

Info

Publication number
WO2021246637A1
WO2021246637A1 PCT/KR2021/004568 KR2021004568W WO2021246637A1 WO 2021246637 A1 WO2021246637 A1 WO 2021246637A1 KR 2021004568 W KR2021004568 W KR 2021004568W WO 2021246637 A1 WO2021246637 A1 WO 2021246637A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
region represented
chain variable
antibody
Prior art date
Application number
PCT/KR2021/004568
Other languages
English (en)
French (fr)
Inventor
김기태
김승구
이병은
Original Assignee
주식회사 이노베이션바이오
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020200169499A external-priority patent/KR102548256B1/ko
Application filed by 주식회사 이노베이션바이오 filed Critical 주식회사 이노베이션바이오
Priority to CN202180039081.4A priority Critical patent/CN115667310A/zh
Priority to US18/000,457 priority patent/US20230212286A1/en
Priority to JP2022573478A priority patent/JP2023527462A/ja
Priority to EP21818442.2A priority patent/EP4159760A1/en
Publication of WO2021246637A1 publication Critical patent/WO2021246637A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411—Immunoglobulin superfamily
    • A61K39/464413—CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70514—CD4
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70532—B7 molecules, e.g. CD80, CD86
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7151—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for tumor necrosis factor [TNF], for lymphotoxin [LT]
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57426—Specifically defined cancers leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/48—Blood cells, e.g. leukemia or lymphoma
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705

Definitions

  • the present invention relates to an antibody specific for CD22 and uses thereof, and more particularly to an antibody that specifically binds to CD22, a chimeric antigen receptor comprising the antibody, a CAR-T cell expressing the chimeric antigen receptor, and It relates to a pharmaceutical composition for preventing or treating diseases mediated by cells expressing CD22, including them.
  • CD22 is a 135 kDa membrane glycoprotein belonging to a family of sialic acid-binding proteins called sialoadhesins. CD22 is detected in the cytoplasm at the beginning of B cell development, appears on the cell surface simultaneously with IgD, and is found in most mature B cells. When B cells are activated, their expression is increased. It has been reported that CD22 is lost at the end of differentiation and is generally absent in plasma cells.
  • CD22 ⁇ immunoglobulin-like domains in the extracellular region.
  • the CD22 ⁇ mutant lacks Ig-like domain 4 and may have a truncated cytoplasmic domain. Antibodies that block the binding of CD22 to monocytes, neutrophils, lymphocytes and erythrocytes have been observed to bind within either the first or second Ig-like domain.
  • CD22 In the cytoplasmic domain of CD22, tyrosine is phosphorylated upon binding to the B-cell antigen receptor and binds to Lyk, Syk and phosphatidylinositol 3-kinase.
  • the function of CD22 is to down-modulate the B cell activation threshold. It can also mediate cell binding through binding to cells containing appropriate sialoglycoconjugates.
  • CD22 includes NHL, acute lymphoblastic leukemia (B-ALL), chronic lymphocytic leukemia (B-CLL) and especially acute non-lymphocytic leukemia (ANLL), It is expressed in most B-cell leukemias and lymphomas.
  • B-ALL acute lymphoblastic leukemia
  • B-CLL chronic lymphocytic leukemia
  • ANLL acute non-lymphocytic leukemia
  • CD22-specific antibodies are being developed.
  • International Patent Publication No. WO1998-041641 discloses a recombinant anti-CD22 antibody having cysteine residues at positions V H 44 and V L 100
  • International Patent Publication No. WO 1998-042378 discloses an antibiotic for the treatment of B-cell malignancies.
  • -CD22 antibody is disclosed.
  • five novel antibodies (1C2, 9E9, 2A9, 2G1 and 6B3) were established by screening an antibody that binds to CD22 in order to develop an antibody that more specifically binds to CD22, and the 5 selected in the present invention It was confirmed that the antibody of the species specifically binds to the CD22 antigen.
  • a chimeric antigen receptor targeting CD22 and CAR-T cells were prepared. ) was confirmed to effectively kill.
  • Another object of the present invention is to provide a polynucleotide encoding the antibody, a vector expressing the antibody, and a recombinant cell transformed with the vector.
  • Another object of the present invention is a chimeric antigen receptor comprising the antibody, a polynucleotide encoding the chimeric antigen receptor targeting CD22, a vector comprising the same, and an immune effector expressing the polynucleotide or the chimeric antigen receptor comprising the vector to provide cells.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating a disease mediated by CD22-expressing cells, including immune effector cells expressing the antibody or chimeric antigen receptor targeting CD22.
  • Another object of the present invention is to provide a composition for diagnosing or monitoring a disease mediated by a cell expressing CD22 comprising the antibody.
  • the present invention relates to (a) a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 1, the CDR2 region represented by the amino acid of SEQ ID NO: 2 and the CDR3 region represented by the amino acid of SEQ ID NO: 3, and the amino acid of SEQ ID NO: 4 a light chain variable region comprising a CDR1 region represented by , a CDR2 region represented by the amino acid of SEQ ID NO: 5, and a CDR3 region represented by the amino acid sequence represented by SEQ ID NO: 6;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 11, the CDR2 region represented by the amino acid of SEQ ID NO: 12 and the CDR3 region represented by the amino acid of SEQ ID NO: 13 and the amino acid of SEQ ID NO: 14 a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 15 and a CDR3 region represented by the amino acid of SEQ ID NO: 16;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 21, the CDR2 region represented by the amino acid of SEQ ID NO: 22 and the CDR3 region represented by the amino acid of SEQ ID NO: 23 and the amino acid of SEQ ID NO: 24 a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 25 and a CDR3 region represented by the amino acid of SEQ ID NO: 26;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 31, the CDR2 region represented by the amino acid of SEQ ID NO: 32 and the CDR3 region represented by the amino acid of SEQ ID NO: 33 and the amino acid of SEQ ID NO: 34 a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 35 and a CDR3 region represented by the amino acid of SEQ ID NO: 36; or
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 41, the CDR2 region represented by the amino acid of SEQ ID NO: 42 and the CDR3 region represented by the amino acid of SEQ ID NO: 43 and the amino acid of SEQ ID NO: 44
  • An antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 45 and a CDR3 region represented by the amino acid of SEQ ID NO: 46 is provided.
  • the antibody may be a monoclonal antibody, preferably a single-chain variable fragment (scFv).
  • scFv single-chain variable fragment
  • the antibody comprises a heavy chain variable region represented by the amino acid of SEQ ID NO: 7 and a light chain variable region represented by the amino acid of SEQ ID NO: 8,
  • the (b) antibody has a heavy chain variable region represented by the amino acid of SEQ ID NO: 17 and a light chain variable region represented by the amino acid of SEQ ID NO: 18,
  • the (c) antibody has a heavy chain variable region represented by the amino acid of SEQ ID NO: 27 and a light chain variable region represented by the amino acid of SEQ ID NO: 28,
  • the (d) antibody has a heavy chain variable region represented by the amino acid of SEQ ID NO: 37 and a light chain variable region represented by the amino acid of SEQ ID NO: 38,
  • the (e) antibody may be composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 47 and a light chain variable region represented by the amino acid of SEQ ID NO: 48.
  • the present invention provides a polynucleotide encoding the antibody that specifically binds to CD22.
  • the present invention provides a vector comprising a polynucleotide encoding the antibody that specifically binds to CD22.
  • the present invention provides a recombinant cell that produces an antibody or fragment thereof that specifically binds to CD22 transformed with the vector.
  • the present invention provides a CD22-binding domain; transmembrane domain; costimulatory domain; And a chimeric antigen receptor (CAR) comprising an intracellular signal transduction domain,
  • the CD22-binding domain may be selected from among antibodies or fragments thereof capable of specifically binding to CD22 of the present invention.
  • the transmembrane domain may be derived from a protein selected from the group consisting of CD8 ⁇ , CD4, CD28, CD137, CD80, CD86, CD152 and PD1.
  • the costimulatory domain may be derived from a protein selected from the group consisting of CD28, 4-1BB, OX-40 and ICOS, and the signaling domain may be derived from CD3 ⁇ .
  • it may further include a hinge region located between the C-terminus of the CD22-binding domain and the N-terminus of the transmembrane domain, wherein the hinge region is CD8 ⁇ may be of origin.
  • the present invention provides a polynucleotide encoding the chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • the present invention also provides a vector comprising a polynucleotide encoding a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • the vector may be a plasmid, a retroviral vector or a lentiviral vector.
  • the present invention provides an immune effector cell comprising the polynucleotide encoding the chimeric antigen receptor (CAR) or a polynucleotide encoding the chimeric antigen receptor (CAR), and expressing the chimeric antigen receptor (CAR) do.
  • CAR chimeric antigen receptor
  • CAR chimeric antigen receptor
  • the immune effector cell may be a T cell.
  • the present invention provides an immune effector cell expressing a chimeric antigen receptor targeting CD22; Or an antibody or fragment thereof that specifically binds to CD22; provides a pharmaceutical composition for preventing or treating a disease mediated by cells expressing CD22, including.
  • the disease mediated by cells expressing CD22 is lymphoma, non-Hogkins lymphoma (NHL), aggressive NHL, relapsed aggressive NHL, relapsed delayed NHL, refractory sexual NHL, refractory delayed NHL, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma, leukemia, hairy cell leukemia (HCL), acute lymphocytic leukemia (ALL) ), Burkitt's lymphoma, and mantle cell lymphoma.
  • NHL non-Hogkins lymphoma
  • aggressive NHL relapsed aggressive NHL
  • relapsed delayed NHL refractory Sexual NHL
  • CLL chronic lymphocytic leukemia
  • small lymphocytic lymphoma small lymphocytic lymphoma
  • leukemia hairy cell leukemia
  • HCL hairy cell leukemia
  • ALL acute lymphocytic leukemia
  • Burkitt's lymphoma and mantle cell lympho
  • the composition may include a therapeutic agent for a disease mediated by cells expressing CD22.
  • the present invention provides a composition for diagnosing or monitoring a disease mediated by cells expressing CD22, including an antibody that specifically binds to CD22.
  • CAR chimeric antigen receptor
  • CAR-T cells targeting CD22 prepared using the established antibody not only effectively bind to CD22, but also activate CAR-T cells that bind to CD22. .
  • the CAR-T cells of the present invention effectively kill CD22-expressing cells, the CD22-specific antibody, the chimeric antigen receptor targeting CD22, and CAR-T cells of the present invention are related to CD22 expression. It can be usefully used as a composition for preventing or treating diseases.
  • 1 is data confirming the binding affinity to CD22 of 1C2, 9E9, 2A9, 2G1 and 6B3 antibodies selected in the present invention by FACS.
  • FIG. 2 is a schematic diagram showing a lentiviral vector expressing a chimeric antigen receptor (CD22-CAR) targeting CD22 and a chimeric antigen receptor expressed in T cells.
  • CD22-CAR chimeric antigen receptor
  • FIG. 3 is a schematic diagram illustrating a method for preparing CD22-CAR-T cells using a lentivirus expressing CD22-CAR.
  • CD22-CAR-T cells prepared using each of 1C2, 9E9, 2G1 and 6B3 antibodies.
  • 5 is data confirming the level of IFN ⁇ expression by CD22-CAR-T cells in the presence of target cells to confirm the activation of CD22-CAR-T cells prepared using each of 1C2, 9E9, 2G1 and 6B3 antibodies. .
  • 6 is data confirming the killing effect of target cells by CD22-CAR-T cells prepared using each of 1C2, 9E9, 2G1 and 6B3 antibodies.
  • the present invention provides an antibody or fragment thereof that specifically binds to CD22,
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 1, the CDR2 region represented by the amino acid of SEQ ID NO: 2 and the CDR3 region represented by the amino acid of SEQ ID NO: 3 and the amino acid of SEQ ID NO: 4 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 5 and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 6;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 11, the CDR2 region represented by the amino acid of SEQ ID NO: 12 and the CDR3 region represented by the amino acid of SEQ ID NO: 13 and the amino acid of SEQ ID NO: 14 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 15 and a CDR3 region represented by the amino acid of SEQ ID NO: 16;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 21, the CDR2 region represented by the amino acid of SEQ ID NO: 22 and the CDR3 region represented by the amino acid of SEQ ID NO: 23 and the amino acid of SEQ ID NO: 24 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 25, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 26;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 31, the CDR2 region represented by the amino acid of SEQ ID NO: 32 and the CDR3 region represented by the amino acid of SEQ ID NO: 33 and the amino acid of SEQ ID NO: 34 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 35, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 36; or
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 41, the CDR2 region represented by the amino acid of SEQ ID NO: 42 and the CDR3 region represented by the amino acid of SEQ ID NO: 43 and the amino acid of SEQ ID NO: 44 It relates to an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 45, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 46.
  • the antibody may be a monoclonal antibody.
  • the term "monoclonal antibody” is also called a monoclonal antibody or monoclonal antibody, and is an antibody produced by a single antibody-forming cell, and has a uniform primary structure (amino acid sequence). It recognizes only one antigenic determinant and is generally produced by culturing a hybridoma cell in which cancer cells and antibody-producing cells are fused. can also be produced.
  • the antibody may be used by humanizing the remaining parts except for the CDR parts, if necessary.
  • CDR complementarity determining region
  • humanized antibody is an antibody that possesses an amino acid sequence corresponding to that of an antibody produced by a human and/or is made using one of the techniques for making human antibodies as disclosed herein. This definition of a humanized antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • an antibody can be used not only in a complete form having two full-length light chains and two full-length heavy chains, but also as a fragment of an antibody molecule.
  • a fragment of an antibody molecule refers to a fragment having at least a peptide tag (epitope) binding function, and includes scFv, Fab, F(ab'), F(ab') 2 , a single domain, and the like.
  • Fab has a structure having variable regions of light and heavy chains, a constant region of a light chain and a first constant region (CH1) of a heavy chain, and has one antigen-binding site.
  • Fab' differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C terminus of the heavy chain CH1 domain.
  • the F(ab')2 antibody is produced by forming a disulfide bond with a cysteine residue in the hinge region of Fab'.
  • Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region. Recombinant technology for generating Fv fragments is described in International Patent Publication Nos.
  • dsFv double chain Fv
  • scFv single chain Fv
  • Such an antibody fragment can be obtained using a proteolytic enzyme (for example, by restriction digestion of the entire antibody with papain, Fab can be obtained, and pepsin digestion to obtain a F(ab')2 fragment), preferably It can be produced through genetic recombination technology.
  • the monoclonal antibody specifically binding to CD22 of the present invention can be prepared by using all or part of the CD22 protein as an immunogen (or antigen). More specifically, first, as an immunogen, CD22, a fusion protein containing CD22 protein, or a carrier containing CD22 protein is prepared with an adjuvant (eg, Freund adjuvant) as an adjuvant (eg, Freund adjuvant), except for humans. Immunization is achieved by subcutaneous, intramuscular, intravenous, intraperitoneal or one or more injections in mammals.
  • an adjuvant eg, Freund adjuvant
  • the mammals other than humans are preferably mice, rats, hamsters, malmots, chickens, rabbits, cats, dogs, pigs, goats, sheep, donkeys, horses or cattle (transgenic mice that produce human antibodies) (including transgenic animals engineered to produce antibodies from other animals such as From the first immunization, immunization is performed 1 to 4 times every 1 to 21 days, and antibody-producing cells can be obtained from the immune-sensitized mammal about 1 to 10 days after the final immunization. The number of times and time intervals for immunization can be appropriately changed depending on the characteristics of the immunogen to be used, and the like.
  • Preparation of a hybridoma secreting a monoclonal antibody can be carried out according to the method of Keira and Mirstein et al. (Nature, 1975, Vol. 256, p. 495-497) and a method similar thereto.
  • Hybridomas can be prepared by cell fusion of myeloma cells of The mammal may be a mouse, rat, malmot, hamster, chicken, rabbit or human, preferably a mouse, rat, chicken or human.
  • a fusion promoter such as polyethylene glycol or Sendai virus, or a method by electric pulse is used, for example, an antibody-producing cell and a mammalian-derived cell that can proliferate indefinitely in a fusion medium containing a fusion promoter. is suspended at a ratio of about 1:1 to 1:10, and in this state, incubated at about 30 to 40° C. for about 1 to 5 minutes.
  • a fusion medium for example, MEM medium, RPMI1640 medium, and Iscove's Modified Dulbecco's Medium may be used, and it is preferable to exclude sera such as bovine serum.
  • the fusion cells obtained as described above are transferred to a selection medium such as HAT medium, and cultured at about 30 to 40° C. for about 3 days to 3 weeks. It kills cells other than hybridomas. Then, after culturing the hybridoma on a microtiter plate, etc., the part with increased reactivity between the immunogen used for the immune response of animals other than humans described above and the culture supernatant was subjected to radioactive substance-marked immunotherapy (RIA). antibody) or ELISA (Enzyme-Linked Immunosorbent Assay). And the clone producing the monoclonal antibody found above shows a specific binding force to the immunogen.
  • a selection medium such as HAT medium
  • the monoclonal antibody of the present invention can be obtained by culturing such a hybridoma in vitro or in vivo.
  • a conventional method for culturing cells derived from mammals is used, and for collecting monoclonal antibodies from a culture or the like, a conventional method in this field for purifying antibodies in general is used. Examples of each method include salting out, dialysis, filtration, concentration, centrifugation, fractional precipitation, gel filtration chromatography, ion exchange chromatography, affinity chromatography, high-performance liquid chromatography, and gel electrophoresis. and isoelectric point electrophoresis and the like, and these are applied in combination as needed. Thereafter, the purified monoclonal antibody is concentrated and dried to obtain a liquid or solid state depending on the intended use.
  • the monoclonal antibody of the present invention comprises DNAs encoding heavy chain and light chain variable regions, respectively, with known DNA encoding heavy chain and light chain constant regions (for example, Japan 2007-252372). No. publication) and each ligated gene is synthesized by PCR or chemical synthesis, and the transformant is obtained by transplanting to a known expression vector (pcDNA 3.1 (sold by Invitrogen)) that enables expression of the gene. It can be obtained by producing an antibody and expressing it in a host such as CHO cells or Escherichia coli, and purifying the antibody from this culture medium using a protein A or G (Protein A or G) column or the like.
  • pcDNA 3.1 sold by Invitrogen
  • a hybridoma producing an anti-CD22 antibody is prepared and screened, and an antibody (scFv) that specifically binds to CD22 5 Species were selected and designated as 1C2, 9E9, 2A9, 2G1 and 6B3, respectively.
  • the 1C2 antibody comprises a CDR1 region represented by the amino acid of SEQ ID NO: 1 (GYTFTSYWMNW), a CDR2 region represented by the amino acid of SEQ ID NO: 2 (IDPSDSET) and a CDR3 region represented by the amino acid of SEQ ID NO: 3 (ARWGNYDYDVWAMDY)
  • a light chain comprising a heavy chain variable region and a CDR1 region represented by the amino acid of SEQ ID NO: 4 (QNIVHLNGNTF), a CDR2 region represented by the amino acid of SEQ ID NO: 5 (KVS), and a CDR3 region represented by the amino acid of SEQ ID NO: 6 (FQGSHVPYT) It was confirmed that it consists of a variable region.
  • the 1C2 antibody is composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 7 and a light chain variable region represented by the amino acid of SEQ ID NO: 8, wherein the heavy chain variable region is the nucleotide sequence of SEQ ID NO: 9, and the light chain variable region is It was confirmed that the nucleotide sequence of SEQ ID NO: 10 is encoded.
  • the 9E9 antibody comprises a CDR1 region represented by the amino acid of SEQ ID NO: 11 (GYAFSIYW), a CDR2 region represented by the amino acid of SEQ ID NO: 12 (IYPGDGDT) and a CDR3 region represented by the amino acid of SEQ ID NO: 13 (ARRGITPWFAY)
  • a light chain comprising a heavy chain variable region and a CDR1 region represented by the amino acid of SEQ ID NO: 14 (QSLLNSSNQKNY), a CDR2 region represented by the amino acid of SEQ ID NO: 15 (FAS) and a CDR3 region represented by the amino acid of SEQ ID NO: 16 (CQQHYSTPLT) It was confirmed that it consists of a variable region.
  • the 9E9 antibody is composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 17 and a light chain variable region represented by the amino acid of SEQ ID NO: 18, the heavy chain variable region is the nucleotide sequence of SEQ ID NO: 19, and the light chain variable region is It was confirmed that it is encoded by the nucleotide sequence of SEQ ID NO: 20.
  • the 2A9 antibody comprises a CDR1 region represented by the amino acid of SEQ ID NO: 21 (GYTFTTYP), a CDR2 region represented by the amino acid of SEQ ID NO: 22 (FHPYNDDT) and a CDR3 region represented by the amino acid of SEQ ID NO: 23 (ARGDYYVSSWYFDV)
  • a light chain comprising a heavy chain variable region and a CDR1 region represented by the amino acid of SEQ ID NO: 24 (QNVGTN), a CDR2 region (SAS) represented by the amino acid of SEQ ID NO: 25 and a CDR3 region represented by the amino acid of SEQ ID NO: 26 (QQYNSYPLT) It was confirmed that it consists of a variable region.
  • the 2A9 antibody is composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 27 and a light chain variable region represented by the amino acid of SEQ ID NO: 28, the heavy chain variable region is the nucleotide sequence of SEQ ID NO: 29, and the light chain variable region is It was confirmed that it is encoded by the nucleotide sequence of SEQ ID NO: 30.
  • the 2G1 antibody comprises a CDR1 region represented by the amino acid of SEQ ID NO: 31 (GFSLTSYDI), a CDR2 region represented by the amino acid of SEQ ID NO: 32 (IWTGGGT) and a CDR3 region represented by the amino acid of SEQ ID NO: 33 (VPHYYGYAMDYW)
  • a light chain comprising a heavy chain variable region and a CDR1 region represented by the amino acid of SEQ ID NO: 34 (QDINKY), a CDR2 region represented by the amino acid of SEQ ID NO: 35 (YTS) and a CDR3 region represented by the amino acid of SEQ ID NO: 36 (LQYDNLLT) It was confirmed that it consists of a variable region.
  • the 2G1 antibody is composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 37 and a light chain variable region represented by the amino acid of SEQ ID NO: 38, wherein the heavy chain variable region is the nucleotide sequence of SEQ ID NO: 39, and the light chain variable region is It was confirmed that the nucleotide sequence of SEQ ID NO: 40 is encoded.
  • the 6B3 antibody comprises a CDR1 region represented by the amino acid of SEQ ID NO: 41 (GYTFTDYN), a CDR2 region represented by the amino acid of SEQ ID NO: 42 (IYPYNGGT) and a CDR3 region represented by the amino acid of SEQ ID NO: 43 (ARLYYYGRTSYWG)
  • a light chain comprising a heavy chain variable region and a CDR1 region represented by the amino acid of SEQ ID NO: 44 (QNVGTY), a CDR2 region (SAS) represented by the amino acid of SEQ ID NO: 45 and a CDR3 region represented by the amino acid of SEQ ID NO: 46 (HQYDSYPYT) It was confirmed that it consists of a variable region.
  • the 6B3 antibody is composed of a heavy chain variable region represented by the amino acid of SEQ ID NO: 47 and a light chain variable region represented by the amino acid of SEQ ID NO: 48, the heavy chain variable region is the nucleotide sequence of SEQ ID NO: 49, and the light chain variable region is It was confirmed that it is encoded by the nucleotide sequence of SEQ ID NO: 50.
  • the CD22-specific antibody of the present invention is preferably scFv (single chain variable fragment), and can be produced through genetic recombination technology so that the heavy chain variable region and the light chain variable region can be linked with a linker.
  • the linker may preferably be represented by the amino acid sequence of SEQ ID NO: 51 or the nucleotide sequence of SEQ ID NO: 52, but is not limited thereto.
  • the 1C2 antibody is the amino acid sequence of SEQ ID NO: 53 or the nucleotide sequence of SEQ ID NO: 54
  • the 9E9 antibody is the amino acid sequence of SEQ ID NO: 55 or the nucleotide sequence of SEQ ID NO: 56
  • the 2A9 antibody is the amino acid sequence of SEQ ID NO: 57 or the nucleotide sequence of SEQ ID NO: 58
  • the 2G1 antibody is the amino acid sequence of SEQ ID NO: 59 or the nucleotide sequence of SEQ ID NO: 60
  • the 6B3 antibody is the amino acid sequence of SEQ ID NO: 61 or the nucleotide sequence of SEQ ID NO: 62 can be displayed as
  • the present invention relates to a polynucleotide encoding the antibody that specifically binds to CD22.
  • polynucleotide generally refers to a nucleic acid molecule, deoxyribonucleotide or ribonucleotide, or an analog thereof, separated by any length.
  • the polynucleotides of the present invention are administered by (1) in-vitro amplification, such as polymerase chain reaction (PCR) amplification; (2) cloning and recombination; (3) purification such as digestion and gel electrophoretic separation; (4) It may be prepared through synthesis such as chemical synthesis, and preferably, the isolated polynucleotide is prepared by recombinant DNA technology.
  • the nucleic acid for encoding the antibody or antigen-binding fragment thereof can be prepared by various methods known in the art, including, but not limited to, restriction fragment operation of synthetic oligonucleotides or application of SOE PCR. can be manufactured.
  • the present invention relates to a vector comprising a polynucleotide encoding an antibody that specifically binds to CD22, and a recombinant cell transformed with the vector.
  • vector refers to a gene product including essential regulatory elements such as a promoter so that a target gene can be expressed in an appropriate host cell.
  • the vector may be selected from one or more of a plasmid, a retroviral vector and a lentiviral vector. Upon transformation into an appropriate host, the vector may replicate and function independently of the host genome, or in some cases may be integrated into the genome itself.
  • the vector may contain expression control elements that allow the coding region to be accurately expressed in a suitable host.
  • regulatory elements include, for example, promoters, ribosome-binding sites, enhancers and other regulatory elements for regulating gene transcription or mRNA translation. can do.
  • the specific structure of the expression control sequence may vary depending on the function of the species or cell type, but generally 5' ratios participating in transcription initiation and translation initiation, respectively, such as TATA box, capped sequence, CAAT sequence, etc. - contains a transcribed sequence, and a 5' or 3' non-translated sequence.
  • a 5' non-transcriptional expression control sequence may include a promoter region that may include a promoter sequence for transcription and control of a functionally linked nucleic acid.
  • promoter means a minimal sequence sufficient to direct transcription.
  • promoter constructs sufficient to allow expression of a regulatable promoter-dependent gene induced by cell type-specific or external signals or agents may be included, and these constructs may be located in the 5' or 3' portion of the gene. . Both conservative and inducible promoters are included.
  • Promoter sequences may be derived from prokaryotes, eukaryotes or viruses.
  • the term "transformant” refers to a cell transformed by introducing a vector having a polynucleotide encoding one or more target proteins into a host cell, and introducing the expression vector into the host cell to prepare a transformant
  • a method for this the calcium phosphate method or the calcium chloride/rubidium chloride method described in the literature (Sambrook, J., et al., Molecular Cloning, A Laboratory Manual (2nd edition), Cold Spring Harbor Laboratory, 1. 74, 1989) , an electroporation method, an electroinjection method, a chemical treatment method such as PEG, a method using a gene gun, or the like.
  • the transformant expressing the vector is cultured in a nutrient medium, it is possible to manufacture and isolate antibody proteins in large quantities.
  • Medium and culture conditions can be appropriately selected and used depending on the host cell. During culture, conditions such as temperature, medium pH, and culture time should be appropriately adjusted to be suitable for cell growth and mass production of proteins.
  • the vector according to the present invention can be transformed into a host cell, preferably a mammalian cell, for the production of an antibody.
  • a host cell preferably a mammalian cell
  • suitable host cell lines capable of expressing fully glycosylated proteins have been developed in the art and include COS-1 (eg ATCC CRL 1650), COS-7 (eg ATCC CRL-1651), HEK293 , BHK21 (eg ATCC CRL-10), CHO (eg ATCC CRL 1610) and BSC-1 (eg ATCC CRL-26) cell lines, Cos-7 cells, CHO cells, hep G2 cells , P3X63Ag8653, SP2/0-Agl4, 293 cells, HeLa cells, etc., which are readily available from, for example, the American Type Culture Collection (ATCC, USA).
  • Preferred host cells include cells of lymphocyte origin, such as melanoma and lymphoma cells.
  • the present invention from another point of view,
  • a chimeric antigen receptor comprising an intracellular signal transduction domain
  • the CD22-binding domain comprises (a) a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 1, the CDR2 region represented by the amino acid of SEQ ID NO: 2 and the CDR3 region represented by the amino acid of SEQ ID NO: 3, and SEQ ID NO: An antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region represented by the amino acid of 4, a CDR2 region represented by the amino acid of SEQ ID NO: 5, and a CDR3 region represented by the amino acid of SEQ ID NO: 6. ;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 11, the CDR2 region represented by the amino acid of SEQ ID NO: 12 and the CDR3 region represented by the amino acid of SEQ ID NO: 13 and the amino acid of SEQ ID NO: 14 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 15 and a CDR3 region represented by the amino acid of SEQ ID NO: 16;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 21, the CDR2 region represented by the amino acid of SEQ ID NO: 22 and the CDR3 region represented by the amino acid of SEQ ID NO: 23 and the amino acid of SEQ ID NO: 24 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 25, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 26;
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 31, the CDR2 region represented by the amino acid of SEQ ID NO: 32 and the CDR3 region represented by the amino acid of SEQ ID NO: 33 and the amino acid of SEQ ID NO: 34 an antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 35, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 36; or
  • a heavy chain variable region comprising the CDR1 region represented by the amino acid of SEQ ID NO: 41, the CDR2 region represented by the amino acid of SEQ ID NO: 42 and the CDR3 region represented by the amino acid of SEQ ID NO: 43 and the amino acid of SEQ ID NO: 44
  • An antibody or fragment thereof that specifically binds to CD22 comprising a light chain variable region comprising a CDR1 region, a CDR2 region represented by the amino acid of SEQ ID NO: 45, and a CDR3 region represented by the amino acid sequence of SEQ ID NO: 46.
  • chimeric antigen receptor generally refers to a fusion protein containing an antigen and an extracellular domain having the ability to bind one or more intracellular domains.
  • a CAR is a key part of a chimeric antigen receptor T cell (CAR-T) and may include an antigen binding domain, a transmembrane domain, a co-stimulatory domain, and an intracellular signaling domain.
  • a CAR can be combined with a T cell receptor-activating intracellular domain based on the antigen (eg, CD22) specificity of the antibody.
  • Genetically modified CAR-expressing T cells can specifically identify and eliminate target antigen-expressing malignant cells.
  • CD22-binding domain generally refers to a domain capable of specifically binding to a CD22 protein.
  • the CD22-binding domain may contain an anti-CD22 antibody or fragment thereof capable of specifically binding to a human CD22 polypeptide or fragment thereof expressed in a B cell.
  • binding domain refers to "extracellular domain”, “extracellular binding domain”, “antigen-specific binding domain” and “Extracellular antigen-specific binding domain” can be used interchangeably and refers to a CAR domain or fragment having the ability to specifically bind a target antigen (eg, CD22). refers to
  • the anti-CD22 antibody or fragment thereof is the above-described anti-CD22 antibody, a monoclonal antibody, preferably a single chain variable fragment (scFv). Specifically, it can be prepared using 1C2, 9E9, 2A9, 2G1 or 6B3 antibody specific for CD22 of the present invention, and 1C2, 9E9, 2G1 or 6B3 antibody is preferably used in the present invention.
  • a signal peptide may be further included at the N-terminus of the CD22-binding domain, and the "signal peptide” generally refers to a peptide chain for guiding protein transduction.
  • the signal peptide may be a short peptide having a length of 5 to 30 amino acids, and the amino acid sequence of SEQ ID NO: 70 was preferably used in the present invention.
  • the present invention may further comprise a hinge region located between the C terminus of the CD22-binding domain and the N terminus of the transmembrane domain, wherein the hinge region is derived from CD8 ⁇ , preferably SEQ ID NO: It can be represented by the amino acid sequence of 71.
  • the "hinge region” generally refers to the linking region between the antigen-binding region and the immune cell Fc receptor (FcR)-binding region.
  • transmembrane domain generally refers to a domain of a CAR that passes through a cell membrane and is connected to an intracellular signaling domain to play a signaling role.
  • the transmembrane domain may be derived from a protein selected from the group consisting of CD8 ⁇ , CD4, CD28, CD137, CD80, CD86, CD152 and PD1, and may preferably be represented by the amino acid sequence of SEQ ID NO: 72.
  • costimulatory domain generally refers to an intracellular domain capable of providing immune-stimulatory molecules, which are cell surface molecules necessary for an effective response of lymphocytes to antigens.
  • the costimulatory domain described above may comprise a costimulatory domain of CD28, and may comprise a costimulatory domain of the TNF receptor family, such as the costimulatory domain of OX40 and 4-1BB, preferably SEQ ID NO: It may be 4-1BB represented by the amino acid sequence of 73.
  • intracellular signal transduction domain generally refers to a domain located inside a cell and capable of transmitting a signal.
  • the intracellular signaling domain is the intracellular signaling domain of the chimeric antigen receptor.
  • the intracellular signaling domain may be selected from CD3 ⁇ intracellular domain, CD28 intracellular domain, CD28 intracellular domain, 4-1BB intracellular domain and OX40 intracellular domain, preferably the amino acid of SEQ ID NO: 74 It may be CD3 ⁇ represented by the sequence.
  • the present invention relates to a polynucleotide encoding the chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • the polynucleotide encoding the chimeric antigen receptor (CAR) comprises a polynucleotide encoding a CD22-binding domain; a polynucleotide encoding a transmembrane domain; polynucleotides coating the co-stimulatory domain; and a polynucleotide encoding an intracellular signaling domain.
  • the polynucleotide encoding the CD22-binding domain may be a polynucleotide encoding a 1C2, 9E9, 2A9, 2G1 or 6B3 antibody specific for CD22 of the present invention, preferably a 1C2, 9E9, 2G1 or 6B3 antibody, and a light chain
  • the specific nucleotide sequence is as described above.
  • the polynucleotide encoding the chimeric antigen receptor (CAR) of the present invention comprises: a signal peptide represented by the nucleotide sequence of SEQ ID NO: 64;
  • transmembrane domain represented by the nucleotide sequence of SEQ ID NO: 66;
  • 4-1BB (costimulatory domain) represented by the nucleotide sequence of SEQ ID NO: 67;
  • CD3 ⁇ intracellular signaling domain
  • a polynucleotide encoding a hinge region may be further included, preferably the CD8 hinge region represented by the nucleotide sequence of SEQ ID NO: 65 can be
  • the present invention relates to a vector comprising a polynucleotide encoding the chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • the vector is a recombinant viral vector, preferably a lentiviral vector, comprising an operably linked EF1 ⁇ promoter; a polynucleotide encoding a signal peptide; a polynucleotide encoding a CD22-binding domain; a polynucleotide encoding a transmembrane domain; It includes a polynucleotide encoding an intracellular signaling domain, and may further include a woodchuck hepatitis virus post-transcriptional regulatory element (WPRE) to increase protein expression ( FIG. 2 ).
  • WPRE woodchuck hepatitis virus post-transcriptional regulatory element
  • the EF1 ⁇ promoter may be represented by the nucleotide sequence of SEQ ID NO: 63, and if necessary, 90% or more, 93% or more, 95% or more, 96% or more, 97% or more, 98% or more of the nucleotide sequence of SEQ ID NO: 63 , or sequences that are at least 99% identical.
  • the promoter is operably linked to drive expression of the CD22-binding domain, anti-CD22 antibody (scFv).
  • Biological methods for introducing polynucleotides into host cells include the use of DNA and RNA vectors.
  • Viral vectors, and in particular retroviral vectors have become the most widely used methods for inserting genes into mammalian, eg, human cells.
  • Other viral vectors may be derived from lentiviruses, poxviruses, herpes simplex viruses, adenoviruses and adeno-associated viruses, and the like.
  • Chemical means for introducing polynucleotides into host cells include colloidal dispersion systems such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-including oil-in-water emulsions, micelles, mixed micelles, and liposomes. including the underlying system.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (eg, an artificial membrane vesicle).
  • Other methods are available for state-of-the-art targeted delivery of nucleic acids, for example, delivery of polynucleotides using targeted nanoparticles or other suitable sub-micrometer-sized delivery systems.
  • an exemplary delivery vehicle is a liposome.
  • lipid preparations is contemplated for the introduction of nucleic acids into host cells (in vitro, ex vivo or in vivo).
  • the nucleic acid may be associated with a lipid.
  • Nucleic acids associated with lipids may be encapsulated within the aqueous interior of the liposome, interspersed within the lipid bilayer of the liposome, attached to the liposome via a linking molecule associated with both the liposome and oligonucleotide, captured within the liposome, complexed with the liposome, or , dispersed in a lipid-containing solution, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with micelles, or otherwise associated with a lipid.
  • the lipid, lipid/DNA or lipid/expression vector association composition is not limited to any particular structure in solution.
  • the present invention comprises a vector comprising a polynucleotide encoding the chimeric antigen receptor (CAR) or a polynucleotide encoding a chimeric antigen receptor (CAR), wherein the chimeric antigen receptor (CAR) It relates to immune effector cells expressing
  • the immune effector cells may be mammalian-derived cells, preferably T cells or natural killer (NK) cells.
  • immune effector cells expressing the chimeric antigen receptor can be prepared by introducing the CAR vector of the present invention into immune effector cells, for example, T cells or NK cells.
  • the CAR vector can be introduced into the cell by methods known in the art, such as electroporation, lipofectamine (lipofectamine 2000, Invitrogen), and the like.
  • immune effector cells can be transfected with a lentiviral vector to integrate the viral genome carrying the CAR molecule into the host genome to ensure long-term and stable expression of the target gene.
  • a transposon can be used to introduce a CAR transport plasmid and a transferase transport plasmid into a target cell.
  • a CAR molecule can be added to the genome by a gene editing method (eg, CRISPR/Cas9).
  • a lentiviral vector into which a polynucleotide coating CD22-CAR was inserted was prepared, and the prepared vector was transformed into T cells to prepare CD22-CAR-T cells. did The prepared CD22-CAR-T cells express a chimeric antigen receptor targeting CD22 of the present invention.
  • Immune effector cells for making immune effector cells expressing a chimeric antigen receptor (CAR) can be obtained from a subject, wherein the "subject” is a living organism (eg, a mammal) in which an immune response can be elicited. includes Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from numerous sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from the site of infection, ascites, pleural effusion, splenic tissue, and tumors.
  • CAR chimeric antigen receptor
  • T cells can be obtained from blood units collected from a subject using any of a number of techniques known to those of ordinary skill in the art, for example, FicollTM isolation.
  • Cells from blood are obtained by apheresis, and apheresis products typically contain T cells, monocytes, granulocytes, lymphocytes including B cells, other nucleated leukocytes, red blood cells, and platelets.
  • T cells are isolated from peripheral blood lymphocytes by lysing red blood cells and depleting monocytes, for example by centrifugation through a PERCOLLTM gradient or by countercurrent centrifugation.
  • activated T cells are isolated from peripheral blood mononuclear cells (PBMCs), and then CD22-CAR lentivirus is transduced into the T cells. to prepare CD22-CAR-T cells.
  • PBMCs peripheral blood mononuclear cells
  • CD22-CAR lentivirus is transduced into the T cells.
  • FIG. 4 it was confirmed that the CD22-CAR-T cells expressing CD4 or CD8 increased as the CD22-peptide increased. This means that the CD22-CAR-T cells prepared in the present invention effectively bind to CD22.
  • the level of IFN ⁇ expression by CD22-CAR-T cells in the presence of target cells was checked.
  • T cells were not activated in K562 cells that do not express CD22, whereas T cells were activated in the presence of U2932 cells expressing CD22, thereby increasing IFN ⁇ expression. .
  • the chimeric antigen receptor and CAR-T cells targeting CD22 of the present invention can be usefully used as a composition for preventing or treating diseases related to B cells or CD22 expression.
  • composition for preventing or treating diseases mediated by CD22 expression Composition for preventing or treating diseases mediated by CD22 expression
  • the present invention provides a pharmaceutical for the prevention or treatment of diseases mediated by CD22-expressing cells, including immune effector cells expressing an antibody that specifically binds to CD22 or a chimeric antigen receptor targeting CD22. to the composition.
  • the disease mediated by cells expressing CD22 is lymphoma, non-Hogkins lymphoma (NHL), aggressive NHL, relapsed aggressive NHL, relapsed delayed NHL, refractory NHL, refractory Delayed NHL, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma, leukemia, hairy cell leukemia (HCL), acute lymphocytic leukemia (ALL), Burkitt's lymphoma and mantle cell lymphoma.
  • NHL non-Hogkins lymphoma
  • aggressive NHL relapsed aggressive NHL
  • relapsed delayed NHL refractory NHL
  • refractory NHL refractory Delayed NHL
  • CLL chronic lymphocytic leukemia
  • small lymphocytic lymphoma small lymphocytic lymphoma
  • leukemia hairy cell leukemia
  • HCL hairy cell leukemia
  • ALL acute lymphocytic leukemia
  • the composition may include a therapeutic agent for a disease mediated by cells expressing CD22, and the therapeutic agent is present in a state covalently bound to the heavy chain and/or light chain of an antibody that specifically binds to CD22. Alternatively, it may be co-administered with the CD22-specific antibody or CD22-CAR-T cell of the present invention.
  • the therapeutic agent includes a small molecule drug, a peptide drug, a toxin (eg, a cytotoxin), and the like.
  • the low molecular weight drug may be a compound that exhibits a pharmaceutical activity of interest and generally has a molecular weight of about 800 Da or less or 2000 Da or less.
  • An inorganic small molecule refers to a molecule containing no carbon atoms, whereas an organic small molecule refers to a compound containing at least one carbon atom.
  • the peptidic drug refers to amino acids containing polymeric compounds, including naturally occurring and non-naturally occurring peptides, oligopeptides, cyclic peptides, polypeptides and proteins, as well as peptide mimics.
  • the peptide drug may be obtained by chemical synthesis or produced from a genetically encoded source (eg, a recombinant source).
  • the molecular weight of the peptide drug may range from 200 Da to 10 kDa or more.
  • the toxin is preferably a cytotoxin, and includes, but is not limited to, ricin, abrin, diphtheria toxin, Pseudomonas exotoxin (eg, PE35, PE37, PE38, PE40, etc.), saporin, gelonin, USA. antiviral protein (PAP), botulinum toxin, bryodin, momordin and buganin.
  • ricin abrin
  • diphtheria toxin diphtheria toxin
  • Pseudomonas exotoxin eg, PE35, PE37, PE38, PE40, etc.
  • saporin eg, PE35, PE37, PE38, PE40, etc.
  • saporin eg, PE35, PE37, PE38, PE40, etc.
  • saporin eg, PE35, PE37, PE38, PE40, etc.
  • saporin eg, PE35, PE37, PE38
  • the therapeutic agent may be an anticancer agent.
  • Anticancer agents reduce the proliferation of cancer cells and include non-peptidyl (ie, non-proteinaceous) compounds, including cytotoxic agents and cytostatic agents.
  • Non-limiting examples of anticancer agents include alkylating agents, nitrosourea, antimetabolites, antitumor antibiotics, plant (vinca) alkaloids, and steroid hormones.
  • Peptide compounds may also be used.
  • an antibody that specifically binds to CD22 or an immune effector cell expressing a chimeric antigen receptor targeting CD22 is the only active ingredient in the composition for treatment or diagnosis, or, for example, an anti-T cell, anti It can be used in combination with other active ingredients, including other antibody components such as -IFN ⁇ or anti-LPS antibodies, or non-antibody components such as xanthine.
  • the pharmaceutical composition preferably comprises a therapeutically effective amount of an antibody of the invention.
  • therapeutically effective amount refers to an amount of a therapeutic agent required to treat, ameliorate, or prevent a target disease or condition, or the amount of a therapeutic agent required to exhibit a detectable therapeutic or prophylactic effect.
  • a therapeutically effective dosage can be initially determined by cell culture assays or animal models, usually rodents, rabbits, dogs, pigs, or primates. Animal models can also be used to determine appropriate concentration ranges and routes of administration. Such information can be used to determine useful dosages and routes for dosing in humans.
  • an effective dosage is 0.01-50 mg/kg, preferably 0.1-20 mg/kg, more preferably about 15 mg/kg.
  • compositions may be administered to the patient individually or in combination with other agents, agents, or hormones.
  • the dosage at which the antibody of the present invention is administered depends on the nature of the condition to be treated, the grade of malignant lymphoma or leukemia, and whether the antibody is used to prevent disease or to treat an existing condition.
  • the frequency of administration depends on the half-life of the antibody molecule and the duration of the drug's effect. If the antibody molecule has a short half-life (eg 2-10 hours), it may be necessary to provide one or more doses per day. Alternatively, if the antibody molecule has a long half-life (eg, 2 to 15 days), it may be necessary to provide a dose once a day, once a week, or once every 1 or 2 months.
  • the pharmaceutical composition may contain a pharmaceutically acceptable carrier for administration of the antibody.
  • the carrier itself must not cause the production of antibodies that are harmful to the individual receiving the composition, and must be non-toxic.
  • Suitable carriers may be slowly metabolized macromolecules, such as proteins, polypeptides, liposomes, polysaccharides, polylactic acid, polyglycolic acid, amino acid polymers, amino acid copolymers and inactive viral particles.
  • salts are, for example, mineral acid salts such as hydrochloride, hydrobromide, phosphate and sulfate, or acetic acid, propionic acid. Salts of organic acids such as malonic acid and benzoic acid may be used.
  • Pharmaceutically acceptable carriers in therapeutic compositions may additionally include liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances such as wetting agents, emulsifying agents or pH buffering agents may be present in such compositions.
  • the carrier may be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions for ingestion of the pharmaceutical composition by a patient.
  • Preferred forms for administration include those suitable for parenteral administration, eg, by injection or infusion (eg, bolus injection or continuous infusion).
  • parenteral administration eg, by injection or infusion (eg, bolus injection or continuous infusion).
  • the product may take the form of suspensions, solutions or emulsions in oil or water-soluble excipients, which may contain prescription agents such as suspending, preservative, stabilizing and/or dispersing agents.
  • the antibody molecule may be in anhydrous form and reconstituted with an appropriate sterile solution prior to use.
  • compositions of the present invention can be administered directly to a patient.
  • the patients to be treated may be animals.
  • the composition is preferably adapted for administration to human patients.
  • the pharmaceutical composition of the present invention is not limited, but oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intraventricular, transdermal, transcutaneous (see, e.g., WO 98/20734), subcutaneous, Administration may be by any route, including intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal routes.
  • a hypospray may be used to administer the pharmaceutical composition of the present invention.
  • therapeutic compositions may be prepared as injectables as liquid solutions or suspensions.
  • solid forms suitable for solution or suspension in liquid excipients prior to injection may be prepared.
  • Direct delivery of the composition may generally be achieved by injection, subcutaneous injection, intraperitoneal injection, intravenous injection, intramuscular injection, or may be delivered to the interstitial space of a tissue.
  • the composition may be administered to the wound site. Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • the active ingredient in the composition may be an antibody molecule. As such, it may be susceptible to degradation in the gastrointestinal tract. Thus, if the composition is administered by a route using the gastrointestinal tract, the composition will need to contain an agent that protects the antibody from degradation but releases the antibody once absorbed from the gastrointestinal tract.
  • the present invention relates to a composition for diagnosing or monitoring a disease mediated by cells expressing CD22, including an antibody that specifically binds to CD22.
  • the antibody that specifically binds to CD22 may be directly or indirectly labeled.
  • Indirect labels include secondary antibodies comprising a detectable label, wherein the secondary antibody binds to an antibody that specifically binds to CD22.
  • Other indirect labels include biotin, wherein an antibody that specifically binds to biotinylated CD22 can be detected using avidin or streptavidin comprising a detectable label.
  • Suitable detectable labels include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
  • Suitable labels include, but are not limited to, magnetic beads, fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, etc.), radioactive labels (e.g., For example, 3 H, 125 I, 35 S, 14 C or 32 P), enzymes (eg, mustard radish peroxidase, alkaline phosphatase, luciferase and enzyme-linked immunosorbent assay (ELISA)) commonly used) and colorimetric labels such as colloidal gold or colored glass or plastic (eg, polystyrene, polypropylene, latex, etc.) beads.
  • fluorescent dyes e.g., fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, etc.
  • the antibody may be labeled with a fluorescent protein, and may contain a contrast agent or a radioisotope.
  • the antibody specifically binding to CD22 of the present invention is used in a diagnostic kit
  • the antibody is immobilized on a support
  • the support may be a microplate, microarray, chip, glass, bead or particle, or a membrane.
  • Example 1 Preparation and selection of antibodies that specifically bind to CD22
  • CD22 peptide-specific antibody To select the CD22 peptide-specific antibody, a hybridoma producing an antibody binding to CD22 was prepared and the antibody was selected.
  • splenocytes were extracted by immunization with CD22 protein (ACRObiosystems Inc., cat#CD2-H52H8, USA), and hybridoma cells were prepared by fusion with mouse myeloma cells.
  • mouse myeloma cells used for cell fusion do not have HGPRT (HypoxanthineGuanidine-Phosphoribosyl-Transferase), they cannot survive in HAT medium, but hybridomas can survive in HAT medium by fusion with splenocytes. Since only hybridomas can be grown using this, it is usually grown in HAT medium until hybridomas are established.
  • HGPRT Hydrophilic Guanidine-Phosphoribosyl-Transferase
  • Limiting dilution was used to select hybridomas that produced an antibody binding to CD22 from among the proliferated hybridomas. First, it was made to be less than one cell per 96 well, and then, it was confirmed by ELISA whether the antibody obtained from the clones proliferated from one cell binds to CD22, and clones that bind to CD22 were selected. The above process was repeated three times to select hybridomas producing an antibody binding to CD22. In this way, five types of antibodies that bind to CD22 were obtained.
  • the five antibodies were named 1C2, 9E9, 2A9, 2G1 and 6B3, respectively, and their base and amino acid sequences were analyzed.
  • the sequence information on the heavy chain variable region and the light chain variable region of each antibody according to the sequencing results is shown in Tables 1 to 5, and the underlined portions in Tables 1 to 5 are the complementarity determining region (CDR). ) means
  • CD22-His tag CD22 extracellular domain; ACRObiosystems Inc.
  • 1C2, 9E9, 2A9, 2G1 and 6B3 antibodies were treated in each well, and then reacted at room temperature for 2 hours, and then washed 3 times with 1 X PBST.
  • Secondary antibody (anti-HRP, 1:10,000) was treated and reacted at room temperature for 30 minutes, washed 3 times with 1 X PBST, and then treated with TMB for color development and reacted at room temperature for 5 minutes. Finally, the reaction was terminated by treatment with a stop solution of 1N H 2 SO 4 , and then the absorbance was measured at 450 nm.
  • CD22-expressing non-cell lymphoma U2932 (B-cell lymphoma U2932 cell) was reacted with 1 ⁇ 10 6 and 1 ⁇ g of 1C2, 9E9, 2A9, 2G1, and 6B3 antibodies for 30 minutes, respectively, and then surface with a secondary antibody. After staining, it was measured by flow cytometry.
  • PE-conjugated anti-CD22 antibody PE-conjugated anti-CD22 antibody; Biolegend Inc., cat# 302506, USA
  • a PE-conjugated anti-mouse IgG antibody was used as a positive control
  • PE-conjugated goat anti-mouse IgG PE-conjugated goat anti-mouse IgG; Biolegend Inc., cat# 405307, USA
  • Example 4 Construction of a chimeric antigen receptor (CAR) expression vector targeting CD22
  • CAR lentivirus chimeric antigen receptor
  • EF1 ⁇ promoter SEQ ID NO: 63
  • a polynucleotide encoding a signal peptide SEQ ID NO: 64
  • a polynucleotide encoding a CD22-binding domain (1C2 represented by SEQ ID NO: 54, 9E9 represented by SEQ ID NO: 56, 2G1 represented by SEQ ID NO: 60 or 6B3 represented by SEQ ID NO: 62)
  • a polynucleotide encoding the CD8 hinge region SEQ ID NO: 65
  • a polynucleotide encoding a transmembrane domain SEQ ID NO: 66
  • a polynucleotide encoding 4-1BB (costimulatory domain) SEQ ID NO: 67
  • a polynucleotide encoding CD3 ⁇ intracellular signaling domain SEQ ID NO: 68
  • CAR DNA composed of a polynucleotide encoding WPRE
  • Lentiviral vectors were co-transfected into Lenti-X 293T cells with three vectors: pMDLg/pRRE (Addgene, cat# #12251), pMD2.G (Addgene, cat##12259), and pRSV-Rev (Addgene, cat##12253). After co-transfection, CD22-CAR lentivirus was produced. For co-infection, three vectors and Lenti-X 293T cells were incubated for 6 hours using Lipofectamine 3000 transfection kit (Invitrogen, cat# L3000-015) and Opti-MEM+GlutaMAX (gibco, cat# 51985-034) medium. .
  • the CD22-CAR lentiviral vector prepared in Example 4 was transformed into T cells to prepare CD22-CAR-T cells.
  • T cell activation beads (Miltenyl Biotec, cat# 130-091-441) was used to activate T cells.
  • CD22-CAR-T cells were prepared by transducing the activated T cells with the CD22-CAR lentivirus prepared in Example 4 into T cells, and the transduction efficiency was increased using Lenti-boost-p.
  • CD22 peptide binding capacity of CD22-CAR-T cells was confirmed by flow cytometry.
  • the CD22-CAR-T cells prepared above were reacted with FITC-CD22 protein with anti-CD3, anti-CD4, and anti-CD8 antibodies, and then fluorescence intensity was measured using a FACS machine.
  • CD3 expressing cells were used as T cells, and the level of FITC expression in T cells was checked.
  • CD22-CAR-T cells expressing CD4 or CD8 binding to CD22 increased as the CD22 peptide increased. This means that the CD22-CAR-T cells prepared in the present invention effectively bind to CD22.
  • the level of IFN ⁇ expression by the CD22-CAR-T cells in the presence of target cells was checked.
  • K562 cells that do not express CD22 (ATCC, cat#CCL-243) and U2932 cells that express CD22 (DSMZ, cat#ACC-633) were used. :1, 1:1. After reacting for a certain period of time in a ratio of 0.5:1, 0:1, surface & intra antibody staining was performed for FACS measurement (CD22 protein, INF-r, CD107a, CD3, CD4, CD8 staining). The level of IFN ⁇ expression of CD22-CAR-T reacted with target cells was confirmed on the basis of 0:1 (CAR-T only).
  • T cells were not activated in K562 cells that do not express CD22, whereas T cells were activated in the presence of U2932 cells expressing CD22, thereby increasing IFN ⁇ expression. .
  • K562 cells which do not express CD22
  • U2932 cells which express CD22
  • the ratios of CD22-CAR-T cells were 1:4, 1:2, 1:1, 1:0.5 and 1:0.25.
  • luminescence CytoTox-Glo Cytotoxicity Assay, Promega, cat# G9291 was measured. The degree of cell death was calculated using Equation 1 below as the measured value.
  • Target Spontaneous Luminescence value derived from the medium of target cells only
  • Target Maximum Luminescence value derived from 100% lysis of target cells (using Lysis Reagent)
  • the CD22-CAR-T cells of the present invention specifically killed U2932 cells expressing CD22.
  • the antibody selected in the present invention specifically recognizes CD22-expressing cells, and using the established antibody, the chimeric antigen receptor (CAR) and CAR-T cells targeting CD22 effectively bind to CD22 In addition, it was confirmed that the activation of CAR-T cells bound to CD22 was made.
  • CAR chimeric antigen receptor
  • the CAR-T cells of the present invention effectively kill cells expressing CD22, the CD22-specific antibody, the chimeric antigen receptor targeting CD22, and CAR-T cells of the present invention are related to CD22 expression. It can be usefully used as a composition for preventing or treating diseases.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Oncology (AREA)
  • Biotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hospice & Palliative Care (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)

Abstract

본 발명은 CD22에 특이적인 항체 및 이의 용도에 관한 것으로, 보다 상세하게는 CD22에 특이적으로 결합하는 항체, 상기 항체를 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 발현하는 CAR-T 세포, 및 이들을 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환 예방 또는 치료용 약학적 조성물에 관한 것이다. 본 발명에서 선별한 항체는 CD22를 발현하는 세포를 특이적으로 인식하는 것을 확인하였으며, 상기 확립된 항체를 이용하여 CD22를 표적으로 하는 키메라 항원 수용체(CAR) 및 CAR-T 세포는 CD22와 효과적으로 결합할 뿐만 아니라, CD22와 결합한 CAR-T 세포의 활성화가 이루어진 것을 확인하였다. 나아가, 본 발명의 CAR-T 세포는 CD22를 발현하는 세포를 효과적으로 사멸시키는 것을 확인하였으므로, 본 발명의 CD22에 특이적인 항체, CD22를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포는 CD22 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.

Description

CD22에 특이적인 항체 및 이의 용도
본 발명은 CD22에 특이적인 항체 및 이의 용도에 관한 것으로, 보다 상세하게는 CD22에 특이적으로 결합하는 항체, 상기 항체를 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 발현하는 CAR-T 세포, 및 이들을 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환 예방 또는 치료용 약학적 조성물에 관한 것이다.
CD22는 시알로어드헤신(sialoadhesins)이라 불리는 시알산(sialic acid) 결합단백질 족에 속하는 135kDa의 막당단백질이다. CD22는 B세포 발생 초기에 세포질에서 검출되고, IgD와 동시에 세포 표면에 나타나며, 대부분의 성숙한 B세포에서 발견된다. B세포가 활성화되면 발현이 증가한다. CD22는 분화말기에 상실되며, 일반적으로 형질세포(plasma cell)에는 존재하지 않는 것으로 보고되었다.
인간의 CD22에는 2종의 동형(isoform)이 존재한다. 지배적인 형태(CD22β)는 세포외부 영역에 7개의 면역글로불린-유사(Ig-like) 도메인을 포함한다. CD22α 변이체는 Ig-유사 도메인 4가 없고, 세포질 도메인이 잘려진 형태를 가질 수 있다. 단핵구, 호중구(neutrophil), 림프구 및 적혈구에 대한 CD22의 결합을 차단하는 항체는, 첫번째 또는 두번째 Ig-유사 도메인내에 결합하는 것이 관찰되었다.
CD22의 세포질 도메인은, B세포 항원 수용체의 결합에 따라 티로신이 인산화되며, Lyk, Syk 및 포스파티딜이노시톨 3-키나제와 결합한다. CD22의 기능은 B세포 활성화 역치(threshold)를 하위조절(down-modulation)하는 것이다. 이것은 또한 적당한 시알로당접합체(sialoglycoconjugates)를 포함하는 세포와의 결합을 통해 세포결합을 매개할 수 있다.
CD22는 NHL, 급성 림프모구백혈병(acute lymphoblastic leukaemia: B-ALL), 만성 림프모구백혈병(chronic lymphocytic leukaemia: B-CLL) 및 특히 급성 비림프구 백혈병(acute non-lymphocytic leukaemia: ANLL)을 포함하는, 대부분의 B세포 백혈병 및 림프종에서 발현된다.
이러한 CD22 발현과 관련된 질환 등의 치료 또는 진단을 위해 CD22에 특이적인 항체의 개발이 이루어지고 있다. 국제공개특허 WO1998-041641호에는 V H44및 V L100위치에 시스테인 잔기를 갖는 재조합 항-CD22 항체에 대해 개시되어 있으며, 국제공개특허 WO 1998-042378호에는 B세포 악성종양의 치료를 위한 항-CD22 항체에 대해 개시되어 있다.
본 발명에서는 CD22에 보다 특이적으로 결합하는 항체를 개발하기 위해 CD22에 결합하는 항체를 스크리닝 하여 신규한 항체 5종(1C2, 9E9, 2A9, 2G1 및 6B3)을 확립하였으며, 본 발명에서 선별한 5종의 항체는 CD22 항원과 특이적으로 결합하는 것을 확인하였다. 또한, 본 발명의 CD22 특이적인 항체를 이용하여 CD22를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포를 제조하였으며, CD22-CAR-T 세포는 CD22와 결합할 뿐만 아니라, CD22 발현 세포(B 세포 림프종)를 효과적으로 사멸시키는 것을 확인하였다.
따라서, 본 발명의 목적은 CD22에 특이적으로 결합하는 항체를 제공하는 데 있다.
본 발명의 다른 목적은 상기 항체를 코딩하는 폴리뉴클레오타이드, 상기 항체를 발현하는 벡터, 상기 벡터로 형질전환된 재조합 세포를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항체를 포함하는 키메라 항원 수용체, CD22를 표적하는 키메라 항원 수용체를 코딩하는 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 폴리뉴클레오타이드 또는 벡터를 포함하는 키메라 항원 수용체 발현하는 면역 이펙터 세포를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항체 또는 CD22를 표적하는 키메라 항원 수용체를 발현하는 면역 이펙터 세포를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 예방 또는 치료용 약학적 조성물을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항체를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 진단 또는 모니터링 조성물을 제공하는 데 있다.
상술한 목적을 달성하기 위해,
본 발명은 (a) 서열번호 1의 아미노산으로 표시되는 CDR1 영역, 서열번호 2의 아미노산으로 표시되는 CDR2 영역 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역, 서열번호 5의 아미노산으로 표시되는 CDR2 영역 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
(b) 서열번호 11의 아미노산으로 표시되는 CDR1 영역, 서열번호 12의 아미노산으로 표시되는 CDR2 영역 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역, 서열번호 15의 아미노산으로 표시되는 CDR2 영역 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
(c) 서열번호 21의 아미노산으로 표시되는 CDR1 영역, 서열번호 22의 아미노산으로 표시되는 CDR2 영역 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역, 서열번호 25의 아미노산으로 표시되는 CDR2 영역 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
(d) 서열번호 31의 아미노산으로 표시되는 CDR1 영역, 서열번호 32의 아미노산으로 표시되는 CDR2 영역 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역, 서열번호 35의 아미노산으로 표시되는 CDR2 영역 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위; 또는
(e) 서열번호 41의 아미노산으로 표시되는 CDR1 영역, 서열번호 42의 아미노산으로 표시되는 CDR2 영역 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역, 서열번호 45의 아미노산으로 표시되는 CDR2 영역 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위로 구성된 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 제공한다.
본 발명의 바람직한 일실시예에 있어서, 상기 항체는 단클론 항체, 바람직하게는 scFv(Single-chain variable fragment)일 수 있다.
본 발명의 바람직한 다른 일실시예에 있어서, 상기 (a) 항체는 서열번호 7의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 8의 아미노산으로 표시되는 경쇄 가변부위로,
상기 (b) 항체는 서열번호 17의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 18의 아미노산으로 표시되는 경쇄 가변부위로,
상기 (c) 항체는 서열번호 27의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 28의 아미노산으로 표시되는 경쇄 가변부위로,
상기 (d) 항체는 서열번호 37의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 38의 아미노산으로 표시되는 경쇄 가변부위로,
상기 (e) 항체는 서열번호 47의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 48의 아미노산으로 표시되는 경쇄 가변부위로 구성될 수 있다.
다른 목적을 달성하기 위해, 본 발명은 상기 CD22에 특이적으로 결합하는 항체를 코딩하는 폴리뉴클레오타이드를 제공한다.
또한, 본 발명은 상기 CD22에 특이적으로 결합하는 항체를 코딩하는 폴리뉴클레오타이드 포함하는 벡터를 제공한다.
또한, 본 발명은 상기 벡터로 형질전환된 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 생산하는 재조합 세포를 제공한다.
또 다른 목적을 달성하기 위해, 본 발명은 CD22-결합 도메인; 막관통 도메인(transmembrane domain); 공동자극 도메인(costimulatory domain); 및 세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메릭 항원 수용체(chimeric antigen receptor: CAR)로,
상기 CD22-결합 도메인은 본 발명의 CD22와 특이적으로 결합할 수 있는 항체 또는 이의 단편 중에 선택될 수 있다.
본 발명의 바람직한 일실시예에 있어서, 상기 막관통 도메인은 CD8α, CD4, CD28, CD137, CD80, CD86, CD152 및 PD1로 구성된 군에서 선택되는 단백질로부터 유래될 수 있다.
본 발명의 다른 바람직한 일실시예에 있어서, 상기 공동자극 도메인은 CD28, 4-1BB, OX-40 및 ICOS로 구성된 군에서 선택되는 단백질 유래일 수 있고, 상기 신호전달 도메인은 CD3ζ 유래일 수 있다.
본 발명의 또 다른 바람직한 일실시예에 있어서, 상기 CD22-결합 도메인의 C 말단 및 막경유 도메인의 N 말단 사이에 위치된 힌지 부위(hinge region)를 추가로 포함할 수 있으며, 상기 힌지 부위는 CD8α 유래일 수 있다.
다른 목적을 달성하기 위해, 본 발명은 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 제공한다.
또한, 본 발명은 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 포함하는 벡터를 제공한다.
본 발명의 바람직한 일실시예에 있어서, 상기 벡터는 플라스미드(plasmid), 레트로바이러스(retroviral) 벡터 또는 렌티바이러스(lentiviral) 벡터일 수 있다.
또한, 본 발명은 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 포함하고, 상기 키메릭 항원 수용체(CAR)를 발현하는 면역 이펙터 세포를 제공한다.
본 발명의 바람직한 일실시예 있어서, 상기 면역 이펙터 세포는 T 세포일 수 있다.
또 다른 목적을 달성하기 위해, 본 발명은 CD22를 표적하는 키메라 항원 수용체를 발현하는 면역 이펙터 세포; 또는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;을 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명의 바람직한 일실시예에 있어서, CD22를 발현하는 세포에 의해 매개되는 질환은 림프종, 비호치킨 림프종(non-Hogkins lymphoma: NHL), 공격적 NHL, 재발성 공격적 NHL, 재발성 지연성 NHL, 불응성 NHL, 불응성 지연성 NHL, 만성 림프성 백혈병(chronic lymphocytic leukemia: CLL), 소형 림프성 림프종, 백혈병, 모발성 세포 백혈병(hairy cell leukemia: HCL), 급성 림프성 백혈병(acute lymphocytic leukemia: ALL), 버킷트 림프종 및 외투 세포 림프종로 구성된 군에서 선택될 수 있다.
본 발명의 바람직한 또 다른 일실시예에서, 상기 조성물은 CD22를 발현하는 세포에 의해 매개되는 질환의 치료제를 포함할 수 있다.
또한, 본 발명은 CD22에 특이적으로 결합하는 항체를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 진단 또는 모니터링용 조성물을 제공한다.
본 발명에서는 CD22에 보다 특이적으로 결합하는 항체를 스크리닝하여 신규한 항체 5종(1C2, 9E9, 2A9, 2G1 및 6B3)을 확립하였고, 상기 신규한 항체들이 CD22 항원과 특이적으로 결합하는 것을 확인하였다.
또한, 상기 확립된 항체를 이용하여 제조된 CD22를 표적으로 하는 키메라 항원 수용체(CAR) 및 CAR-T 세포는 CD22와 효과적으로 결합할 뿐만 아니라, CD22와 결합한 CAR-T 세포의 활성화가 이루어진 것을 확인하였다.
나아가, 본 발명의 CAR-T 세포는 CD22를 발현하는 세포를 효과적으로 사멸시키는 것을 확인하였으므로, 본 발명의 CD22에 특이적인 항체, CD22를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포는 CD22 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.
도 1은 본 발명에서 선별한 1C2, 9E9, 2A9, 2G1 및 6B3 항체의 CD22에 대한 결합력을 FACS로 확인한 데이터이다.
도 2는 CD22를 표적으로 하는 키메라 항원 수용체(CD22-CAR)를 발현하는 렌티바이러스 벡터 및 T 세포에서 발현된 키메라 항원 수용체를 나타낸 모식도이다.
도 3은 CD22-CAR를 발현하는 렌티바이러스를 이용한 CD22-CAR-T 세포 제조방법을 나타낸 모식도이다.
도 4는 1C2, 9E9, 2G1 및 6B3 항체 각각을 이용하여 제조한 CD22-CAR-T 세포의 CD22 결합능을 확인한 데이터이다.
도 5는 1C2, 9E9, 2G1 및 6B3 항체 각각을 이용하여 제조한 CD22-CAR-T 세포의 활성화를 확인하기 위해, 표적 세포의 존재하에 CD22-CAR-T 세포에 의한 IFNγ 발현 정도를 확인한 데이터이다.
도 6은 1C2, 9E9, 2G1 및 6B3 항체 각각을 이용하여 제조한 CD22-CAR-T 세포에 의한 표적 세포의 사멸효과를 확인한 데이터이다.
이하, 본 발명을 상세하게 설명한다.
CD22에 특이적으로 결합하는 항체
본 발명은 일관점에서, CD22에 특이적으로 결합하는 항체 또는 이의 단편으로서,
(a) 서열번호 1의 아미노산으로 표시되는 CDR1 영역, 서열번호 2의 아미노산으로 표시되는 CDR2 영역 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역, 서열번호 5의 아미노산으로 표시되는 CDR2 영역 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(b) 서열번호 11의 아미노산으로 표시되는 CDR1 영역, 서열번호 12의 아미노산으로 표시되는 CDR2 영역 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역, 서열번호 15의 아미노산으로 표시되는 CDR2 영역 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(c) 서열번호 21의 아미노산으로 표시되는 CDR1 영역, 서열번호 22의 아미노산으로 표시되는 CDR2 영역 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역, 서열번호 25의 아미노산으로 표시되는 CDR2 영역 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(d) 서열번호 31의 아미노산으로 표시되는 CDR1 영역, 서열번호 32의 아미노산으로 표시되는 CDR2 영역 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역, 서열번호 35의 아미노산으로 표시되는 CDR2 영역 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편; 또는
(e) 서열번호 41의 아미노산으로 표시되는 CDR1 영역, 서열번호 42의 아미노산으로 표시되는 CDR2 영역 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역, 서열번호 45의 아미노산으로 표시되는 CDR2 영역 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편에 관한 것이다.
본 발명에서, 상기 항체는 단클론 항체(monoclonal antibody)일 수 있다. 본 발명에서, 용어 "단클론 항체(monoclonal antibody)"는 모노클로날 항체 또는 단일클론항체라고도 불리며, 단일 항체 형성세포가 생성하는 항체로, 1차 구조(아미노산 배열)가 균일한 특징이 있다. 오직 하나의 항원 결정기만을 인식하며, 일반적으로 암세포와 항체생산세포를 융합한 하이브리도마(hybridoma cell)을 배양하여 생산되지만, 확보된 항체 유전자 서열을 이용하여 다른 재조합 단백질 발현 숙주세포를 이용하여 생산할 수도 있다. 또한, 상기 항체는 필요에 따라 CDR 부분을 제외한 나머지 부분을 인간화시켜 사용할 수도 있다.
본 발명에서, 용어 "CDR", 즉 "상보성 결정 영역"은 중쇄 및 경쇄 폴리펩타이드 모두의 가변 영역 내에서 발견되는 비근접(non-contiguous) 항원 결합 부위를 의미하는 것이다.
본 발명에서, 용어 "인간화 항체"는 인간에 의해 생산된 항체의 것에 상응하는 아미노산 서열을 소유하고 및/또는 본원에서 개시된 바와 같은 인간 항체를 만들기 위한 기술 중에서 한 가지를 이용하여 만들어진 항체이다. 인간화 항체의 이러한 정의는 비인간 항원 결합 잔기를 포함하는 인간화 항체를 특정적으로 배제한다.
본 발명에서, 용어 "항체"는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 완전한 형태 뿐만 아니라 항체 분자의 단편도 사용될 수 있다. 항체 분자의 단편이란 적어도 펩타이드 태그(에피토프) 결합 기능을 보유하고 있는 단편을 뜻하며 scFv, Fab, F(ab'), F(ab') 2,단일 도메인(single domain) 등을 포함한다.
항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 부위(hinge region)를 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 부위의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 국제공개 특허 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(dsFv)는 디설파이드 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 경쇄의 가변 영역이 공유 결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수 분해 효소를 이용해서 얻을 수 있고(예를 들면, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 바람직하게는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명의 CD22에 특이적으로 결합하는 단클론 항체는 CD22 단백질 전체 또는 일부 펩타이드를 면역원(또는 항원)으로 이용하여 제조할 수 있다. 보다 상세하게는, 우선 면역원으로서 CD22, CD22 단백질을 포함하는 융합 단백질 또는 CD22 단백질을 포함하는 캐리어(carrier)를 필요에 따라서 면역증강제인 아주반트(adjuvant)(예, Freund adjuvant)와 함께 인간을 제외한 포유동물의 피하, 근육, 정맥, 발볼록살 또는 복강 내에 1회 내지 그 이상 주사하는 것으로써 면역감작(immunization)을 시킨다. 상기 인간을 제외한 포유동물은 바람직하게는, 마우스, 래트, 햄스터, 몰모트, 닭, 토끼, 고양이, 개, 돼지, 염소, 양, 당나귀, 말 또는 소(인간 항체를 생산하는 형질 전환(transgenic) 마우스와 같은 다른 동물 유래의 항체를 생산하도록 조작된 형질 전환(transgenic) 동물을 포함한다.)이며, 보다 바람직하게는, 마우스, 래트, 햄스터, 몰모트, 닭 또는 토끼이다. 첫 번째 면역으로부터 약 1~21일 마다 1~4회 면역을 실시하여, 최종 면역으로부터 약 1~10일 후에 면역 감작 된 포유동물로부터 항체 생산하는 세포를 수득할 수 있다. 면역을 시키는 회수 및 시간적 간격은 사용하는 면역원의 특징 등에 의하여 적당히 변경할 수 있다.
단클론 항체를 분비하는 하이브리도마(hybridoma)의 제조는 케이라 및 미르슈타인 등의 방법(Nature, 1975, Vol. 256, p. 495-497) 및 이에 준하는 방법에 따라 실시할 수 있다. 상기와 같이 면역 감작된 인간을 제외한 동물로부터 채취한 비장, 림프절, 골수 또는 편도로 이루어지는 군으로부터 선택되는 어느 하나, 바람직하게는 비장에 포함되는 항체 생산하는 세포와 자가 항체 생산 능력이 없는 포유동물 유래의 골수종 세포(myeloma cells)를 세포 융합시키는 것에 의해 하이브리도마(hybridoma)를 제조할 수 있다. 상기 포유동물은 마우스, 래트, 몰모트, 햄스터, 닭, 토끼 또는 인간일 수 있고, 바람직하게는 마우스, 래트, 닭 또는 인간일 수 있다.
세포 융합은, 예를 들면, 폴리에틸렌글리콜이나 센다이 바이러스를 비롯한 융합 촉진제나 전기 펄스에 의한 방법이 이용되고, 예를 들면, 융합 촉진제를 함유하는 융합 배지에 항체 생산 세포와 무한 증식 가능한 포유류 유래의 세포를 약 1:1 내지 1:10의 비율로 부유시켜, 이 상태로, 약 30 내지 40℃로 약 1 내지 5분간 배양한다. 융합 배지에는, 예를 들면, MEM 배지, RPMI1640 배지 및 이스코브 변형 둘베코 배지(Iscove's Modified Dulbecco's Medium)를 비롯한 통상의 일반적인 것을 이용하면 좋고, 소 혈청 등의 혈청류는 제외해 두는 것이 바람직하다.
상기 단클론 항체를 생산하는 하이브리도마 클론을 스크리닝하는 방법은 우선, 상기한 바와 같이 획득한 융합 세포를 HAT 배지 등의 선택용 배지에 옮기고, 약 30 내지 40℃로 약 3일 내지 3주일 배양해서 하이브리도마 이외의 세포를 사멸시킨다. 이어서, 마이크로타이터 플레이트(microtiter plate) 등에서 하이브리도마를 배양한 후, 위에서 기술한 인간을 제외한 동물의 면역반응에 사용한 면역원과 배양 상청액과의 반응성이 증가된 부분을 RIA(radioactive substance-marked immuno antibody) 또는 ELISA(Enzyme-Linked Immunosorbent Assay)같은 면역분석방법을 통하여 찾는 방법을 통해 수행할 수 있다. 그리고 상기에서 찾은 단클론 항체를 생산하는 클론은 상기 면역원에 대하여 특이적인 결합력을 보여준다.
본 발명의 단클론 항체는, 이와 같은 하이브리도마를 생체 내외에서 배양함으로써 얻을 수 있다. 배양에는, 포유동물 유래의 세포를 배양하기 위한 통상의 방법이 이용되며, 배양물 등으로부터 단클론 항체를 채취하기 위해서는, 항체 일반을 정제하기 위한 이 분야에서의 통상의 방법이 이용된다. 각각의 방법으로서는, 예를 들면, 염석(鹽析), 투석, 여과, 농축, 원심분리, 분별 침전, 겔 여과 크로마토그래피, 이온 교환 크로마토그래피, 어피니티 크로마토그래피, 고속액체 크로마토그래피, 겔 전기영동 및 등전점 전기영동 등을 들 수 있고, 이들은 필요에 따라서 조합해서 적용된다. 정제한 단클론 항체는, 그 후, 농축, 건조하여, 용도에 따라서 액상 또는 고상으로 한다.
또한, 본 발명의 단클론 항체는, 중쇄(重鎖) 및 경쇄(輕鎖) 가변영역을 코딩하는 DNA를 각각, 중쇄 및 경쇄의 정상영역을 코딩하는 기지의 DNA(예를 들면, 일본 2007-252372호 공보 참조)와 각각 연결한 유전자를, PCR법, 또는, 화학 합성에 의해 합성하고, 그 유전자의 발현을 가능하게 하는 공지의 발현 벡터(pcDNA 3.1(Invitrogen 사 판매) 등에 이식하여 형질 전환체를 제조하고, CHO 세포나 대장균 등의 숙주 중에서 발현시킴으로써 항체를 생산하고, 이러한 배양액으로부터, 프로테인 A 또는 G(Protein A 또는 G) 컬럼 등을 이용해서 항체를 정제함으로써 얻을 수 있다.
본 발명의 구체적인 일실시예에서는, CD22에 특이적으로 결합하는 항체를 제조하기 위해, 항-CD22 항체를 생산하는 하이브리도마를 제조 및 스크리닝 하여, CD22에 특이적으로 결합하는 항체(scFv) 5종을 선별하였으며, 이를 각각 1C2, 9E9, 2A9, 2G1 및 6B3로 명명하였다.
(a) 상기 1C2 항체는 서열번호 1의 아미노산으로 표시되는 CDR1 영역(GYTFTSYWMNW), 서열번호 2의 아미노산으로 표시되는 CDR2 영역(IDPSDSET) 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역(ARWGNYDYDVWAMDY)을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역(QNIVHLNGNTF), 서열번호 5의 아미노산으로 표시되는 CDR2 영역(KVS) 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역(FQGSHVPYT)을 포함하는 경쇄 가변 부위로 구성되는 것을 확인하였다.
구체적으로, 1C2 항체는 서열번호 7의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 8의 아미노산으로 표시되는 경쇄 가변부위로 구성되며, 상기 중쇄 가변 부위는 서열번호 9의 염기서열로, 경쇄 가변 부위는 서열번호 10의 염기서열로 코딩되는 것을 확인하였다.
(b) 상기 9E9 항체는 서열번호 11의 아미노산으로 표시되는 CDR1 영역(GYAFSIYW), 서열번호 12의 아미노산으로 표시되는 CDR2 영역(IYPGDGDT) 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역(ARRGITPWFAY)을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역(QSLLNSSNQKNY), 서열번호 15의 아미노산으로 표시되는 CDR2 영역(FAS) 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역(CQQHYSTPLT)을 포함하는 경쇄 가변 부위로 구성되는 것을 확인하였다.
구체적으로, 9E9 항체는 서열번호 17의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 18의 아미노산으로 표시되는 경쇄 가변부위로 구성되며, 상기 중쇄 가변 부위는 서열번호 19의 염기서열로, 경쇄 가변 부위는 서열번호 20의 염기서열로 코딩되는 것을 확인하였다.
(c) 상기 2A9 항체는 서열번호 21의 아미노산으로 표시되는 CDR1 영역(GYTFTTYP), 서열번호 22의 아미노산으로 표시되는 CDR2 영역(FHPYNDDT) 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역(ARGDYYVSSWYFDV)을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역(QNVGTN), 서열번호 25의 아미노산으로 표시되는 CDR2 영역(SAS) 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역(QQYNSYPLT)을 포함하는 경쇄 가변 부위로 구성되는 것을 확인하였다.
구체적으로, 2A9 항체는 서열번호 27의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 28의 아미노산으로 표시되는 경쇄 가변부위로 구성되며, 상기 중쇄 가변 부위는 서열번호 29의 염기서열로, 경쇄 가변 부위는 서열번호 30의 염기서열로 코딩되는 것을 확인하였다.
(d) 상기 2G1 항체는 서열번호 31의 아미노산으로 표시되는 CDR1 영역(GFSLTSYDI), 서열번호 32의 아미노산으로 표시되는 CDR2 영역(IWTGGGT) 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역(VPHYYGYAMDYW)을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역(QDINKY), 서열번호 35의 아미노산으로 표시되는 CDR2 영역(YTS) 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역(LQYDNLLT)을 포함하는 경쇄 가변 부위로 구성되는 것을 확인하였다.
구체적으로, 2G1 항체는 서열번호 37의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 38의 아미노산으로 표시되는 경쇄 가변부위로 구성되며, 상기 중쇄 가변 부위는 서열번호 39의 염기서열로, 경쇄 가변 부위는 서열번호 40의 염기서열로 코딩되는 것을 확인하였다.
(e) 상기 6B3 항체는 서열번호 41의 아미노산으로 표시되는 CDR1 영역(GYTFTDYN), 서열번호 42의 아미노산으로 표시되는 CDR2 영역(IYPYNGGT) 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역(ARLYYYGRTSYWG)을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역(QNVGTY), 서열번호 45의 아미노산으로 표시되는 CDR2 영역(SAS) 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역(HQYDSYPYT)을 포함하는 경쇄 가변 부위로 구성되는 것을 확인하였다.
구체적으로, 6B3 항체는 서열번호 47의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 48의 아미노산으로 표시되는 경쇄 가변부위로 구성되며, 상기 중쇄 가변 부위는 서열번호 49의 염기서열로, 경쇄 가변 부위는 서열번호 50의 염기서열로 코딩되는 것을 확인하였다.
본 발명의 CD22에 특이적인 항체는 바람직하게 scFv(single chain variable fragment)로, 중쇄 가변 부위 및 경쇄 가변 부위가 링커로 연결될 수 있도록 유전자 재조합 기술을 통하여 제작할 수 있다. 상기 링커는 바람직하게 바람직하게 서열번호 51의 아미노산 서열 또는 서열번호 52의 염기서열로 표시될 수 있으나, 이에 한정되지는 않는다.
경쇄 가변부위-링커-중쇄 가변부위로 연결된 경우 1C2 항체는 서열번호 53의 아미노산 서열 또는 서열번호 54의 염기서열로, 9E9 항체는 서열번호 55의 아미노산 서열 또는 서열번호 56의 염기서열로, 2A9 항체는 서열번호 57의 아미노산 서열 또는 서열번호 58의 염기서열로, 2G1 항체는 서열번호 59의 아미노산 서열 또는 서열번호 60의 염기서열로, 6B3 항체는 서열번호 61의 아미노산 서열 또는 서열번호 62의 염기서열로 표시될 수 있다.
본 발명은 다른 관점에서, 상기 CD22에 특이적으로 결합하는 항체를 코딩하는 폴리뉴클레오타이드에 관한 것이다.
본 발명에서, 용어 "폴리뉴클레오타이드"는 일반적으로 임의의 길이로 분리된 핵산 분자(nucleic acid molecule), 데옥시리보뉴클레오티드 또는 리보뉴클레오티드, 또는 그의 유사체를 지칭한다. 일부 구현예에서, 본 발명의 폴리뉴클레오타이드는 (1) 중합효소 연쇄반응(PCR) 증폭과 같은 in-vitro 증폭; (2) 클로닝 및 재조합; (3) 절단(digestion) 및 겔 전기영동 분리와 같은 정제; (4) 화학 합성과 같은 합성을 통해 제조될 수 있으며, 바람직하게 분리된 폴리뉴클레오타이드는 재조합 DNA 기술에 의해 제조된다. 본 발명에서, 항체 또는 이의 항원 결합 단편을 코딩하기 위한 핵산은 합성 올리고뉴클레오티드의 제한 단편 조작(restriction fragment operation) 또는 SOE PCR의 적용을 포함하지만 이에 제한하지 않고, 당업계에 공지된 다양한 방법에 의해 제조될 수 있다.
본 발명은 또 다른 관점에서, 상기 CD22에 특이적으로 결합하는 항체를 코딩하는 폴리뉴클레오타이드 포함하는 벡터, 및 상기 벡터로 형질전환된 재조합 세포에 관한 것이다.
본 발명에서, 용어 "벡터(expression vector)"는 적당한 숙주세포 내에서 목적 유전자가 발현할 수 있도록 프로모터 등의 필수적인 조절 요소를 포함하는 유전자 제조물이다. 벡터는 플라스미드, 레트로바이러스(retroviral) 벡터 및 렌티바이러스(lentiviral) 벡터 중 하나 이상으로부터 선택될 수 있다. 적당한 숙주로 형질전환되면, 벡터는 숙주 게놈과 무관하게 복제하고 기능할 수 있거나, 또는 일부 경우에 게놈 그 자체에 통합될 수 있다.
또한, 벡터는 코딩 영역이 적합한 숙주에서 정확하게 발현될 수 있게 하는 발현 제어 요소를 포함할 수 있다. 이러한 조절 요소는 당업자에게 잘 알려져 있으며, 예를 들어 프로모터, 리보솜 결합 부위(ribosome-binding site), 인핸서(enhancer) 및 유전자 전사(transcription) 또는 mRNA 번역(translation)을 조절하기 위한 다른 조절 요소를 포함할 수 있다. 발현 조절 서열의 특정 구조는 종 또는 세포 유형의 기능에 따라 달라질 수 있으나, 일반적으로 TATA 박스(box), 캡핑된(capped) 서열, CAAT 서열 등과 같은 전사 개시 및 번역 개시에 각각 참여하는 5' 비-전사 서열, 및 5' 또는 3' 비-번역 서열을 함유한다. 예를 들어, 5' 비-전사 발현 조절 서열은 기능적으로 연결된 핵산을 전사 및 조절하기 위한 프로모터 서열을 포함할 수 있는 프로모터 영역을 포함할 수 있다.
본 발명에서, 용어 "프로모터"는 전사를 지시하기에 충분한 최소 서열을 의미한다. 또한, 세포 유형 특이적 또는 외부의 신호 또는 제제에 의해 유도되는 조절 가능한 프로모터 의존적 유전자를 발현하도록 하는 데 충분한 프로모터 구성이 포함될 수 있으며, 이러한 구성들은 유전자의 5' 또는 3' 부분에 위치할 수 있다. 보존적 프로모터 및 유도적 프로모터 둘 다 포함된다. 프로모터 서열은 원핵생물, 진핵생물 또는 바이러스로부터 유래될 수 있다.
본 발명에서, 용어 "형질전환체"는 하나 이상의 목적 단백질을 암호화하는 폴리뉴클레오타이드를 갖는 벡터가 숙주세포에 도입되어 형질전환된 세포를 의미하고, 발현 벡터를 숙주세포에 도입하여 형질전환체를 제조하기 위한 방법으로는 문헌(Sambrook, J., et al., Molecular Cloning, A Laboratory Manual(2판), Cold Spring Harbor Laboratory, 1. 74, 1989)에 기재된 인산칼슘법 또는 염화캄슘/염화루비듐법, 일렉트로포레이션법(electroporation), 전기주입법(electroinjection), PEG 등의 화학적 처리방법, 유전자 총(gene gun) 등을 이용하는 방법 등이 있다.
상기 벡터가 발현되는 형질전환체를 영양배지에서 배양하면 항체 단백질을 대량으로 제조, 분리 가능하다. 배지와 배양조건은 숙주 세포에 따라 관용되는 것을 적절히 선택하여 이용할 수 있다. 배양시 세포의 생육과 단백질의 대량 생산에 적합하도록 온도, 배지의 pH 및 배양시간 등의 조건들을 적절하게 조절하여야 한다.
본 발명에 따른 벡터는 항체의 생산을 위해 숙주세포, 바람직하게는 포유동물 세포에 형질전환 시킬 수 있다. 완벽한 글리코실화된 단백질을 발현할 수 있는 적합한 숙주 세포주의 수는 당해 분야에서 개발되어 왔으며 COS-1(예를 들면, ATCC CRL 1650), COS-7(예를 들면, ATCC CRL-1651), HEK293, BHK21(예를 들면, ATCC CRL-10), CHO(예를 들면, ATCC CRL 1610) 및 BSC-1(예를 들면, ATCC CRL-26) 세포주, Cos-7 세포, CHO 세포, hep G2 세포, P3X63Ag8653, SP2/0-Agl4, 293 세포, HeLa 세포 등을 포함하며, 이들 세포는 예를 들면, ATCC(American Type Culture Collection, 미국)으로부터 용이하게 이용가능하다. 바람직한 숙주 세포는 흑색종 및 림프종 세포와 같은 림프구 기원의 세포를 포함한다.
CD22를 표적으로 하는 키메라항원 수용체(Chimeric antigen receptor)
본 발명은 다른 관점에서,
CD22-결합 도메인;
막관통 도메인(transmembrane domain);
공동자극 도메인(costimulatory domain); 및
세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메릭 항원 수용체(chimeric antigen receptor: CAR)로,
상기 CD22-결합 도메인은 (a) 서열번호 1의 아미노산으로 표시되는 CDR1 영역, 서열번호 2의 아미노산으로 표시되는 CDR2 영역 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역, 서열번호 5의 아미노산으로 표시되는 CDR2 영역 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(b) 서열번호 11의 아미노산으로 표시되는 CDR1 영역, 서열번호 12의 아미노산으로 표시되는 CDR2 영역 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역, 서열번호 15의 아미노산으로 표시되는 CDR2 영역 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(c) 서열번호 21의 아미노산으로 표시되는 CDR1 영역, 서열번호 22의 아미노산으로 표시되는 CDR2 영역 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역, 서열번호 25의 아미노산으로 표시되는 CDR2 영역 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
(d) 서열번호 31의 아미노산으로 표시되는 CDR1 영역, 서열번호 32의 아미노산으로 표시되는 CDR2 영역 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역, 서열번호 35의 아미노산으로 표시되는 CDR2 영역 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편; 또는
(e) 서열번호 41의 아미노산으로 표시되는 CDR1 영역, 서열번호 42의 아미노산으로 표시되는 CDR2 영역 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역, 서열번호 45의 아미노산으로 표시되는 CDR2 영역 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편이다.
본 발명에서, 용어 "키메릭 항원 수용체 (CAR)"는 일반적으로 항원 및 하나 이상의 세포 내 도메인과 결합하는 능력을 갖는 세포 외 도메인을 함유하는 융합 단백질을 지칭한다. CAR는 키메릭 항원 수용체 T 세포(CAR-T)의 핵심 부분이며, 항원 결합 도메인, 막 관통 도메인, 공동 자극 도메인 및 세포 내 신호전달 도메인을 포함할 수 있다. CAR는 항체의 항원(예를 들어, CD22) 특이성에 기초하여 T 세포 수용체-활성화 세포 내 도메인과 조합될 수 있다. 유전자가 변형된 CAR-발현 T 세포는 표적 항원-발현 악성 세포를 특이적으로 식별하고 제거할 수 있다.
본 발명에서, 용어 "CD22-결합 도메인(CD22-binding domain)"은 일반적으로 CD22 단백질에 특이적으로 결합할 수 있는 도메인을 지칭한다. 예를 들어, CD22-결합 도메인은 B 세포에서 발현된 인간 CD22 폴리펩타이드 또는 이의 단편에 특이적으로 결합할 수 있는 항-CD22 항체 또는 이의 단편을 함유할 수 있다.
본 발명에서, 용어 "결합 도메인(binding domain)"은 "세포 외 도메인(extracellular domain)", "세포 외 결합 도메인(extracellular binding domain)", "항원-특이적 결합 도메인(antigenspecific binding domain)" 및 "세포 외 항원-특이적 결합 도메인(extracellular antigen-specific biding domain)"은 상호 교환적으로 사용될 수 있으며, 표적 항원(예를 들어, CD22)에 특이적으로 결합하는 능력을 갖는 CAR 도메인 또는 단편을 지칭한다.
본 발명에 있어서, 상기 항-CD22 항체 또는 이의 단편은 상술한 항-CD22 항체로, 단클론 항체(monoclonal antibody), 바람직하게는 scFv(single chain variable fragment)이다. 구체적으로, 본 발명의 CD22에 특이적인 1C2, 9E9, 2A9, 2G1 또는 6B3 항체를 이용하여 제조할 수 있으며, 본 발명에서는 바람직하게 1C2, 9E9, 2G1 또는 6B3 항체를 사용하였다.
본 발명에 있어서, CD22-결합 도메인의 N 말단에 신호 펩타이드(signal peptide)를 추가로 포함할 수 있으며, 상기 "신호 펩타이드(signal peptide)"는 일반적으로 단백질 전달을 안내하기 위한 펩타이드 사슬을 지칭한다. 신호 펩타이드는 5 내지 30 개의 아미노산 길이를 갖는 짧은 펩타이드일 수 있으며, 본 발명에서는 바람직하게 서열번호 70의 아미노산 서열을 이용하였다.
본 발명에 있어서, CD22-결합 도메인의 C 말단 및 막관통 도메인의 N 말단 사이에 위치된 힌지 부위(hinge region)를 추가로 포함할 수 있으며, 상기 힌지 부위는 CD8α 유래로, 바람직하게는 서열번호 71의 아미노산 서열로 표시될 수 있다. 상기 "힌지 부위(hinge region)"는 일반적으로 항원-결합 영역과 면역 세포 Fc 수용체 (FcR)-결합영역 사이의 연결 영역을 지칭한다.
본 발명에 있어서, "막관통 도메인(transmembrane domain)"은 일반적으로 세포막을 통과하고 세포 내 신호전달 도메인에 연결되어 신호전달의 역할을 하는 CAR의 도메인을 지칭한다. 상기 막관통 도메인은 CD8α, CD4, CD28, CD137, CD80, CD86, CD152 및 PD1로 구성된 군에서 선택되는 단백질로부터 유래될 수 있으며, 바람직하게는 서열번호 72의 아미노산 서열로 표시될 수 있다.
본 발명에 있어서, "공동 자극 도메인(costimulatory domain)"은 일반적으로 림프구의 항원에 대한 효과적인 반응에 필요한 세포 표면 분자인 면역 자극 분자를 제공할 수 있는 세포 내 도메인을 지칭한다. 상기 기재된 공동자극 도메인(costimulatory domain)은 CD28의 공동 자극 도메인을 포함할 수 있고, OX40 및 4-1BB의 공동 자극 도메인과 같은 TNF 수용체 패밀리의 공동 자극 도메인을 포함할 수 있으며, 바람직하게는 서열번호 73의 아미노산 서열로 표시되는 4-1BB일 수 있다.
본 발명에 있어서, "세포 내 신호전달 도메인(intracellular signal transduction domain)"은 일반적으로 세포 내부에 위치하고 신호를 전달할 수 있는 도메인을 지칭한다. 본 발명에서, 세포 내 신호전달 도메인은 키메라 항원 수용체의 세포 내 신호전달 도메인이다. 예를 들어, 세포 내 신호전달 도메인은 CD3ζ 세포 내 도메인, CD28 세포 내 도메인, CD28 세포 내 도메인, 4-1BB 세포 내 도메인 및 OX40 세포 내 도메인으로부터 선택될 수 있으며, 바람직하게는 서열번호 74의 아미노산 서열로 표시되는 CD3ζ일 수 있다.
키메릭 항원 수용체 코딩 폴리뉴클레오타이드 및 키메릭 항원 수용체 발현 벡터
본 발명은 또 다른 관점에서, 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드에 관한 것이다.
본 발명에 있어서, 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드는 CD22-결합 도메인을 코딩하는 폴리뉴클레오타이드; 막관통 도메인을 코딩하는 폴리뉴클레오타이드; 공동 자극 도메인을 코팅하는 폴리뉴클레오타이드; 및 세포 내 신호전달 도메인을 코딩하는 폴리뉴클레오타이드를 포함할 수 있다.
상기 CD22-결합 도메인을 코딩하는 폴리뉴클레오타이드는 본 발명의 CD22에 특이적인 1C2, 9E9, 2A9, 2G1 또는 6B3 항체, 바람직하게는 1C2, 9E9, 2G1 또는 6B3 항체를 코딩하는 폴리뉴클레오타이드일 수 있으며, 경쇄가변부위 및 중쇄가변부위가 링커로 연결된 scFv 형태로, 구체적인 염기서열은 상술한 바와 같다.
바람직하게, 본 발명의 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드는, 서열번호 64의 염기서열로 표시되는 신호 펩타이드;
서열번호 54의 염기서열로 표시되는 1C2 항체, 서열번호 56의 염기서열로 표시되는 9E9 항체, 서열번호 60의 염기서열로 표시되는 2G1 항체 또는 서열번호 62의 염기서열로 표시되는 6B3 항체;
서열번호 66의 염기서열로 표시되는 막관통 도메인;
서열번호 67의 염기서열로 표시되는 4-1BB(공동자극 도메인); 및
서열번호 68의 염기서열로 표시되는 CD3ζ(세포 내 신호전달 도메인)로 구성될 수 있다.
또한, CD22-결합 도메인을 코딩하는 폴리뉴클레오타이드 및 막관통 도메인 사이에, 힌지 부위(hinge region)를 코딩하는 폴리뉴클레오타이드가 추가로 포함될 수 있으며, 바람직하게 서열번호 65의 염기서열로 표시되는 CD8 힌지 부위일 수 있다.
본 발명은 또 다른 관점에서, 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 포함하는 벡터에 관한 것이다.
본 발명의 구체적인 구현예에서, 상기 벡터는 재조합 바이러스 벡터로, 바람직하게는 렌티바이러스 벡터이며, 작동 가능하게 연결된 EF1α 프로모터; 시그널 펩타이드를 코딩하는 폴리뉴클레오타이드; CD22-결합 도메인을 코딩하는 폴리뉴클레오타이드; 막관통 도메인을 코딩하는 폴리뉴클레오타이드; 세포 내 신호전달 도메인을 코딩하는 폴리뉴클레오타이드를 포함하며, 단백질 발현을 증가시키기 위해 WPRE(woodchuck hepatitis virus post-transcriptional regulatory element)를 추가로 포함할 수 있다 (도 2).
상기 EF1α 프로모터는 서열번호 63의 염기서열로 표시될 수 있으며, 필요에 따라 상기 서열번호 63의 염기서열과 90% 이상, 93% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 또는 99% 이상 동일한 서열을 포함할 수 있다.
또한, 상기 프로모터는 CD22-결합 도메인인 항-CD22 항체(scFv)의 발현을 유도하도록 작동 가능하게 연결되어 있다.
숙주 세포 내로 폴리뉴클레오티드를 도입하기 위한 생물학적 방법은 DNA 및 RNA 벡터의 사용을 포함한다. 바이러스 벡터, 및 특히 레트로바이러스 벡터는 유전자를 포유동물, 예를 들어 인간 세포 내로 삽입하기 위해 가장 널리 사용되는 방법이 되었다. 다른 바이러스 벡터는 렌티바이러스, 폭스바이러스, 단순 포진 바이러스, 아데노바이러스 및 아데노-연관 바이러스 등으로부터 유래될 수 있다.
숙주 세포 내로 폴리뉴클레오티드를 도입하기 위한 화학적 수단은 콜로이드성 분산액 시스템, 예를 들면, 거대분자 복합체, 나노캡슐, 마이크로구체, 비드, 및 수중유 에멀젼, 미셀, 혼합된 미셀, 및 리포솜을 비롯한 지질-기반 시스템을 포함한다. 시험관 내 및 생체 내에서 전달 비히클로서 사용하기 위한 예시적인 콜로이드성 시스템은 리포솜(예를 들면, 인공 막 소포)이다. 핵산의 최신 기술의 표적화된 전달, 예를 들면, 표적화된 나노입자 또는 다른 적합한 마이크로미터-미만 크기의 전달 시스템을 사용한 폴리뉴클레오티드의 전달을 위한 다른 방법이 이용 가능하다.
비-바이러스 전달 시스템이 이용되는 경우에, 예시적인 전달 비히클은 리포솜이다. 지질 제제의 사용은 숙주세포 내로의 핵산의 도입(시험관 내, 생체 외 또는 생체 내)을 위해 고려된다. 또 다른 측면에서, 핵산은 지질과 회합될 수 있다. 지질과 회합된 핵산은 리포솜의 수성 내부에 캡슐화되거나, 리포솜의 지질 이중층 내에 점재되거나, 리포솜 및 올리고뉴클레오티드 둘 다와 회합된 연결 분자를 통해 리포솜에 부착되거나, 리포솜 내에 포획되거나, 리포솜과 복합체화되거나, 지질 함유 용액 중에 분산되거나, 지질과 혼합되거나, 지질과 조합되거나, 지질 내에 현탁액으로서 함유되거나, 미셀과 함께 함유 또는 복합체화되거나, 또는 지질과 달리 회합될 수 있다. 지질, 지질/DNA 또는 지질/발현 벡터 회합 조성물은 용액 중의 임의의 특정한 구조로 제한되지 않는다.
키메릭 항원 수용체(CAR) 발현 면역 이펙터 세포
본 발명은 또 다른 관점에서, 상기 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 포함하는 벡터를 포함하고, 상기 키메릭 항원 수용체(CAR)를 발현하는 면역 이펙터 세포에 관한 것이다.
본 발명에 있어서, 상기 면역 이펙터 세포는 포유동물 유래 세포 일 수 있으며, 바람직하게는 T 세포 또는 자연 살해(NK) 세포일 수 있다.
본 발명에 있어서, 상기 키메릭 항원 수용체(CAR)를 발현하는 면역 이펙터 세포는 본 발명의 CAR 벡터를 면역 이펙터 세포, 예를 들어 T 세포 또는 NK 세포 내로 도입시켜 제조할 수 있다.
구체적으로, CAR 벡터는 전기천공법, 리포펙타민(lipofectamine 2000, Invitrogen) 등과 같은 당업계에 공지된 방법에 의해 세포 내로 도입될 수 있다. 예를 들어, 면역 이펙터 세포는 렌티바이러스 벡터에 의해 형질 감염되어 CAR 분자를 운반하는 바이러스 게놈을 숙주 게놈에 통합시켜 표적 유전자의 장기적이고 안정적인 발현을 보장할 수 있다. 다른 예를 들어, 전이인자(transposon)는 CAR 운반 플라스미드(transposon) 및 전이효소 운반 플라스미드를 표적 세포 내로 도입하는데 이용될 수 있다. 다른 예를 들어, CAR 분자는 유전자 편집방법(예를들면, CRISPR / Cas9)에 의해 게놈에 첨가될 수 있다.
본 발명의 구체적인 일실시예에서는 도 2에 나타난 바와 같이 CD22-CAR를 코팅하는 폴리뉴클레오타이드가 삽입된 렌티바이러스 벡터를 제조하였으며, 제조된 벡터를 T 세포에 형질전환 시켜 CD22-CAR-T 세포를 제조하였다. 제조된 CD22-CAR-T 세포에서는 본 발명의 CD22를 표적으로 하는 키메라 항원 수용체를 발현하게 된다.
키메릭 항원 수용체(CAR)를 발현하는 면역 이펙터 세포 제조를 위한 면역 이펙터 세포는 대상체로 부터 수득할 수 있으며, 상기 "대상체"는 면역 반응이 도출될 수 있는 살아있는 유기체 (예를 들어, 포유동물)를 포함한다. 대상체의 예는 인간, 개, 고양이, 마우스, 래트, 및 그의 트랜스제닉 종을 포함한다. T 세포는 말초 혈액 단핵 세포, 골수, 림프절 조직, 제대혈, 흉선 조직, 감염 부위로부터의 조직, 복수, 흉막 삼출, 비장 조직, 및 종양을 비롯한 수많은 공급원으로부터 수득될 수 있다.
상기 T 세포는 통상의 기술자에게 공지된 임의의 많은 기술, 예를 들면, 피콜(Ficoll)™ 분리를 사용하여 대상체로부터 수집된 혈액 단위로부터 수득될 수 있다. 혈액으로부터 세포는 분리반출술에 의해 수득되며, 분리반출술 생성물은 전형적으로 T 세포, 단핵구, 과립구, B 세포를 비롯한 림프구, 다른 유핵 백혈구, 적혈구, 및 혈소판을 함유한다.
분리반출술에 의해 수집된 세포는 혈장 분획을 제거하고 세포를 후속 프로세싱 단계를 위해 적절한 완충제 또는 배지에 두기 위해 세척될 수 있다. T 세포는 적혈구를 용해시키고, 예를 들어 퍼콜(PERCOLL)™ 구배를 통한 원심분리에 의해 또는 역류 원심 분리에 의해 단핵구를 고갈시킴으로써 말초 혈액 림프구로부터 단리된다.
본 발명의 구체적인 일구현예에서, 도 3에 나타난 바와 같이, 말초 혈액 단핵세포(peripheral blood mononuclear cell, PBMC)로 부터 활성화된 T 세포를 분리한 다음, CD22-CAR 렌티바이러스를 T 세포에 형질도입시켜 CD22-CAR-T 세포를 제조하였다. 제조된 CD22-CAR-T 세포의 CD22-펩타이드 결합능을 확인한 결과, 도 4에 나타난 바와 같이, CD22-펩타이드 증가에 따라, CD4 또는 CD8를 발현하는 CD22-CAR-T 세포가 증가하는 것을 확인하였다. 이는 본 발명에서 제조한 CD22-CAR-T 세포가 효과적으로 CD22와 결합하는 것을 의미한다.
본 발명의 구체적인 다른 일구현예에서, CD22-CAR-T 세포의 활성화를 확인하기 위해, 표적 세포의 존재 하에 CD22-CAR-T 세포에 의한 IFNγ 발현 정도를 확인하였다. 그 결과 도 5a 내지 도 5d에 나타난 바와 같이, CD22를 발현하지 않는 K562 세포에서는 T 세포가 활성화되지 않은 반면, CD22를 발현하는 U2932 세포의 존재 하에 T 세포가 활성화되어 IFNγ 발현이 증가하는 것을 확인하였다.
본 발명의 구체적인 또 다른 일구현예에서, CD22-CAR-T 세포에 의한 표적 세포의 사멸효과를 확인한 결과, 도 6에 나타난 바와 같이, CD22-CAR-T 세포는 CD22를 발현하는 U2932 세포에 대한 사멸 효과를 보이는 것을 확인하였다.
즉, 본 발명의 CD22를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포는 B 세포 또는 CD22 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.
CD22 발현에 의해 매개되는 질환 예방 또는 치료용 조성물
본 발명은 또 다른 관점에서, CD22에 특이적으로 결합하는 항체 또는 CD22를 표적하는 키메라 항원 수용체를 발현하는 면역 이펙터 세포를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
본 발명에 있어서, CD22를 발현하는 세포에 의해 매개되는 질환은 림프종, 비호치킨 림프종(non-Hogkins lymphoma: NHL), 공격적 NHL, 재발성 공격적 NHL, 재발성 지연성 NHL, 불응성 NHL, 불응성 지연성 NHL, 만성 림프성 백혈병(chronic lymphocytic leukemia: CLL), 소형 림프성 림프종, 백혈병, 모발성 세포 백혈병(hairy cell leukemia: HCL), 급성 림프성 백혈병(acute lymphocytic leukemia: ALL), 버킷트 림프종 및 외투 세포 림프종로 구성된 군에서 선택될 수 있다.
본 발명에 있어서, 상기 조성물은 CD22를 발현하는 세포에 의해 매개되는 질환의 치료제를 포함할 수 있으며, 상기 치료제는 CD22에 특이적으로 결합하는 항체의 중쇄 및/또는 경쇄에 공유결합된 상태로 존재하거나, 본 발명의 CD22에 특이적인 항체 또는 CD22-CAR-T 세포와 병용투여할 수 있다.
상기 치료제는 저분자 약물, 펩타이드성 약물, 독소(예를 들어, 세포독소) 등을 포함한다.
상기 저분자 약물는 관심대상의 약제학적 활성을 나타내고, 일반적으로 분자량이 약 800 Da 이하또는 2000 Da 이하의 화합물일 수 있다. 무기 저분자는 탄소원자를 하나도 포함하지 않은 분자를 가리키고, 반면 유기저분자는 최소한 하나의 탄소원자를 함유하는 화합물을 가리킨다.
상기 펩타이드성 약물은 중합체성 화합물을 함유하는 아미노산을 가리키고, 이것은 자연발생 및 비-자연발생 펩타이드, 올리고펩타이드, 환형 펩타이드, 폴리펩타이드 및 단백질, 뿐만 아니라 펩타이드 모방물을 포함한다. 상기 펩타이드 약물은 화학적 합성에 의해 획득되거나 또는 유전적으로 인코딩된 공급원(예를 들어, 재조합공급원)에서 생성될 수 있다. 펩타이드 약물의 분자량의 범위는 200 Da 내지 10 kDa 또는 그 이상일 수 있다.
상기 독소는 바람직하게 세포독소이며, 세포독소에는 비제한적으로, 리신, 아브린, 디프테리아 독소, 슈도모나스 균체외독소(예를 들어, PE35, PE37, PE38, PE40 등), 사포린, 겔로닌, 미국자리공 항바이러스 단백질(PAP), 보툴리눔 독소, 브리오딘, 모모르딘 및 부가닌이 포함된다.
또한, 상기 치료제는 항암제일 수 있다. 항암제는 암 세포의 증식을 감소시키고, 세포독성 약제 및 세포 증식 억제제를 아우르는 비-펩타이드성(즉, 비-단백질계) 화합물을 포함한다. 항암제의 비제한적인 예는 알킬화제, 니트로소요소, 항대사물질, 항종양 항생물질, 식물 (빈카) 알칼로이드 및 스테로이드 호르몬을 포함한다. 펩타이드성 화합물 또한 사용될 수 있다.
상기 약학적 조성물에서 CD22에 특이적으로 결합하는 항체 또는 CD22를 표적하는 키메라 항원 수용체를 발현하는 면역 이펙터 세포는 치료 또는 진단용 조성물 내에서 유일한 활성성분이거나, 또는 예를 들면, 항-T 세포, 항-IFNγ 또는 항-LPS 항체와 같은 다른 항체성분들, 또는 크산틴과 같은 비항체 성분들을 포함하는 다른 활성성분들과 함께 사용 가능하다.
약제 조성물은 치료적 유효량의 본 발명의 항체를 포함하는 것이 바람직하다. 여기에서 사용된 용어 "치료적 유효량"은 목표 질환 또는 상태를 치료, 개선 또는 예방하는 데 필요한 치료제의 양을 의미하고, 또는 감지할 수 있는 정도의 치료 또는 예방효과를 나타내는 데 필요한 치료제의 양을 뜻한다. 어떤 항체에 대하여, 치료적 유효 투여량은 세포배양 분석법 또는 보통 설치류, 토끼, 개, 돼지 또는 영장류와 같은 동물 모델로 최초로 결정될 수 있다. 동물 모델은 또한 적절한 농도범위와 투여루트를 결정하는 데 사용될 수 있다. 이러한 정보는 인간의 투약을 위해 유용한 투여량 및 루트를 결정하는 데 사용될 수 있다.
인간환자를 위한 정밀한 유효량은 질환상태의 심각도, 환자의 일반적 건강 상태, 환자의 나이, 체중 및 성별, 식이요법, 투여시간, 투여빈도, 약제조성, 반응감도 및 치료에 대한 내성/반응에 따라 달라질 수 있다. 상기 양은 통상적인 실험에 의해 결정될 수 있고, 임상의사의 판단의 범위 내에 있다. 일반적으로, 유효 투여량은 0.01~50mg/kg, 바람직하게는 0.1~20mg/kg, 더욱 바람직하게는 약 15mg/kg이다.
조성물은 환자에게 개별적으로 투여되거나, 또는 다른 제제, 약제 또는 호르몬과 조합하여 투여될 수 있다.
본 발명의 항체가 투여되는 투여량은 치료될 상태의 성질, 악성 림프종 또는 백혈병의 등급, 및 항체가 질환 예방 차원에서 사용되는지 또는 현존하는 상태를 치료하기 위해 사용되는지에 따라 달라진다.
투여빈도는 항체분자의 반감기, 약 효과의 지속성에 따라 달라진다. 만약 항체분자가 짧은 반감기(예, 2~10시간)를 가지면, 하루당 1회 또는 그 이상의 투여량을 제공할 필요가 있다. 또는, 항체분자가 긴 반감기(예, 2~15일)를 가지면, 하루에 한번, 일주일에 한차례, 또는 매 1개월 또는 2개월당 한차례의 투여량을 제공할 필요가 있다.
또한, 약제 조성물은 항체의 투여를 위하여 약제학적으로 허용가능한 담체를 함유할 수 있다. 담체는 그 자신이 조성물을 투여받는 개체에 유해한 항체의 생성을 유발해서는 안되고, 독성이 없어야만 한다. 적당한 담체로는 단백질, 폴리펩타이드, 리포오좀, 다당류, 폴리락틱산, 폴리글리콜산, 아미노산 중합체, 아미노산 공중합체 및 비활성 바이러스 입자들과 같은, 서서히 물질대사되는 거대분자일 수 있다.
약제학적으로 허용가능한 염들은, 예를 들면, 염화수소산염, 브롬화수소산염, 인산염 및 황산염과 같은 미네랄산염들, 또는 아세트산, 프로피온산. 말론산 및 벤조산 같은 유기산의 염들이 사용될 수 있다.
치료 조성물내의 약제학적으로 허용가능한 담체는 부가적으로, 물, 식염수, 글리세롤 및 에탄올과 같은 액체들을 포함할 수 있다. 부가적으로, 습윤제, 유화제 또는 pH 완충물질과 같은 보조 물질들이 이런한 조성물 내에 존재할 수 있다. 상기 담체는 환자에 의한 약제 조성물 섭취를 위해, 정제, 환약, 당의정, 캡슐, 액체, 겔, 시럽, 슬러리 및 현탁제로서 제제화될 수 있다.
투여를 위한 바람직한 형태는, 예로써 주사(injection) 또는 주입(infusion)(예를 들면, 환괴(bolus) 주사 또는 연속적 주입)에 의한 비경구적 투약에 적합한 형태를 포함한다. 생성물이 주입 또는 주사용일 경우에는, 오일 또는 수용성 부형제내의 현탁제, 용액 또는 에멀젼의 형태를 취할 수 있고, 이는 현탁제, 방부제, 안정화제 및/또는 분산제와 같은 처방제들을 포함할 수 있다. 또는, 항체분자는 무수형태일 수 있고, 사용전에 적절한 멸균액으로 재구성될 수 있다.
일단 제제화된 경우, 본 발명의 조성물은 환자에게 직접 투여될 수 있다. 치료받을 환자들은 동물일 수 있다. 그러나, 조성물은 인간 환자 투여를 위해 맞추는 것이 바람직하다.
본 발명의 약제 조성물은 제한은 없지만, 경구, 정맥, 근육내, 동맥내, 골수내, 척추강내, 심실내, 경피(transdermal), 경피(transcutaneous)(예, WO 98/20734 참조), 피하, 복강내, 비강내, 장내, 국소, 혀밑, 질내 또는 직장 경로를 포함하는 어떤 경로에 의해 투여될 수 있다. 본 발명의 약제 조성물을 투여하는 데 하이포스프레이(hypospray)가 사용될 수 있다. 전형적으로, 치료 조성물은 액체 용액 또는 현탁액으로서 주사가능한 물질로서 제조될 수 있다. 또한, 주입전에 액체 부형제내용액 또는 현탁액에 적합한 고체 형태가 제조될 수 있다.
조성물의 직접적인 전달은 일반적으로 주사, 피하주사, 복강내주사, 정맥내주사, 근육내주사에 의해 이루어질 수 있거나, 또는 조직의 간질(interstitial) 공간으로 전달될 수도 있다. 또한, 조성물은 상처부위로 투여될 수 있다. 투여량 처리는 단일 복용 스케쥴 또는 다중 복용 스케쥴일 수 있다.
조성물 내의 활성성분은 항체분자일 수 있다. 그 자체로, 위장관내에서 분해에 민감할 수 있다. 따라서, 조성물이 위장관을 사용하는 경로에 의해 투여되면, 조성물은, 분해로부터 항체를 보호하지만 일단 위장관으로부터 흡수된 항체를 방출시키는 제제를 함유할 필요가 있을 것이다.
약제학적으로 허용가능한 담체의 완벽한 논의는 레밍톤 약제학지(Remington's Pharmaceutical Sciences)(Mack Publishing Company, NJ, 1991)를 이용할 수 있다.
CD22를 발현하는 세포에 의해 매개되는 질환의 진단 또는 모니터링
본 발명은 또 다른 관점에서, CD22에 특이적으로 결합하는 항체를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 진단 또는 모니터링용 조성물에 관한 것이다.
상기 CD22에 특이적으로 결합하는 항체는 직접적으로 또는 간접적으로 표지될 수 있다. 간접적 표지는 검출가능 표지를 포함하는 2차 항체를 포함하는데, 여기서 2차 항체가 CD22에 특이적으로 결합하는 항체에 결합한다. 다른 간접적 표지는 바이오틴을 포함하는데, 여기서 바이오티닐화된 CD22에 특이적으로 결합하는 항체는 검출가능 표지를 포함하는 아비딘 또는 스트렙트아비딘을 사용하여 검출될 수 있다.
적절한 검출가능 표지는 분광분석적, 광화학적, 생화학적, 면역화학적, 전기적, 광학적 또는 화학적 수단에 의해 검출가능한 모든 조성물을 포함한다. 적절한 표지는, 비제한적으로, 자석 비드, 형광염료(예를 들어, 플루오레세인이소티오시안산염, 텍사스 레드, 로다민, 초록 형광 단백질, 적색 형광 단백질, 황색 형광 단백질 등), 방사성 표지(예를 들어, 3H, 125I, 35S, 14C또는 32P), 효소(예를 들어, 겨자무과산화효소, 알칼린 포스파타아제, 루시퍼라아제 및 효소-연결 면역흡착검사(ELISA)에 일반적으로 사용되는 것들) 및 콜로이드성 골드 또는 착색 유리 또는 플라스틱(예를 들면, 폴리스티렌, 폴리프로필렌, 라텍스 등) 비드와 같은 표색계 표지를 포함한다.
또한, 진단 또는 모니터링을 위해 상기 항체는 형광 단백질로 표지될 수 있으며, 조영제 또는 방사선 동위원소를 포함할 수 있다.
본 발명의 CD22에 특이적으로 결합하는 항체를 진단 키트에 이용하는 경우, 상기 항체는 지지체에 고정되어 있으며, 상기 지지체는 마이크로플레이트, 마이크로어레이, 칩, 유리, 비드 또는 입자, 또는 멤브레인 일 수 있다.
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
실시예 1: CD22에 특이적으로 결합하는 항체 제조 및 선별
CD22 펩타이드 특이적인 항체를 선별하기위해, CD22와 결합하는 항체를 생산하는 하이브리도마를 제조하여 항체를 선별하였다.
먼저, CD22 단백질(ACRObiosystems Inc., cat#CD2-H52H8, 미국)을 면역하여 비장세포를 적출하고 마우스 골수증세포와 세포 융합을 통하여 하이브리도마 세포를 제작하였다.
세포 융합에 이용하는 마우스 골수종 세포는 HGPRT(HypoxanthineGuanidine-Phosphoribosyl-Transferase)를 가지고 있지 않기 때문에 HAT 배지에서는 생존할 수 없으나, 하이브리도마는 비장세포와 융합함으로써 HAT 배지에서 생존할 수 있다. 이를 이용하면 하이브리도마만을 증식시킬 수 있으므로, 통상 하이브리도마를 확립시킬때까지 HAT 배지에서 증식시켰다.
증식된 하이브리도마 중에서 CD22와 결합하는 항체를 생산하는 하이브리도마를 선별하기 위해 한계희석법을 사용하였다. 우선 96웰당 1개 세포 이하가 되도록 한 다음, 1개의 세포로부터 증식된 클론에서 얻어진 항체가 CD22와 결합하는지를 ELISA로 확인하고 CD22와 결합하는 클론을 선별하였다. 상기과정을 3회 반복하여 CD22와 결합하는 항체를 생산하는 하이브리도마를 선별하였다. 이와 같은 방법으로 CD22에 결합하는 5종의 항체를 수득하였다.
상기 5종의 항체는 각각 1C2, 9E9, 2A9, 2G1 및 6B3로 명명하였으며, 이들의 염기서열과 아미노산 서열을 분석하였다. 서열분석 결과에 따른 각 항체의 중쇄 가변부위 및 경쇄 가변부위에 대한 서열정보는 하기 표 1 내지 표 5에 나타내었으며, 하기 표 1 내지 5에서 밑줄친 부분은 상보적 결정 부위(complementarity determining region; CDR)를 의미한다.
1C2 항체의 서열정보
1C2 서열정보 서열번호
중쇄가변부위 CDR1 GYTFTSYWMNW 서열번호 1
중쇄가변부위 CDR2 IDPSDSET 서열번호 2
중쇄가변부위 CDR3 ARWGNYDYDVWAMDY 서열번호 3
경쇄가변부위 CDR1 QNIVHLNGNTF 서열번호 4
경쇄가변부위 CDR2 KVS 서열번호 5
경쇄가변부위 CDR3 FQGSHVPYT 서열번호 6
중쇄가변부위
아미노산서열		 QVQLQQPGAELVRPGASVKLSCKAS GYTFTSYWMNW VKQRPGQGLEWIGM IDPSDSET HYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYC ARWGNYDYDVWAMDY WGQGTSVTVSS 서열번호 7
경쇄가변부위
아미노산서열		 DVLMTQTPLSLPVSLGDQASISCRSS QNIVHLNGNTF LEWFLQKPGQSPKLLIY KVS NRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYC FQGSHVPYT FGGGTKLEIK 서열번호 8
중쇄가변부위
염기서열		 CAGGTGCAGCTGCAGCAGCCCGGCGCCGAGCTGGTGAGGCCCGGCGCCAGCGTGAAGCTGAGCTGCAAGGCCAGCGGCTACACCTTCACCAGCTACTGGATGAACTGGGTGAAGCAGAGGCCCGGCCAGGGCCTGGAGTGGATCGGCATGATCGACCCCAGCGACAGCGAGACCCACTACAACCAGATGTTCAAGGACAAGGCCACCCTGACCGTGGACAAGAGCAGCAGCACCGCCTACATGCAGCTGAGCAGCCTGACCAGCGAGGACAGCGCCGTGTACTACTGCGCCAGGTGGGGCAACTACGACTACGACGTGTGGGCCATGGACTACTGGGGCCAGGGCACCAGCGTGACCGTGAGCAGC 서열번호 9
경쇄가변부위
염기서열		 GACGTGCTGATGACCCAGACCCCCCTGAGCCTGCCCGTGAGCCTGGGCGACCAGGCCAGCATCAGCTGCAGGAGCAGCCAGAACATCGTGCACCTGAACGGCAACACCTTCCTGGAGTGGTTCCTGCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACAAGGTGAGCAACAGGTTCAGCGGCGTGCCCGACAGGTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGAAGATCAGCAGGGTGGAGGCCGAGGACCTGGGCGTGTACTACTGCTTCCAGGGCAGCCACGTGCCCTACACCTTCGGCGGCGGCACCAAGCTGGAGATCAAG 서열번호 10
9E9 항체의 서열정보
9E9 서열정보 서열번호
중쇄가변부위 CDR1 GYAFSIYW 서열번호 11
중쇄가변부위 CDR2 IYPGDGDT 서열번호 12
중쇄가변부위 CDR3 ARRGITPWFAY 서열번호 13
경쇄가변부위 CDR1 QSLLNSSNQKNY 서열번호 14
경쇄가변부위 CDR2 FAS 서열번호 15
경쇄가변부위 CDR3 CQQHYSTPLT 서열번호 16
중쇄가변부위
아미노산서열		 EVQLEESGAELVRPGSSVKISCKAS GYAFSIYWMNWVKQRPGQGLEWIGQ IYPGDGDT NYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFC ARRGITPWFAY WGQGTLVTVSA 서열번호 17
경쇄가변부위
아미노산서열		 DIVLTQSPSSLAMSVGQKVTMSCKSS QSLLNSSNQKNY LAWYQQKPGQSPKLLVY FAS TRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYF CQQHYSTPLT FGAGTKLELK 서열번호 18
중쇄가변부위
염기서열		 GAGGTTCAGCTGGAGGAGTCTGGGGCTGAGCTGGTGAGGCCTGGGTCCTCAGTGAAGATTTCCTGCAAGGCTTCTGGCTATGCATTCAGTATCTACTGGATGAACTGGGTGAAGCAGAGGCCTGGACAGGGTCTTGAGTGGATTGGACAGATTTATCCTGGAGATGGTGATACTAACTACAATGGAAAGTTCAAGGGTAAAGCCACACTGACTGCAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTAACATCTGAGGACTCTGCGGTCTATTTCTGTGCAAGGCGGGGGATTACGCCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA 서열번호 19
경쇄가변부위
염기서열		 GACATTGTGCTGACACAGTCTCCATCCTCCCTGGCTATGTCAGTAGGACAGAAGGTCACTATGAGCTGCAAGTCCAGTCAGAGCCTTTTAAATAGTAGCAATCAAAAGAACTATTTGGCCTGGTACCAGCAGAAACCAGGACAGTCTCCTAAACTTCTGGTATACTTTGCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTCATAGGCAGTGGATCTGGGACAGATTTCACTCTTACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGATTACTTCTGTCAGCAACATTATAGCACTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA 서열번호 20
2A9 항체의 서열정보
2A9 서열정보 서열번호
중쇄가변부위 CDR1 GYTFTTYP 서열번호 21
중쇄가변부위 CDR2 FHPYNDDT 서열번호 22
중쇄가변부위 CDR3 ARGDYYVSSWYFDV 서열번호 23
경쇄가변부위 CDR1 QNVGTN 서열번호 24
경쇄가변부위 CDR2 SAS 서열번호 25
경쇄가변부위 CDR3 QQYNSYPLT 서열번호 26
중쇄가변부위
아미노산서열		 EVQLEESGAELVKPGASVKMSCKAF GYTFTTYP IEWMKQNHGKSLEWIGN FHPYNDDT KYNEKFKGKAKLTVEKSSSTVYLELSRLTSDDSAVYYC ARGDYYVSSWYFDV WGAGTTVTVSS 서열번호 27
경쇄가변부위
아미노산서열		 DIVMTQSQKFMSTSVGDRVSVTCKAS QNVGTN VAWYQQKPGQSPKALIY SAS YRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFC QQYNSYPLT FGSGTKLEIK 서열번호 28
중쇄가변부위
염기서열		 GAGGTGCAGCTGGAGGAGAGCGGCGCCGAGCTGGTGAAGCCCGGCGCCAGCGTGAAGATGAGCTGCAAGGCCTTCGGCTACACCTTCACCACCTACCCCATCGAGTGGATGAAGCAGAACCACGGCAAGAGCCTGGAGTGGATCGGCAACTTCCACCCCTACAACGACGACACCAAGTACAACGAGAAGTTCAAGGGCAAGGCCAAGCTGACCGTGGAGAAGAGCAGCAGCACCGTGTACCTGGAGCTGAGCAGGCTGACCAGCGACGACAGCGCCGTGTACTACTGCGCCAGGGGCGACTACTACGTGAGCAGCTGGTACTTCGACGTGTGGGGCGCCGGCACCACCGTGACCGTGAGCAGC 서열번호 29
경쇄가변부위
염기서열		 GACATCGTGATGACCCAGAGCCAGAAGTTCATGAGCACCAGCGTGGGCGACAGGGTGAGCGTGACCTGCAAGGCCAGCCAGAACGTGGGCACCAACGTGGCCTGGTACCAGCAGAAGCCCGGCCAGAGCCCCAAGGCCCTGATCTACAGCGCCAGCTACAGGTACAGCGGCGTGCCCGACAGGTTCACCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAACGTGCAGAGCGAGGACCTGGCCGAGTACTTCTGCCAGCAGTACAACAGCTACCCCCTGACCTTCGGCAGCGGCACCAAGCTGGAGATCAAG 서열번호 30
2G1 항체의 서열정보
2G1 서열정보 서열번호
중쇄가변부위 CDR1 GFSLTSYDI 서열번호 31
중쇄가변부위 CDR2 IWTGGGT 서열번호 32
중쇄가변부위 CDR3 VPHYYGYAMDYW 서열번호 33
경쇄가변부위 CDR1 QDINKY 서열번호 34
경쇄가변부위 CDR2 YTS 서열번호 35
경쇄가변부위 CDR3 LQYDNLLT 서열번호 36
중쇄가변부위
아미노산서열		 EVQLQESGPGLVAPSQSLSITCTVS GFSLTSYDI SWIRQPPGKGLEWLGV IWTGGGT NYNSAFMSRLSISKDNSKSQVFLKMNSLQTDDTAIYYC VPHYYGYAMDYW GQGTSVTVSS 서열번호 37
경쇄가변부위
아미노산서열		 DIVLTQSPSSLSASLGGKVTITCKAS QDINKY IAWYQHKPGKGPRLLIH YTS TLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYC LQYDNLLT FGAGTKLELK 서열번호 38
중쇄가변부위
염기서열		 GAGGTGCAGCTGCAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGAGCCTGTCCATTACCTGCACTGTCTCTGGGTTCTCATTAACCAGCTATGATATAAGCTGGATTCGCCAGCCACCAGGAAAGGGTCTGGAGTGGCTTGGAGTAATATGGACTGGTGGAGGCACAAATTATAATTCAGCTTTCATGTCCAGACTGAGCATCAGCAAGGACAACTCCAAGAGCCAAGTTTTCTTAAAAATGAACAGTCTGCAAACTGATGACACAGCCATATATTACTGTGTCCCTCATTACTACGGCTATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA 서열번호 39
경쇄가변부위
염기서열		 GATATTGTGCTGACCCAGTCTCCATCCTCACTGTCTGCATCTCTGGGAGGCAAAGTCACCATCACTTGCAAGGCAAGCCAAGACATTAACAAGTATATAGCTTGGTACCAACACAAGCCTGGAAAAGGTCCTAGGCTGCTCATACATTACACATCTACATTACAGCCAGGCATCCCATCAAGGTTCAGTGGAAGTGGGTCTGGGAGAGATTATTCCTTCAGCATCAGCAACCTGGAGCCTGAAGATATTGCAACTTATTATTGTCTACAGTATGATAATCTGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA 서열번호 40
6B3 항체의 서열정보
6B3 서열정보 서열번호
중쇄가변부위 CDR1 GYTFTDYN 서열번호 41
중쇄가변부위 CDR2 IYPYNGGT 서열번호 42
중쇄가변부위 CDR3 ARLYYYGRTSYWG 서열번호 43
경쇄가변부위 CDR1 QNVGTY 서열번호 44
경쇄가변부위 CDR2 SAS 서열번호 45
경쇄가변부위 CDR3 HQYDSYPYT 서열번호 46
중쇄가변부위
아미노산서열		 EVQLQQSGPELVKPGASVKISCKAS GYTFTDYN MHWVKQSHGKSLEWIGY IYPYNGGT GYKQKFKSKATLTVDNSSSTAYMELRSLTSEDSAVYYC ARLYYYGRTSYWG QGTTLTVSS 서열번호 47
경쇄가변부위
아미노산서열		 DIVMTQSQKFMSTSVGDRVSVTCKAS QNVGTY VAWYQQKPGQSPKALIY SAS YRYSGVPDRFTGSGSGTDFTLTISIVQSEDLAEYFC HQYDSYPYT FGGGTKLEI 서열번호 48
중쇄가변부위
염기서열		 GAGGTGCAGCTGCAGCAGAGCGGCCCCGAGCTGGTGAAGCCCGGCGCCAGCGTGAAGATCAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACAACATGCACTGGGTGAAGCAGAGCCACGGCAAGAGCCTGGAGTGGATCGGCTACATCTACCCCTACAACGGCGGCACCGGCTACAAGCAGAAGTTCAAGAGCAAGGCCACCCTGACCGTGGACAACAGCAGCAGCACCGCCTACATGGAGCTGAGGAGCCTGACCAGCGAGGACAGCGCCGTGTACTACTGCGCCAGGCTGTACTACTACGGCAGGACCAGCTACTGGGGCCAGGGCACCACCCTGACCGTGAGCAGC 서열번호 49
경쇄가변부위
염기서열		 GACATCGTGATGACCCAGAGCCAGAAGTTCATGAGCACCAGCGTGGGCGACAGGGTGAGCGTGACCTGCAAGGCCAGCCAGAACGTGGGCACCTACGTGGCCTGGTACCAGCAGAAGCCCGGCCAGAGCCCCAAGGCCCTGATCTACAGCGCCAGCTACAGGTACAGCGGCGTGCCCGACAGGTTCACCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCATCGTGCAGAGCGAGGACCTGGCCGAGTACTTCTGCCACCAGTACGACAGCTACCCCTACACCTTCGGCGGCGGCACCAAGCTGGAGATCAAG 서열번호 50
실시예 2: 선별한 항체의 CD22에 대한 특이성 확인 - ELISA 분석
본 발명에서는 상기 실시예 1에서 확립한 1C2, 9E9, 2A9, 2G1 및 6B3 항체의 CD22에 대한 특이성을 확인하기 위해, ELISA 분석을 수행하였다.
먼저, CD22 펩타이드를 코딩하기 위해, CD22-His tag(CD22 extracellular domain; ACRObiosystems Inc.)를 100 ng/웰이 되도록 96-웰 플레이트에 분주한 다음, 4℃에서 하룻밤 동안 반응시켰다. 그 다음, 3% BSA가 포함된 1 X PBST를 처리한 후, 상온에서 30분 동안 블로킹시켰다.
1C2, 9E9, 2A9, 2G1 및 6B3 항체를 각 웰에 처리한 다음, 상온에서 2시간 동안 반응시킨 후, 1 X PBST로 3번 세척하였다. 2차 항체(anti-HRP, 1:10,000)를 처리하여 상온에서 30분 동안 반응시킨 후, 1 X PBST로 3번 세척한 다음, 발색을 위해 TMB를 처리하여 상온에서 5분 동안 반응시켰다. 마지막으로 1N H 2SO 4의 정지액(stop solution)을 처리하여 반응을 종료시킨 다음, 450nm에서 흡광도를 측정하였다.
ELISA 실험 조건
Immobilization Corning (Cat#. 3690)
Antigen CD22-His tag, 100 ng/well
Primary Ab 0.4 ㎍/㎖
Secondary Ab-HRP 1:10,000
TMB substrate incubation 5 min
Measurement filter 450nm
Plate reader Infinite F50
ELISA 실험 결과
항체 종류 OD450 측정값
1C2 2.4289
9E9 1.7581
2A9 2.9304
2G1 2.5395
6B3 1.7930
그 결과, 표 7에 나타난 바와 같이, 본 발명에서 선별한 항체가 모두 CD22에 특이적으로 결합하는 것을 확인하였다.
실시예 3: 선별한 항체의 CD22에 대한 특이성 확인 - FACS 분석
본 발명에서는 상기 실시예 1에서 확립한 1C2, 9E9, 2A9, 2G1 및 6B3 항체의 CD22에 대한 특이성을 확인하기 위해, FACS 분석을 수행하였다.
먼저, CD22를 발현하는 비세포림프종 U2932 (B-cell lymphoma U2932 cell)이 1x10 6개와 1C2, 9E9, 2A9, 2G1 및 6B3 항체 1 ㎍ 각각을 30분간 반응시킨 다음, 2차 항체로 표면(surface)을 염색한 후, 유세포분석기로 측정하였다.
양성대조군으로 PE-컨쥬게이션된 항-CD22 항체(PE-conjugated anti-CD22 antibody; Biolegend Inc., cat# 302506, 미국)를 사용하였으며, 2차 항체로는 PE-컨쥬게이션된 항-마우스 IgG 항체(PE-conjugated goat anti-mouse IgG; Biolegend Inc., cat# 405307, 미국)를 사용하였다.
그 결과, 도 1에 나타난 바와 같이 1C2, 9E9, 2A9, 2G1 및 6B3 항체 모두 CD22를 발현하는 세포와 특이적으로 결합하는 것을 확인하였다.
실시예 4: CD22를 표적으로 하는 키메라 항원 수용체(CAR) 발현 벡터 제작
본 발명에서는 상기 실시예 1에서 제조한 항체 중에서 CD22에 대한 특이성이 높은 1C2, 9E9, 2G1 및 6B3 항체를 이용하여, CD22를 표적으로 하는 키메라 항원수용체(CAR)를 발현하는 렌티바이러스 벡터(CD22-CAR 렌티바이러스)를 제조하였다.
도 2의 모식도에 나타난 바와 같이, EF1α 프로모터(서열번호 63); 시그널 펩타이드를 코딩하는 폴리뉴클레오타이드(서열번호 64); CD22-결합 도메인을 코딩하는 폴리뉴클레오타이드(서열번호 54로 표시되는 1C2, 서열번호 56으로 표시되는9E9, 서열번호 60으로 표시되는 2G1 또는 서열번호 62로 표시되는 6B3); CD8 힌지 부위를 코딩하는 폴리뉴클레오타이드(서열번호 65); 막관통 도메인을 코딩하는 폴리뉴클레오타이드(서열번호 66); 4-1BB(공동자극도메인)을 코딩하는 폴리뉴클레오타이드(서열번호 67); CD3ζ세포내신호전달도메인)을 코딩하는 폴리뉴클레오타이드(서열번호 68); 및 WPRE를 코딩하는 폴리뉴클레오타이드(서열번호 69)로 구성된 CAR DNA를 생체외(in vitro)에서 합성하여 3세대 렌티바이러스 벡터에 삽입하였다.
렌티바이러스 벡터는 pMDLg/pRRE(Addgene, cat# #12251) pMD2.G(Addgene, cat##12259), pRSV-Rev(Addgene, cat##12253)의 세 가지 벡터 함께 Lenti-X 293T 세포로 공동 감염(co-transfection)시킨 다음, CD22-CAR 렌티바이러스를 생산하였다. 공동 감염을 위해 Lipofectamine 3000 transfection kit(Invitrogen, cat# L3000-015)와 Opti-MEM+GlutaMAX(gibco, cat# 51985-034) 배지를 사용하여 세 가지 벡터와 Lenti-X 293T 세포를 6시간 배양하였다.
실시예 5: CD22-CAR-T 세포 제조
본 발명에서는 상기 실시예 4에서 제조한 CD22-CAR 렌티바이러스 벡터를 T 세포에 형질전환시켜 CD22-CAR-T 세포를 제조하였다.
구체적으로, 도 3에 나타난 바와 같이, 혈액에서 말초혈액단핵세포(peripheral blood mononuclear cell, PBMC)를 분리한 다음, T 세포활성화비드(T cell activation bead; Miltenyl Biotec, cat# 130-091-441)를사용해 T 세포를 활성화시켰다. 활성화된 T 세포에 상기 실시예 4에서 제조한 CD22-CAR 렌티바이러스를 T 세포에 형질 도입시켜 CD22-CAR-T 세포를 제조하였으며, Lenti-boost-p를 사용하여 형질 도입 효율을 증가시켰다.
CD22-CAR-T 세포의 CD22 펩타이드 결합능은 유세포분석(Flow Cytometry) 방법을 통해 확인하였다. 상기에서 제조한 CD22-CAR-T세포를 FITC-CD22 단백질과 anti-CD3, anti-CD4, anti-CD8 항체와 반응시킨 후 FACS 기계를 이용해 형광 세기를 측정하였다. 분석과정에서 CD3를 발현하는 세포를 T 세포로하여 T 세포안에서 FITC 발현 정도를 확인하였다.
그 결과, 도 4에 나타난 바와 같이, CD22 펩타이드 증가에 따라, CD22와 결합하는 CD4 또는 CD8를 발현하는 CD22-CAR-T 세포가 증가하는 것을 확인하였다. 이는 본 발명에서 제조한 CD22-CAR-T 세포가 효과적으로 CD22와 결합하는 것을 의미한다.
실시예 6: CD22 펩타이드에 의한 CD22-CAR-T 세포 활성화 확인
본 발명에서는 상기 실시예 5에서 제조한 CD22-CAR-T 세포가 CD22 펩타이드에 의해 활성화되는지 확인하기 위해, 표적세포의 존재 하에 CD22-CAR-T 세포에 의한 IFNγ 발현 정도를 확인하였다.
표적세포는 CD22를 발현하지 않는 K562 세포(ATCC, cat#CCL-243) 및 CD22를 발현하는 U2932 세포(DSMZ, cat#ACC-633)를 이용하였으며, CD22-CAR-T 세포와 표적세포를 2:1, 1:1. 0.5:1, 0:1 비율로 일정시간 반응시킨 후 surface & intra antibody로 염색하여 FACS 측정하였다 (CD22 protein, INF-r, CD107a, CD3, CD4, CD8 염색). 0:1(CAR-T only)를 기준으로 표적세포와 반응시킨 CD22-CAR-T의 IFNγ 발현 정도를 확인하였다.
그 결과 도 5a 내지 도 5d에 나타난 바와 같이, CD22를 발현하지 않는 K562 세포에서는 T 세포가 활성화되지 않은 반면, CD22를 발현하는 U2932 세포의 존재 하에 T 세포가 활성화되어 IFNγ 발현이 증가하는 것을 확인하였다.
실시예 7: CD22 발현 세포에 대한 CD22-CAR-T 세포의 사멸 효과 확인
본발명에서는 CD22-CAR-T 세포에 의한 표적세포의 사멸효과를 확인하였다.
표적세포로 CD22를 발현하지 않는 K562 세포와 CD22를 발현하는 U2932 세포를 이용하였으며, CD22-CAR-T 세포와 1:4, 1:2, 1:1, 1:0.5 및 1:0.25 비율이 되도록 혼합한 다음, 루미네센스(CytoTox-Glo Cytotoxicity Assay, Promega, cat# G9291)를 측정하였다. 측정한 값으로 하기 수학식 1을 이용하여 세포 사멸 정도를 계산하였다.
[수학식 1]
% Cytotoxicity = [(Experimental - Effector Spontaneous - Target Spontaneous) / (Target Maximum - Target Spontaneous)] X 100
Experimental: 표적세포 및 CAR-T 세포 복합 배양의 배지로부터 도출된 발광(Luminescence)값
Effector Spontaneous: CAR-T 세포만의 배지로부터 도출된 발광값
Target Spontaneous: 표적세포만의 배지로부터 도출된 발광값
Target Maximum: 표적세포의 100% 용해(용해시약 (Lysis Reagent) 이용)로부터 도출된 발광값
그 결과, 도 6에 나타난 바와 같이 본 발명의 CD22-CAR-T 세포는 CD22를 발현하는 U2932 세포를 특이적으로 사멸시키는 것을 확인하였다.
본 발명에서 선별한 항체는 CD22를 발현하는 세포를 특이적으로 인식하는 것을 확인하였으며, 상기 확립된 항체를 이용하여 CD22를 표적으로 하는 키메라 항원 수용체(CAR) 및 CAR-T 세포는 CD22와 효과적으로 결합할 뿐만 아니라, CD22와 결합한 CAR-T 세포의 활성화가 이루어진 것을 확인하였다.
또한, 본 발명의 CAR-T 세포는 CD22를 발현하는 세포를 효과적으로 사멸시키는 것을 확인하였으므로, 본 발명의 CD22에 특이적인 항체, CD22를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포는 CD22 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.

Claims (14)

  1. (a) 서열번호 1의 아미노산으로 표시되는 CDR1 영역, 서열번호 2의 아미노산으로 표시되는 CDR2 영역 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역, 서열번호 5의 아미노산으로 표시되는 CDR2 영역 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
    (b) 서열번호 11의 아미노산으로 표시되는 CDR1 영역, 서열번호 12의 아미노산으로 표시되는 CDR2 영역 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역, 서열번호 15의 아미노산으로 표시되는 CDR2 영역 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
    (c) 서열번호 21의 아미노산으로 표시되는 CDR1 영역, 서열번호 22의 아미노산으로 표시되는 CDR2 영역 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역, 서열번호 25의 아미노산으로 표시되는 CDR2 영역 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위;
    (d) 서열번호 31의 아미노산으로 표시되는 CDR1 영역, 서열번호 32의 아미노산으로 표시되는 CDR2 영역 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역, 서열번호 35의 아미노산으로 표시되는 CDR2 영역 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위; 또는
    (e) 서열번호 41의 아미노산으로 표시되는 CDR1 영역, 서열번호 42의 아미노산으로 표시되는 CDR2 영역 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역, 서열번호 45의 아미노산으로 표시되는 CDR2 영역 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위로 구성된 CD22에 특이적으로 결합하는 항체 또는 이의 단편.
  2. 제1항에 있어서, 상기 (a) 항체는 서열번호 7의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 8의 아미노산으로 표시되는 경쇄 가변부위로,
    상기 (b) 항체는 서열번호 17의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 18의 아미노산으로 표시되는 경쇄 가변부위로,
    상기 (c) 항체는 서열번호 27의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 28의 아미노산으로 표시되는 경쇄 가변부위로,
    상기 (d) 항체는 서열번호 37의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 38의 아미노산으로 표시되는 경쇄 가변부위로,
    상기 (e) 항체는 서열번호 47의 아미노산으로 표시되는 중쇄 가변부위 및 서열번호 48의 아미노산으로 표시되는 경쇄 가변부위로 구성되는 것을 특징으로 하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편.
  3. 제1항 또는 제2항의 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 코딩하는 폴리뉴클레오타이드.
  4. 제1항 또는 제2항의 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 코딩하는 폴리뉴클레오타이드 포함하는 벡터.
  5. 제4항의 벡터로 형질전환된 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 생산하는 재조합 세포.
  6. CD22-결합 도메인;
    막관통 도메인(transmembrane domain);
    공동자극 도메인(costimulatory domain); 및
    세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메릭 항원 수용체(chimeric antigen receptor: CAR)로,
    상기 CD22-결합 도메인은 (a) 서열번호 1의 아미노산으로 표시되는 CDR1 영역, 서열번호 2의 아미노산으로 표시되는 CDR2 영역 및 서열번호 3의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 4의 아미노산으로 표시되는 CDR1 영역, 서열번호 5의 아미노산으로 표시되는 CDR2 영역 및 서열번호 6의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
    (b) 서열번호 11의 아미노산으로 표시되는 CDR1 영역, 서열번호 12의 아미노산으로 표시되는 CDR2 영역 및 서열번호 13의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 14의 아미노산으로 표시되는 CDR1 영역, 서열번호 15의 아미노산으로 표시되는 CDR2 영역 및 서열번호 16의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
    (c) 서열번호 21의 아미노산으로 표시되는 CDR1 영역, 서열번호 22의 아미노산으로 표시되는 CDR2 영역 및 서열번호 23의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 24의 아미노산으로 표시되는 CDR1 영역, 서열번호 25의 아미노산으로 표시되는 CDR2 영역 및 서열번호 26의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
    (d) 서열번호 31의 아미노산으로 표시되는 CDR1 영역, 서열번호 32의 아미노산으로 표시되는 CDR2 영역 및 서열번호 33의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 34의 아미노산으로 표시되는 CDR1 영역, 서열번호 35의 아미노산으로 표시되는 CDR2 영역 및 서열번호 36의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편; 또는
    (e) 서열번호 41의 아미노산으로 표시되는 CDR1 영역, 서열번호 42의 아미노산으로 표시되는 CDR2 영역 및 서열번호 43의 아미노산으로 표시되는 CDR3 영역을 포함하는 중쇄 가변부위 및 서열번호 44의 아미노산으로 표시되는 CDR1 영역, 서열번호 45의 아미노산으로 표시되는 CDR2 영역 및 서열번호 46의 아미노산으로 표시되는 CDR3 영역을 포함하는 경쇄 가변 부위를 포함하는 CD22에 특이적으로 결합하는 항체 또는 이의 단편인 것을 특징으로 하는 키메릭 항원 수용체.
  7. 제6항에 있어서, 상기 막관통 도메인은 CD8α, CD4, CD28, CD137, CD80, CD86, CD152 및 PD1로 구성된 군에서 선택되는 단백질이며,
    공동자극 도메인은 CD28, 4-1BB, OX-40 및 ICOS로 구성된 군에서 선택되는 단백질이고,
    상기 신호전달 도메인은 CD3ζ인 것을 특징으로 하는 키메릭 항원 수용체.
  8. 제6항에 있어서, 상기 CD22-결합 도메인의 C 말단 및 막관통 도메인의 N 말단 사이에 힌지 부위(hinge region)가 추가로 포함되는 것을 특징으로 하는 키메릭 항원 수용체.
  9. 제6항 내지 제8항 중 어느 한 항의 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드.
  10. 제6항 내지 제8항 중 어느 한 항의 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 포함하는 벡터.
  11. 제6항 내지 제8항 중 어느 한 항의 키메릭 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 벡터를 포함하는 면역 이펙터 세포.
  12. 제1항 또는 제2항의 CD22에 특이적으로 결합하는 항체 또는 이의 단편;
    또는 제11항의 면역 이펙터 세포;를 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 예방 또는 치료용 약학적 조성물.
  13. 제12항에 있어서, 상기 CD22를 발현하는 세포에 의해 매개되는 질환은 림프종, 비호치킨 림프종(non-Hogkins lymphoma: NHL), 공격적 NHL, 재발성 공격적 NHL, 재발성 지연성 NHL, 불응성 NHL, 불응성 지연성 NHL, 만성 림프성 백혈병(chronic lymphocytic leukemia: CLL), 소형 림프성 림프종, 백혈병, 모발성 세포 백혈병(hairy cell leukemia: HCL), 급성 림프성 백혈병(acute lymphocytic leukemia: ALL), 버킷트 림프종 및 외투 세포 림프종로 구성된 군에서 선택되는 것을 특징으로 하는 CD22를 발현하는 세포에 의해 매개되는 질환의 예방 또는 치료용 약학적 조성물.
  14. 제1항 또는 제2항의 CD22에 특이적으로 결합하는 항체 또는 이의 단편을 포함하는 CD22를 발현하는 세포에 의해 매개되는 질환의 진단 또는 모니터링용 조성물.
PCT/KR2021/004568 2020-06-01 2021-04-12 Cd22에 특이적인 항체 및 이의 용도 WO2021246637A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN202180039081.4A CN115667310A (zh) 2020-06-01 2021-04-12 Cd22特异性抗体及其用途
US18/000,457 US20230212286A1 (en) 2020-06-01 2021-04-12 Antibodies specific for cd22 and uses thereof
JP2022573478A JP2023527462A (ja) 2020-06-01 2021-04-12 Ｃｄ２２に特異的な抗体およびその使用
EP21818442.2A EP4159760A1 (en) 2020-06-01 2021-04-12 Antibody specific to cd22, and use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2020-0065666 2020-06-01
KR20200065666 2020-06-01
KR10-2020-0169499 2020-12-07
KR1020200169499A KR102548256B1 (ko) 2020-06-01 2020-12-07 Cd22에 특이적인 항체 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2021246637A1 true WO2021246637A1 (ko) 2021-12-09

Family

ID=78831333

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/004568 WO2021246637A1 (ko) 2020-06-01 2021-04-12 Cd22에 특이적인 항체 및 이의 용도

Country Status (6)

Country Link
US (1) US20230212286A1 (ko)
EP (1) EP4159760A1 (ko)
JP (1) JP2023527462A (ko)
KR (1) KR20220155943A (ko)
CN (1) CN115667310A (ko)
WO (1) WO2021246637A1 (ko)

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1988007085A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Process for the purification of recombinant polypeptides
WO1988007086A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
WO1998041641A1 (en) 1997-03-20 1998-09-24 The Government Of The United States As Represented By The Secretary Of The Department Of Health And Human Services Recombinant antibodies and immunoconjugates targeted to cd-22 bearing cells and tumors
WO1998042378A1 (en) 1997-03-24 1998-10-01 Immunomedics, Inc. Immunotherapy of b-cell malignancies using anti-cd22 antibodies
JP2007252372A (ja) 2006-02-23 2007-10-04 Mitsubishi Pharma Corp モノクローナル抗体およびそれをコードする遺伝子、ハイブリドーマ、医薬組成物ならびに診断試薬
KR20090088920A (ko) * 2006-12-01 2009-08-20 메다렉스, 인코포레이티드 씨디22에 결합하는 인간 항체 및 이의 용도
KR20150036700A (ko) * 2012-07-19 2015-04-07 레드우드 바이오사이언스 인코포레이티드 Cd22에 대해 특이적인 항체 및 이들의 사용 방법
KR20180030656A (ko) * 2015-07-16 2018-03-23 유씨비 바이오파마 에스피알엘 Cd22에 결합하는 항체 분자
WO2019191704A1 (en) * 2018-03-30 2019-10-03 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
WO2020069405A1 (en) * 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1988007085A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Process for the purification of recombinant polypeptides
WO1988007086A1 (en) 1987-03-20 1988-09-22 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
WO1998041641A1 (en) 1997-03-20 1998-09-24 The Government Of The United States As Represented By The Secretary Of The Department Of Health And Human Services Recombinant antibodies and immunoconjugates targeted to cd-22 bearing cells and tumors
WO1998042378A1 (en) 1997-03-24 1998-10-01 Immunomedics, Inc. Immunotherapy of b-cell malignancies using anti-cd22 antibodies
JP2007252372A (ja) 2006-02-23 2007-10-04 Mitsubishi Pharma Corp モノクローナル抗体およびそれをコードする遺伝子、ハイブリドーマ、医薬組成物ならびに診断試薬
KR20090088920A (ko) * 2006-12-01 2009-08-20 메다렉스, 인코포레이티드 씨디22에 결합하는 인간 항체 및 이의 용도
KR20150036700A (ko) * 2012-07-19 2015-04-07 레드우드 바이오사이언스 인코포레이티드 Cd22에 대해 특이적인 항체 및 이들의 사용 방법
KR20180030656A (ko) * 2015-07-16 2018-03-23 유씨비 바이오파마 에스피알엘 Cd22에 결합하는 항체 분자
WO2019191704A1 (en) * 2018-03-30 2019-10-03 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
WO2020069405A1 (en) * 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1991, MACK PUBLISHING COMPANY
KEIRAMIRSTEIN ET AL., NATURE, vol. 256, 1975, pages 495 - 497
SAMBROOK, J. ET AL.: "Molecular Cloning, A Laboratory Manual", vol. 1, 1989, COLD SPRING HARBOR LABORATORY, pages: 74

Also Published As

Publication number Publication date
EP4159760A1 (en) 2023-04-05
KR20220155943A (ko) 2022-11-24
US20230212286A1 (en) 2023-07-06
CN115667310A (zh) 2023-01-31
JP2023527462A (ja) 2023-06-28

Similar Documents

Publication Publication Date Title
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2018124766A2 (ko) 키메라 항원 수용체 및 이를 발현하는 자연 살해 세포
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
AU2019386549A1 (en) Anti-4-1BB antibody and use thereof
WO2015133817A1 (ko) B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2017023138A1 (ko) 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포
WO2017030370A1 (ko) 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2022030730A1 (ko) 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체
WO2021153979A1 (ko) 항-taa 항체, 항-pd-l1 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2021060914A1 (ko) 항-클라우딘-3 키메라 항원 수용체
WO2021246637A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2022124866A1 (ko) 항-pd-1 항체 및 이의 용도
WO2022124864A1 (ko) 항-tigit 항체 및 이의 용도
WO2022181992A1 (ko) Cd22에 특이적인 인간화 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2022124764A1 (ko) Cd47에 특이적인 항체 및 이의 용도
WO2022124765A1 (ko) Gpc3에 특이적인 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21818442

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022573478

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021818442

Country of ref document: EP

Effective date: 20230102