WO2019190066A1 - Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물 - Google Patents

Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물 Download PDF

Info

Publication number
WO2019190066A1
WO2019190066A1 PCT/KR2019/002527 KR2019002527W WO2019190066A1 WO 2019190066 A1 WO2019190066 A1 WO 2019190066A1 KR 2019002527 W KR2019002527 W KR 2019002527W WO 2019190066 A1 WO2019190066 A1 WO 2019190066A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
oct4
amino acid
cancer
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2019/002527
Other languages
English (en)
French (fr)
Inventor
장현철
이병일
윤홍덕
송보민
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Cancer Center Japan
National Cancer Center Korea
Original Assignee
National Cancer Center Japan
National Cancer Center Korea
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020190024944A external-priority patent/KR102209108B1/ko
Application filed by National Cancer Center Japan, National Cancer Center Korea filed Critical National Cancer Center Japan
Priority to US17/041,926 priority Critical patent/US11717556B2/en
Publication of WO2019190066A1 publication Critical patent/WO2019190066A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08—Peptides having 5 to 11 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10—Peptides having 12 to 20 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer

Definitions

  • the present invention relates to a composition, method and use that can inhibit the stem cell properties of various stem cells, including general stem cells, cancer stem cells, including a peptide that inhibits the function of OCT4 as an active ingredient.
  • cancer stem cells are cancer cells with unlimited regenerative capacity, similar to general stem cells, and slowly proliferate differently from general cancer cells. Cancer stem cells are cancer cells with self-renewal or differentiation ability that are unique to stem cells. It is known to have different mechanisms.
  • stem cell therapeutics which are being actively studied recently, are difficult to control the proliferation and survival of stem cells. Representative side effects may occur when undifferentiated stem cells remain in the body and become cancerous after treatment is completed.
  • stem cell properties of stem cells including cancer stem cells
  • cancer stem cells not only can be safely applied to various stem cell applications, but also effectively suppresses cancer recurrence, metastasis, and resistance by increasing the therapeutic effect of cancer. It is expected to be possible.
  • the present invention has been made to solve the problems of the prior art as described above, comprising a peptide that inhibits the function of OCT4 as an active ingredient, to inhibit the stem cell stem cell variety, such as general stem cells, cancer stem cells It is an object of the present invention to provide compositions, methods, uses, and the like which can be obtained.
  • the composition includes a peptide comprising any one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11, and 13 as an active ingredient.
  • the peptide may include some or all of the amino acids of SEQ ID NOs: 5, 7, 9, 11 or 13, and may preferably contain 1 to 10 amino acids by addition, substitution or deletion, more preferably. Preferably, one to five amino acids may be added, substituted, or deleted, and the addition, alteration, or replacement may be included in the front, rear, or inside of the peptide, and the peptide may inhibit the function of OCT4. If not limited to this.
  • the peptide is a functional equivalent of at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13 is included in the scope of the present invention, the functional equivalent is the addition, substitution of amino acids Or as a result of deletion, having at least 60%, preferably at least 70%, more preferably at least 80%, most preferably at least 90% homology with the amino acid sequence, SEQ ID NOs: 5, 7 , Peptides exhibiting substantially homogeneous activity with any one or more amino acid sequences selected from the group consisting of 9, 11, and 13.
  • the peptide may be a polynucleotide comprising any one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 4, 6, 8, 10 and 12, the polynucleotide may include a polynucleotide variant.
  • the polynucleotide variant has at least one base sequence selected from the group consisting of SEQ ID NOs: 4, 6, 8, 10 and 12 and at least 70%, more preferably at least 80%, most preferably at least 90% It may include a base sequence having the same identity.
  • % sequence homology for a polynucleotide is identified by comparing the comparison region with the optimally arranged sequence, wherein some of the polynucleotide sequences in the comparison region further comprise the reference sequence (addition or deletion) for the optimal alignment of the sequence. Not add) or delete (ie, gap).
  • the peptide may preferably be linked to a cell permeable peptide, and the cell permeable peptide may be used without limitation to various cell permeable peptides known in the art so long as it does not interfere with the property of inhibiting the function of OCT4 of the peptide according to the present invention. Can be.
  • membrane-permeable polyarginine residues 11R were linked to the ends of the peptide.
  • a variety of methods known in the art can be used, for example, may include a linker (GGG, etc.) and the like, but is not limited thereto.
  • the peptide is preferably characterized in that it inhibits the binding between OCT4 (Octamer-binding transcription factor 4) and PP1 (protein phosphatase 1), more preferably human OCT4 It may be characterized by maintaining the phosphorylation of the amino acid serine of the corresponding OCT4 of serine, the 229th amino acid serine of mouse OCT4 or other organisms of the 236th amino acid of, but not limited to any peptide that can inhibit the function of OCT4 Do not.
  • the present invention provides a composition for inhibiting stem cell stem cells, comprising a peptide comprising any one or more amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 11 and 13 as an active ingredient do.
  • the peptide may comprise part or all of the amino acids of SEQ ID NO: 5, 7, 9, 11 or 13, wherein the peptide is of SEQ ID NO: 4, 6, 8, 10 or 12 Polynucleotides containing a part or all of the base sequence may be encoded.
  • the stem cells may be selected from embryonic stem cells, germ cells, cancer stem cells, etc., but is not limited to any kind of stem cells expressing OCT4 protein.
  • the composition may preferably inhibit the stem cell proliferation of stem cells to inhibit the proliferation, survival, etc. of the stem cells, through which stem cells in all fields using stem cells It can be used as a way to control.
  • the present invention also provides a pharmaceutical composition for preventing or treating cancer, comprising a peptide comprising any one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11, and 13 as an active ingredient.
  • the present invention provides a method for treating cancer, comprising administering to a subject a composition comprising a peptide comprising any one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13 as an active ingredient. to provide.
  • the present invention also provides a cancer prevention or therapeutic use of a composition
  • a composition comprising as an active ingredient a peptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13.
  • the peptide may comprise part or all of the amino acids of SEQ ID NO: 5, 7, 9, 11 or 13, wherein the peptide is of SEQ ID NO: 4, 6, 8, 10 or 12 Polynucleotides containing a part or all of the base sequence may be encoded.
  • the peptide is preferably characterized in that it inhibits the binding between OCT4 (Octamer-binding transcription factor 4) and PP1 (protein phosphatase 1), more preferably human OCT4 It may be characterized by maintaining the phosphorylation of the serine of the 236th amino acid of the mouse or the 229th amino acid of the mouse OCT4, but is not limited to any peptide that can inhibit the function of OCT4.
  • the cancer is preferably thyroid cancer, cervical cancer, brain cancer, lung cancer, ovarian cancer, liver cancer, pancreatic cancer, prostate cancer, skin cancer, tongue cancer, breast cancer, uterine cancer, stomach cancer, rectal cancer, colon cancer, blood Cancer, and the like, and more preferably gastric cancer, colorectal cancer, lung cancer, liver cancer, prostate cancer, thyroid cancer, breast cancer, cervical cancer, ovarian cancer, and the like, but are not limited thereto.
  • the pharmaceutical composition may further include an anticancer agent, wherein the anticancer agent may be preferably doxorubicin, cisplatin, gemcitabine, oxaliplatin, 5-FU, etc., but is used as an anticancer agent.
  • the anticancer agent may be preferably doxorubicin, cisplatin, gemcitabine, oxaliplatin, 5-FU, etc., but is used as an anticancer agent.
  • the compound is not limited thereto.
  • the pharmaceutical composition preferably inhibits the stem cell properties of cancer stem cells, thereby inhibiting the proliferation, survival, metastasis, recurrence, anticancer drug development, etc. of cancer, Any effect that may occur by inhibiting the stem cell properties of cancer stem cells is not limited thereto.
  • the present invention also provides a pharmaceutical composition for preventing or treating cancer, comprising a peptide that maintains phosphorylation of the 236 th serine in the amino acid sequence of OCT4.
  • the present invention also provides a composition for inhibiting stem cells, comprising a peptide that maintains phosphorylation of the 236th serine in the amino acid sequence of OCT4.
  • the present invention also provides a method for treating cancer, comprising administering to a subject a composition comprising a peptide that maintains phosphorylation of the 236th serine at the amino acid sequence of OCT4.
  • the present invention also provides a method for inhibiting stem cell activity using a composition comprising a peptide that maintains phosphorylation of the 236th serine in the amino acid sequence of OCT4.
  • the present invention provides a cancer prevention or treatment of the composition comprising a peptide that maintains the phosphorylation of the 236th serine in the amino acid sequence of OCT4.
  • the peptide that maintains the phosphorylation of the 236 th serine in the amino acid sequence of the OCT4 is a peptide comprising any one or more amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 11 and 13 Can be.
  • the present invention also provides a cell therapeutic agent comprising a peptide comprising any one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13 and stem cells for cell therapy as an active ingredient.
  • the cell therapy agent may control the stem cells by inhibiting the metastasis and survival of the stem cells for treatment, and may inhibit cancer from being generated by cancer of the therapeutic stem cells remaining after the treatment.
  • the effect is induced by inhibiting the function of OCT4 is not limited thereto.
  • the present invention provides a method for screening an anticancer agent comprising the steps of: a) treating a protein phosphatase 1 (PPI) and a candidate substance in a cell expressing human OCT4; b) confirming whether phosphorylation of the 236th serine in the amino acid sequence of the human OCT4 occurs; And c) selecting the candidate as an anticancer agent when the 236 th serine is maintained in phosphorylation.
  • PPI protein phosphatase 1
  • the present invention also provides an anticancer screening method comprising the steps of: a) binding a fluorescent substance to a peptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13; step; b) treating and reacting the PPI (protein phosphatase 1) and the candidate to the peptide to which the fluorescent substance is bound; And c) selecting a candidate substance having a reduced fluorescence value as an anticancer agent by measuring a fluorescence polarization value.
  • the candidate substance is not limited as long as it is a substance that can be used as an anticancer agent such as nucleotides, DNA, RNA, amino acids, aptamers, proteins, compounds, natural products, natural extracts.
  • the present invention is a stem of the stem cell comprising the step of administering to the subject a composition comprising a peptide comprising any one or more amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 11 and 13 as an active ingredient
  • a composition comprising a peptide comprising any one or more amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 11 and 13 as an active ingredient
  • the present invention provides a stem cell stem cell inhibition of stem cells of the composition comprising a peptide comprising any one or more amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 11 and 13 as an active ingredient. .
  • the present invention provides a method for treating cancer, comprising administering to a subject a composition comprising a peptide comprising any one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13 as an active ingredient. to provide.
  • the present invention also provides a cancer prevention or therapeutic use of a composition
  • a composition comprising as an active ingredient a peptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 7, 9, 11 and 13.
  • the present invention also provides a method for inhibiting stem cell stem cells comprising administering to a subject a composition comprising a peptide that maintains phosphorylation of the 236th serine in an amino acid sequence of human OCT4 as an active ingredient.
  • the present invention also provides a stem cell suppressive use of stem cells of a composition comprising a peptide for maintaining phosphorylation of the 236th serine in the amino acid sequence of human OCT4 as an active ingredient.
  • the present invention also provides a method for treating cancer, comprising administering to a subject a composition comprising, as an active ingredient, a peptide that maintains phosphorylation of the 236th serine in the amino acid sequence of human OCT4.
  • the present invention also provides a cancer prevention or therapeutic use of a composition comprising a peptide for maintaining phosphorylation of the 236th serine in the amino acid sequence of human OCT4 as an active ingredient.
  • Peptides for inhibiting OCT4 function according to the present invention can effectively reduce the stem cell properties of various stem cells, it can be effectively used for inhibiting the proliferation of cancer, inhibit the recurrence of cancer, inhibit the metastasis of cancer, inhibit the development of cancer resistance
  • stem cells can be reduced in general stem cells, time for differentiation of embryonic stem cells into specific cells can be shortened and efficiency can be increased.
  • the use of the composition of the present invention can completely eliminate the undifferentiated embryonic stem cells remaining after treatment, and thus can effectively suppress the side effects of cancer development. Can significantly increase the stability of cell therapy.
  • FIG. 1 is a diagram showing the results of confirming the transformed cell line using Western blotting according to an embodiment of the present invention.
  • FIG. 2 is a diagram showing the results of confirming the transformed cell line according to an embodiment of the present invention using immunofluorescence staining.
  • Figure 3 is a view showing the results confirmed by using the alkaline phosphatase staining method of the stem cell transformed cell line according to an embodiment of the present invention
  • Figure 4 is a view showing the results confirmed by the tumor cell formation of the stem cell transformed cell line according to an embodiment of the present invention.
  • FIG. 5 is a view showing a result of comparing the gene expression pattern of the transformed cell line according to an embodiment of the present invention.
  • FIG. 6 is a view showing a result of comparing tumor growth curves using mouse xenografts of transformed cell lines according to an embodiment of the present invention.
  • FIG. 7 is a view showing the result of comparing the final tumor size using the mouse xenograft of the transformed cell line according to an embodiment of the present invention.
  • FIG. 8 is a view showing the results of comparing the degree of staining using tissue immunostaining in mouse xenograft tumors according to an embodiment of the present invention.
  • FIG. 9 is a view showing the results of confirming the differentiation of tissue using a tissue immunostaining method in a mouse xenograft tumor according to an embodiment of the present invention.
  • FIG. 10 is a view showing the result of confirming the relationship between PP1 and OCT4 S236 phosphorylation using Western blotting according to an embodiment of the present invention.
  • FIG. 11 is a view showing the results confirmed by the immunofluorescence staining relationship between PP1 and OCT4 S236 phosphorylation according to an embodiment of the present invention.
  • FIG. 12 is a diagram showing the results confirmed by Western blotting that PP1 expression inhibition according to an embodiment of the present invention increases OCT4 S236 phosphorylation.
  • Figure 13 shows the results confirmed by immunofluorescence staining that PP1 expression inhibition according to an embodiment of the present invention increases the OCT4 S236 phosphorylation.
  • FIG. 14 is a view showing the results confirming that the inhibition of PP1 expression in accordance with an embodiment of the present invention reduces stem cellularity.
  • 15 is a view showing a result of predicting the 3D structure of the OCT4 protein according to an embodiment of the present invention.
  • 16 is a view showing the results confirmed by Western blotting the activity of the peptides for inhibiting OCT4 function of the present invention according to an embodiment of the present invention.
  • 17 is a diagram showing the results of confirming the activity of the peptides for inhibiting OCT4 function of the present invention by immunofluorescence staining method according to an embodiment of the present invention.
  • FIG. 18 is a view showing the results confirming stem cell inhibition and cancer long-term viability reduction activity of the peptides for inhibiting OCT4 function of the present invention according to an embodiment of the present invention.
  • 19 is a view showing the result of confirming by fluorescence polarization that the peptide for inhibiting OCT4 function of the present invention according to an embodiment of the present invention binds to PP1.
  • 20 is a view showing the results of confirming the detailed sequence binding to PP1 of the peptide sequence for inhibiting OCT4 function of the present invention according to an embodiment of the present invention by fluorescence polarization method.
  • 21 is a diagram showing the results confirmed by immunofluorescence staining treatment of the cell permeable peptide containing the peptide sequence for inhibiting OCT4 function of the present invention to increase the OCT4 S236 phosphorylation according to an embodiment of the present invention .
  • Figure 22 shows the results confirmed by the alkaline phosphatase staining method that the treatment of cell permeable peptides comprising the peptide sequence for inhibiting OCT4 function of the present invention to the cell line reduces stem cell properties The figure shown.
  • the main cause of cancer death is cancer metastasis and treatment resistance, and it has been recently proved that the root cause is stem cell-like cancer cells. Therefore, anti-cancer strategies that reduce the stem cell properties of cancer cells are expected to substantially reduce death from cancer.
  • cancer cells There are two main ways for cancer cells to acquire stem cellity, one is when normal stem cells become cancer cells, and the other is when cancer cells acquire stem cells through dedifferentiation. .
  • the core factors of embryonic stem cells play an important role in maintaining the stem cells of cancer cells, and as cancer progresses, expression of embryonic stem cell-related gene groups, rather than normal tissue stem cell-related genes, increases. It became.
  • Three transcription factors, Oct4, Sox2, and Nanog are central in the stem cell network of embryonic stem cells, and among them, OCT4 (gene Pou5f1) is known to play an important role in maintaining cancer stem cells.
  • the present invention reveals that protein phosphatase 1 (PP1) induces dephosphorylation of the 236th serine (corresponding to the 229th serine of the mouse) of human oct-binding transcription factor 4 in human cells, and the function of OCT4 and PP1 in human cells. Inhibiting peptide sequences were identified.
  • PP1 is a dephosphorylation enzyme with a variety of substrates, general PP1 inhibition affects the function of many other proteins besides OCT4, which may cause various side effects, but the peptide of the present invention specifically inhibits the binding of PP1 and OCT4. Reduces stem cell sex. It is anticipated that the peptides of the present invention may be used for the reduction of cancer and normal stem cellity by inducing phosphorylation of OCT4, and particularly for inhibiting the recurrence of patients undergoing anticancer treatment.
  • the OCT4 inhibitory peptide of the present invention inhibits OCT4 and PP1 binding to maintain phosphorylation of the 236th serine of human OCT4, thereby inhibiting OCT4 function and exhibiting the same level of effect as 100% deficiency of OCT4.
  • normal stem cells lose stem cell proliferation and differentiate, and cancer cells lose stem cell proliferation, making long-term survival impossible, and preventing recurrence after chemotherapy.
  • This is due to the maintenance of the 236th phosphorylation of OCT4 by a peptide that specifically inhibits the binding of OCT4 and protein dephosphorylation enzyme PP1, resulting in loss of transcriptional activity by OCT4 not binding to DNA.
  • stem cell refers to a broad concept that collectively refers to an undifferentiated cell having the ability to differentiate into various kinds of tissue cells, that is, stem cells.
  • stem cells are largely divided into embryonic stem cells (adryonic stem cells), adult stem cells (adult stem cells), gamete, cancer stem cells (cancer stem cells) that can be produced using embryos, Stem cells refer to the cell mass stage after fertilization and before forming specific organs, and recently, embryonic stem cells are also prepared from normal cells through reverse differentiation. Therefore, any cell that can differentiate into all the cells and tissues constituting the body is not limited thereto.
  • Cancer stem cells are extracted from umbilical cord blood, bone marrow, blood, and the like, and refer to primitive cells immediately before they are differentiated into cells of specific organs such as bone, liver, and blood. Germ cells are cells that transmit genetic information to the next generation through reproduction, but humans include, but are not limited to, sperm and eggs. Cancer stem cells refer to cancer cells in a comprehensive sense, having stem cell-specific self-renewal and differentiation ability. Cancer stem cells generally proliferate at a slower rate than normal cancer cells under normal tumor growth conditions (a condition in which there is sufficient cell nutrients (glucose) and sufficient growth conditions of the tumor microenvironment and no cell stress). Maintaining the dormant state may have resistance to anticancer drugs.
  • normal tumor growth conditions a condition in which there is sufficient cell nutrients (glucose) and sufficient growth conditions of the tumor microenvironment and no cell stress. Maintaining the dormant state may have resistance to anticancer drugs.
  • transcriptional regulators such as PGC-1 ⁇
  • the function of the main metabolic regulator is normal cancer cells.
  • the function of the main metabolic regulator is normal cancer cells.
  • the cell signaling system that is linked to this comprehensively refers to cells with invasion and metastasis, which acquired resistance to cell death (apoptosis) in a malnutrition state.
  • any cell capable of differentiating into a general cancer cell is not limited thereto.
  • prevention means any action that suppresses or delays the onset of a disease such as cancer by administration of the composition according to the present invention.
  • Treatment in the present invention means any action that improves or advantageously changes the symptoms of diseases such as cancer by administration of the composition according to the present invention.
  • composition of the present invention can be administered, and the subject is not limited.
  • the pharmaceutical composition may be characterized in the form of capsules, tablets, granules, injections, ointments, powders or beverages, the pharmaceutical composition may be characterized in that it is intended for humans.
  • the pharmaceutical composition is not limited to these, but can be used in the form of oral dosage forms, such as powders, granules, capsules, tablets, aqueous suspensions, external preparations, suppositories, and sterile injectable solutions, respectively, according to conventional methods.
  • the pharmaceutical composition of the present invention may comprise a pharmaceutically acceptable carrier.
  • Pharmaceutically acceptable carriers can be used as oral administration binders, suspending agents, disintegrants, excipients, solubilizers, dispersants, stabilizers, suspending agents, pigments, fragrances, etc.
  • buffers, preservatives, analgesic Topical agents, solubilizers, isotonic agents, stabilizers and the like can be mixed and used, and for topical administration, bases, excipients, lubricants, preservatives and the like can be used.
  • the formulation of the pharmaceutical composition of the present invention may be prepared in various ways by mixing with a pharmaceutically acceptable carrier as described above.
  • oral administration may be in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like, in the case of injections, in unit dosage ampoules or multiple dosage forms.
  • solutions, suspensions, tablets, capsules, sustained release preparations and the like may be used.
  • Suitable carriers, excipients, and diluents for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, malditol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil and the like can be used.
  • fillers, anti-coagulants, lubricants, wetting agents, fragrances, emulsifiers, preservatives and the like may be further included.
  • Routes of administration of the pharmaceutical compositions according to the invention are not limited to these, but are oral, intravenous, intramuscular, intraarterial, intramedullary, intradural, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical , Sublingual or rectal. Oral or parenteral release is preferred.
  • parenteral includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intramuscular, intrasternal, intradural, intralesional and intracranial injection or infusion techniques.
  • the pharmaceutical compositions of the invention may also be administered in the form of suppositories for rectal administration.
  • the pharmaceutical composition of the present invention is dependent on a number of factors, including the activity, age, weight, general health, sex, formulation, time of administration, route of administration, rate of release, drug combination and severity of the particular disease to be prevented or treated, of the specific compound employed.
  • the dosage of the pharmaceutical composition may vary depending on the patient's condition, body weight, extent of disease, drug form, route of administration and duration, and may be appropriately selected by those skilled in the art and may be 0.0001 to 50 mg / day. It may be administered at kg or 0.001 to 50 mg / kg. Administration may be administered once a day or may be divided several times. The dosage does not limit the scope of the invention in any aspect.
  • the pharmaceutical composition according to the present invention may be formulated as pills, dragees, capsules, solutions, gels, syrups, slurries, suspensions.
  • octamer-binding transcription factor 4 a cell line expressing OCT4 substituted with 236D, a mimic mutant of OCT4 S236, was constructed.
  • a lentiviral that expresses short hairpin RNA (shRNA, SEQ ID NO: 1) and puromycin resistance genes dependently on doxycycline was prepared and primarily a cancer stem cell line, NCCIT (ATCC ® CRL-2073 TM). And NTERA-2 (ATCC ® CRL-1973 TM).
  • Plasmids were transfected secondary to the transfected cell lines using Lipofectamine 3000 (Thermefisher). The cells were treated with puromycin and blasticidin to isolate the transfected and transfected cell lines, and the isolated cell lines were treated with doxycycline to inhibit the expression of endogenous OCT4 and to produce cell lines substituted with exogenous OCT4 protein. . The produced cell line was confirmed by Western blotting.
  • OCT4 substituted with wild type OCT4 or 236D was normally transformed, and it was confirmed that exogenous OCT4 protein was expressed depending on doxycycline.
  • the expression of the exogenous OCT4 protein was confirmed by immunofluorescence staining.
  • the cell lines treated with doxycycline and cultured for 4 to 8 days were washed with phosphate buffer solution, and the cells were fixed with 4% formaldehyde solution and then washed again with phosphate buffer solution.
  • 0.5% Triton X-100 was treated to increase cell membrane permeability. And blocked using a 1% BSA (bovine serum albumin) solution, and treated with OCT4 antibody and reacted at room temperature for 2 hours.
  • BSA bovine serum albumin
  • OCT4 substituted with wild type OCT4 or 236D was normally transformed, and it was confirmed that exogenous OCT4 protein was expressed depending on doxycycline.
  • the exogenous OCT4 expressing cell line prepared by the method of Example 1.1 was separated into single cells through trypsin treatment, and then 1,000 cells per well were stored in 6-well plates. After dispensing and incubating for at least one week at 37 ° C. and 5% CO 2 , staining was performed using an alkaline phosphatase assay kit (Medsource Ozone Biomedicals) and observed under a microscope. The results are shown in FIG.
  • cells expressing wild-type OCT4 maintain the same cell morphology as the control group and maintain stem cell positivity, indicating a positive response to alkaline phosphatase, whereas OCT4 substituted with 236D.
  • OCT4 substituted with 236D In the case of the cells expressing the mutated cell shape was not aggregated, it was confirmed that the negative response to the alkaline phosphatase.
  • tumor formation was confirmed.
  • 1 mL of B27 (Invitrogen), 20 ng / mL Epidermal Growth Factor (EGF, Sigma), 20 ng / ml basic fibroblast growth factor-2 (bFGF2, Sigma) Dispense 10,000 cells per well into 96-well Ultra Low Attachment plates (Corning) using DMEM / F12 (Hyclone) medium with 4ug / ml heparin (Sigma), and 37 ° C., 5% CO 2 conditions. After incubation for 2 days, the same amount of medium was added.
  • NCCIT cells expressing exogenous OCT4 prepared by the method of Example 1.1 were treated with doxycycline and cells cultured with and without treatment using RNeasy Purification Kit (Qiagen) to purify the entire RNA and then to Macrogen. The request was made for whole RNA-seq. The results are shown in FIG.
  • a transgenic cell line expressing nocturnal OCT4 showed a gene expression pattern similar to that of the original cell line, and a transgenic cell line expressing OCT4 substituted with 236D was similar to a cell line from which OCT4 was removed. It was confirmed that the expression pattern was shown.
  • OCT4 plays an important role in the maintenance of stem cell properties, in particular, in the case of mimicking the phosphorylation of S236 by substituting D for the 236th amino acid of OCT4, stem cell activity is significantly inhibited, thereby OCT4 S236 Phosphorylation was found to play an important role in stem cellity.
  • the exogenous OCT4 expressing NTERA2 cells prepared by the method of Example 1.1 were xenografted 1x10 7 in BALB / c-nu mice and divided into two groups when the tumor size was about 50-100 mm 3 and one group was doxycycline.
  • Figure 6 shows the results of measuring tumor size at 2-3 days intervals for 5 weeks without dosing and other groups.
  • the size of the xenograft tumor was significantly smaller.
  • a paraffin block was prepared and stained with a growth marker Ki67 antibody using tissue immunochemical staining.
  • Ki67 staining was significantly low in tumor tissues expressing OCT4 substituted with 236D.
  • a lentivirus that expresses shRNA of SEQ ID NO: 2 or SEQ ID NO: 2 is produced depending on doxycycline and is transfected into an NCCIT cell line to control the expression of PP1 through doxycycline.
  • Western blotting and immunofluorescence staining were performed in the same manner as in Example 2.1. The results are shown in FIGS. 12 and 13, respectively.
  • OCT4 human octamer-binding transcription factor
  • PDB ID: 3L1P mouse's OCT4 X-ray crystal structure
  • the amino acid sequences of human OCT4 and mouse OCT4 are very similar in the case of sites expected to be involved in binding to PP1, and thus the structure of human OCT4 protein in the region is alpha-helix 1 ( It could be predicted to have a 3D structure consisting of ⁇ -helix 1), alpha-helix 2, and alpha-helix 3 ( ⁇ -helix 3).
  • Example 4 Through the structural analysis of Example 4, to prepare a peptide for inhibiting OCT4 function that can inhibit the OCT4 function by reducing the binding of OCT4 and PP1, helix 1-3 of SEQ ID NO: 4 (Helix 1-3) , Nucleotide sequences of helix 1 (Helix-1) of SEQ ID NO: 6, helix 2 (Helix-2) of SEQ ID NO: 8, and helix 3 (Helix-3) of SEQ ID NO: 10 were prepared. And the prepared base sequences were respectively inserted into pCAG-F-puro vector (Addgene) to prepare a recombinant vector.
  • pCAG-F-puro vector Additional vector
  • the vector prepared by the method of Example 5 was inserted into the NCCIT cell line using lipofectamine 3000, transformed, and cultured for 36 to 48 hours, followed by Western blotting in the same manner as in Example 2.1. Quantification of western blotting was analyzed using ImageJ. The results are shown in FIG.
  • the peptides for inhibiting OCT4 function produced by the method of Example 5 all increased the phosphorylation of OCT4 in the NCCIT cell line, in particular, it was confirmed that the effect of helix 1 and helix 1-3 is the highest It was.
  • Example 5 the vector prepared by the method of Example 5 was inserted into the NCCIT and NTERA-2 cell lines using lipofectamine 3000, transformed, and then cultured for 36 to 48 hours, followed by immunofluorescence staining in the same manner as in Example 2.1. The results are shown in FIG. 17.
  • the vector prepared by the method of Example 5 was used for lipofectamine 3000, mouse embryonic stem cell (mESC), NCCIT and Each transformed NTERA-2 cell line was incubated for 2 days, treated with puromycin and further cultured for 2 days to isolate only the transformed cell line into which the vector was inserted. And alkaline phosphatase assay and cancer cell viability assay (clonigenic assay) was carried out in the same manner as in Example 1.2. The results are shown in FIG.
  • Helix-3 (SEQ ID NO: 14), Helix 3-2 (SEQ ID NO: 14), Helix 3-2 (SEQ ID NO: 15) by narrowing the sequence involved in binding to PP1 in the Helix-3 sequence consisting of 19 amino acids
  • the binding forces between helix 3-3 (SEQ ID NO: 13) and helix 3 were compared.
  • Figure 20 shows that the spiral 3-3 (Helix-3-3) (SEQ ID NO: 13) consisting of 12 amino acids has the same binding force as helix 3 (Helix-3).
  • a cell permeable peptide (11R-GGG-VVRVWFCNRRQK) linking the sequences of Helix 3-3 (Helix-3-3) was prepared and added to the cell culture solution at a concentration of 10 uM and treated for 2 days or more. After treatment, the result of confirming the phosphorylation of OCT4 by immunofluorescence staining is shown in FIG. 21.
  • OCT4 function inhibitory peptides of the present invention effectively inhibit the binding of OCT4 and PP1, maintains phosphorylation of serine, the 236th amino acid of human OCT4, inhibits the function of OCT4, and thus OCT4 does not bind to DNA. By not doing so, the transcriptional activity is lost, and finally, stem cell traits of cancer stem cells can be reduced to effectively inhibit cancer proliferation, cancer recurrence, cancer metastasis suppression, and anticancer drug resistance. Not only that, but also stem cells can be reduced in general stem cells, which not only shortens the time and increases the efficiency of differentiation of embryonic stem cells into specific cells, but also increases the efficiency of cell therapy using embryonic stem cells. Can effectively suppress the side effects of cancer development from remaining undifferentiated embryonic stem cells Therefore, the peptides for inhibiting OCT4 function of the present invention were found to be applicable to various fields through stem cell suppression of stem cells.
  • Peptides for inhibiting OCT4 function according to the present invention can effectively reduce the stem cell properties of various stem cells, it can be effectively used for inhibiting the proliferation of cancer, inhibit the recurrence of cancer, inhibit the metastasis of cancer, inhibit the development of cancer resistance
  • stem cells can be reduced in general stem cells, time for differentiation of embryonic stem cells into specific cells can be shortened and efficiency can be increased.
  • the use of the composition of the present invention can completely eliminate the undifferentiated embryonic stem cells remaining after treatment, and thus can effectively suppress the side effects of cancer development. Can significantly increase the stability of cell therapy. Therefore, the value is excellent in terms of industrial availability.
  • SEQ ID NO: 2 shRNA # 1 of PP1
  • SEQ ID NO: 4 DNA sequence of Helix 1-3
  • SEQ ID NO: 5 Amino Acid Sequence of Helix 1-3
  • SEQ ID NO: 6 DNA sequence of Helix 1
  • SEQ ID NO: 7 amino acid sequence of Helix 1
  • SEQ ID NO: 8 DNA sequence of Helix 2
  • SEQ ID NO: 11 Amino acid sequence of Helix 3
  • SEQ ID NO: 13 Amino Acid Sequence of Helix 3-3

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Biochemistry (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 OCT4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물에 관한 것으로, 보다 자세하게는 OCT4의 인산화를 유도함으로써 OCT4의 기능을 저해하는 펩티드를 유효성분으로 포함하는 일반 줄기세포, 암 줄기세포 등 다양한 줄기세포의 줄기세포성 억제용 조성물에 관한 것이다. 본 발명의 OCT4 기능 저해용 펩티드들은 줄기세포의 줄기세포성 억제를 통한 다양한 분야에 적용이 가능할 것으로 기대된다.

Description

OCT4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물
본 발명은 OCT4의 기능을 저해하는 펩티드를 유효성분으로 포함하여 일반 줄기세포, 암 줄기세포 등 다양한 줄기세포의 줄기세포성을 억제할 수 있는 조성물, 방법 및 용도 등에 관한 것이다.
본 출원은 2018년 3월 27일에 출원된 한국특허출원 제10-2018-0035418호 및 2019년 3월 4일에 출원된 한국특허출원 제10-2019-0024944호에 기초한 우선권을 주장하며, 해당 출원의 명세서 및 도면에 개시된 모든 내용은 본 출원에 원용된다.
최근에 활발히 개발되고 항암치료에 실질적으로 사용되고 있는 항암제들의 대부분은 빠르게 증식하는 암세포를 표적으로 하는 약물들이 대부분이다. 이러한 약물들을 이용한 항암 치료 경우에 초기에는 효과적으로 암 세포가 사멸되어 암이 치료되는 것으로 보여지지만, 결국 체내에 남아있는 암 줄기세포(cancer stem cell)가 제거되지 않아 암의 재발 및/또는 전이가 활발히 일어나며, 결국 기존의 항암요법에 대한 내성을 나타내는 문제점들이 종종 발생하고 있기 때문에 최근 암 줄기세포에 대한 관심이 높아지고 있다. 암 줄기세포는 일반적인 줄기세포와 유사하게 무제한의 재생능력을 가진 암세포로서 일반적인 암세포와 상이하게 천천히 증식하며, 줄기세포 특유의 능력인 자가재생이나 분화능력을 가지고 있는 암세포로서 기존에 알려져 있는 암세포들과 다른 기작(mechanism)들을 가지고 있는 것으로 알려져 있다. 한편, 최근 활발히 연구되고 있는 줄기세포 치료제의 경우 줄기세포의 증식, 생존 등을 조절하기 어렵기 때문에 이로 인한 부작용이 발생하고 있는 상황이다. 대표적인 부작용은 치료가 완료된 후, 미분화 줄기세포가 체내에 잔류하여 암화 됨으로써 발생할 수 있다.
따라서, 암 줄기세포를 포함한 줄기세포의 줄기세포성을 조절할 수 있는 방법이 있다면 다양한 줄기세포 응용 분야에 안전하게 적용이 가능할 뿐만 아니라, 암의 치료 효과를 높여 암의 재발, 전이, 내성 등을 효과적으로 억제할 수 있을 것으로 기대된다.
본 발명은 상기와 같은 종래 기술상의 문제점을 해결하기 위해 안출된 것으로, OCT4의 기능을 저해하는 펩티드를 유효성분으로 포함하는, 일반 줄기세포, 암 줄기세포 등 다양한 줄기세포의 줄기세포성을 억제할 수 있는 조성물, 방법 및 용도 등을 제공하는 것을 그 목적으로 한다.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당업계에서 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다.
본 발명, 예컨대 조성물에는 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함한다.
상기 펩티드는 서열번호 5, 7, 9, 11 또는 13의 아미노산을 일부 또는 전체로 포함할 수도 있으며, 바람직하게는 1개 내지 10개의 아미노산을 부가, 치환, 또는 결실하여 포함할 수 있으며, 더욱 바람직하게는 1 내지 5개의 아미노산을 부가, 치환, 또는 결실하여 포함할 수 있으며, 상기 추가, 변경 또는 대체는 펩티드의 전방, 후방, 또는 펩티드 내부에 포함될 수 있으며, OCT4의 기능을 억제할 수 있는 펩티드라면 이에 제한되지 않는다. 또한, 상기 펩티드는 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열의 기능성 동등물도 본 발명의 권리범위에 포함되며, 상기 기능적 동등물이란, 아미노산의 부가, 치환, 또는 결실의 결과, 상기 아미노산 서열과 적어도 60 % 이상, 바람직하게는 70 % 이상, 더욱 바람직하게는 80 % 이상, 가장 바람직하게는 90 % 이상의 서열 상동성을 가지는 것으로서, 상기 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열과 실질적으로 동질의 활성을 나타내는 펩티드를 의미한다.
또한, 상기 펩티드는 서열번호 4, 6, 8, 10 및 12로 이루어진 군으로부터 선택된 어느 하나 이상의 염기서열을 포함하는 폴리뉴클레오티드가 코딩된 것일 수 있고, 상기 폴리뉴클레오티드에는 폴리뉴클레오티드 변이체가 포함될 수 있다. 구체적으로 상기 폴리뉴클레오티드 변이체에는 서열번호 4, 6, 8, 10 및 12로 이루어진 군으로부터 선택된 어느 하나 이상의 염기서열과 70 % 이상, 더욱 바람직하게는 80 % 이상, 가장 바람직하게는 90 % 이상의 서열 상동성을 가지는 염기서열을 포함할 수 있다. 예를 들면, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100%의 서열 상동성을 갖는 폴리뉴클레오타이드를 포함한다. 폴리뉴클레오티드에 대한 "서열 상동성의 %"는 최적으로 배열된 서열과 비교 영역을 비교함으로써 확인되며, 비교 영역에서 폴리뉴클레오티드 서열의 일부는 더 서열의 최적 배열에 대한 참고 서열(추가 또는 삭제를 포함하지 않음)에 비해 추가 또는 삭제(즉, 갭)를 포함할 수 있다.
상기 펩티드는 바람직하게는 세포투과성 펩티드에 연결될 수 있으며, 상기 세포투과성 펩티드는 본 발명에 따른 펩티드의 OCT4의 기능을 억제하는 특성을 방해하지 않는 이상 당업계 공지된 다양한 세포투과성 펩티드가 제한되지않고 사용될 수 있다. 본 발명의 실시예에서는 막 투과성 폴리아르기닌 잔기(membrane-permeable polyarginine residues (11R))를 펩티드의 말단에 연결해 사용하였다. 이때 세포투과성 펩티드를 연결하면서, 당업계 공지된 다양한 방법이 사용될 수 있고, 예컨대 링커(GGG 등) 등을 포함시킬 수 있고, 이에 제한되지않는다.
본 발명의 일 구체예에 있어서, 상기 펩티드는 바람직하게는 OCT4(Octamer-binding transcription factor 4)와 PP1(protein phosphatase 1)사이의 결합을 저해하는 것을 특징으로 할 수 있으며, 더욱 바람직하게는 인간 OCT4의 236번째 아미노산인 세린, 마우스 OCT4의 229번째 아미노산 세린 또는 기타 다른 생물체의 대응하는 OCT4의 아미노산 세린의 인산화를 유지하는 것을 특징으로 할 수 있으나, OCT4의 기능을 억제할 수 있는 펩티드라면 이에 제한되지 않는다.
보다 구체적으로, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는, 줄기세포의 줄기세포성 억제용 조성물을 제공한다.
본 발명의 다른 구체예에 있어서, 상기 펩티드는 서열번호 5, 7, 9, 11 또는 13의 아미노산을 일부 또는 전체로 포함할 수도 있으며, 상기 펩티드는 서열번호 4, 6, 8, 10 또는 12의 염기서열을 일부 또는 전체로 포함하는 폴리뉴클레오티드가 코딩된 것일 수 있다.
본 발명의 다른 구체예에 있어서, 상기 줄기세포는 배아줄기세포, 생식세포, 암 줄기세포 등으로부터 선택될 수 있으나, OCT4 단백질이 발현되는 줄기세포의 종류라면 이에 제한되지 않는다.
본 발명의 또 다른 구체예에 있어서, 상기 조성물은 바람직하게는 줄기세포의 줄기세포성을 억제하여 줄기세포의 증식, 생존 등을 억제할 수 있으며, 이를 통하여 줄기세포를 사용하는 모든 분야에서 줄기세포를 조절할 수 있는 방법으로 사용될 수 있다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법을 제공한다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물의 암 예방 또는 치료 용도를 제공한다.
본 발명의 다른 구체예에 있어서, 상기 펩티드는 서열번호 5, 7, 9, 11 또는 13의 아미노산을 일부 또는 전체로 포함할 수도 있으며, 상기 펩티드는 서열번호 4, 6, 8, 10 또는 12의 염기서열을 일부 또는 전체로 포함하는 폴리뉴클레오티드가 코딩된 것일 수 있다.
본 발명의 일 구체예에 있어서, 상기 펩티드는 바람직하게는 OCT4(Octamer-binding transcription factor 4)와 PP1(protein phosphatase 1) 사이의 결합을 저해하는 것을 특징으로 할 수 있으며, 더욱 바람직하게는 인간 OCT4의 236번째 아미노산인 세린 또는 마우스 OCT4의 229번째 아미노산인 세린의 인산화를 유지하는 것을 특징으로 할 수 있으나, OCT4의 기능을 억제할 수 있는 펩티드라면 이에 제한되지 않는다.
본 발명의 다른 구체예에 있어서, 상기 암은 바람직하게는 갑상선암, 자궁경부암, 뇌암, 폐암, 난소암, 간암, 췌장암, 전립선암, 피부암, 혀암, 유방암, 자궁암, 위암, 직장암, 대장암, 혈액암 등으로 이루어질 수 있으며, 더욱 바람직하게는 위암, 대장암, 폐암, 간암, 전립선암, 갑상선암, 유방암, 자궁경부암, 난소암 등이나, OCT4와 연관된 암이라면 이에 제한되지 않는다.
본 발명의 또 다른 구체예에 있어서, 상기 약학적 조성물은 항암제를 추가로 포함할 수 있으며, 상기 항암제는 바람직하게는 독소루비신, 시스플라틴, 젬시타빈, 옥살리플라틴, 5-FU 등일 수 있으나, 항암제로 사용되고 있는 화합물이라면 이에 제한되지 않는다.
본 발명의 또 다른 구체예에서, 상기 약학적 조성물은 바람직하게는 암 줄기세포의 줄기세포성을 억제하며, 이를 통하여 암의 증식, 생존, 전이, 재발, 항암제 내성 발생 등을 억제할 수 있으나, 암 줄기세포의 줄기세포성을 억제함으로써 발생할 수 있는 효과라면 이에 제한되지 않는다.
또한, 본 발명은 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드를 포함하는, 암 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드를 포함하는, 줄기세포성 억제용 조성물을 제공한다.
또한, 본 발명은 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드를 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법을 제공한다.
또한, 본 발명은 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드를 포함하는 조성물을 이용하여 줄기세포성을 억제하는 방법을 제공한다.
또한, 본 발명은 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드를 포함하는 조성물의 암 예방 또는 치료용도를 제공한다.
본 발명의 구체예에 있어서, 상기 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지하는 펩티드는 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드일 수 있다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드 및 세포 치료용 줄기세포를 유효성분으로 포함하는 세포 치료제를 제공한다.
본 발명의 다른 구체예에 있어서, 상기 세포치료제는 치료용 줄기세포의 전이, 생존을 억제하여 줄기세포를 조절할 수도 있고, 치료 후 남아있는 치료용 줄기세포가 암화되어 암이 발생하는 것을 억제할 수도 있으나, OCT4의 기능을 억제함으로써 유도되는 효과라면 이에 제한되지 않는다.
또한, 본 발명은 하기 단계를 포함하는 항암제 스크리닝 방법을 제공한다: a) 인간 OCT4를 발현하는 세포에 PPI(protein phosphatase 1) 및 후보물질을 처리하는 단계; b) 상기 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화 여부를 확인하는 단계; 및 c) 상기 236번째 세린이 인산화가 유지된 경우, 상기 후보물질을 항암제로 선택하는 단계.
또한, 본 발명은 하기 단계를 포함하는 항암제 스크리닝 방법을 제공한다: a) 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드에 형광물질을 결합시키는 단계; b) 상기 형광물질이 결합된 펩티드에 PPI(protein phosphatase 1) 및 후보물질을 처리 및 반응시키는 단계; 및 c) 형광 편광(fluorescence polarization) 값을 측정하여 형광 값이 감소된 후보물질을 항암제로 선택하는 단계.
상기 후보 물질은 뉴클레오티드, DNA, RNA, 아미노산, 압타머, 단백질, 화합물, 천연물, 천연추출물 등 항암제로 사용가능한 물질이라면 제한되지 않는다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 줄기세포의 줄기세포성 억제 방법을 제공한다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물의, 줄기세포의 줄기세포성 억제 용도를 제공한다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법을 제공한다.
또한, 본 발명은 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물의 암 예방 또는 치료 용도를 제공한다.
또한, 본 발명은 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 줄기세포의 줄기세포성 억제 방법을 제공한다.
또한, 본 발명은 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물의, 줄기세포의 줄기세포성 억제 용도를 제공한다.
또한, 본 발명은 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법을 제공한다.
또한, 본 발명은 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물의, 암 예방 또는 치료 용도를 제공한다.
본 발명에 따른 OCT4 기능 저해용 펩티드들은 다양한 줄기세포의 줄기세포성을 효과적으로 감소시킬 수 있기 때문에, 암의 증식 억제, 암의 재발 억제, 암의 전이 억제, 암의 항암제 내성 발생 억제 등에 효과적으로 사용될 수 있을 뿐만 아니라 일반 줄기세포에서도 줄기세포성을 감소시킬 수 있기 때문에 배아줄기세포의 특정 세포로의 분화에 있어서 시간은 단축시키고, 효율을 증대시킬 수 있다. 또한 배아줄기세포를 이용한 세포 치료에서, 본 발명의 조성물을 이용하게 되면, 치료 이후 남아있는 미분화된 배아줄기세포를 완전히 제거할 수 있으며, 따라서 암 발생의 부작용들을 효과적으로 억제할 수 있기 때문에 배아줄기세포를 이용한 세포치료요법의 안정성을 현저히 증대시킬 수 있다.
도 1은 본 발명의 일 실시예에 따른 형질전환된 세포주를 웨스턴 블롯팅을 이용하여 확인한 결과를 나타낸 도면이다.
도 2는 본 발명의 일 실시예에 따른 형질전환된 세포주를 면역형광염색법을 이용하여 확인한 결과를 나타낸 도면이다.
도 3은 본 발명의 일 실시예에 따른 형질전환된 세포주의 줄기세포성을 알칼리성 인산가수분해효소 염색법을 이용하여 확인한 결과를 나타낸 도면이다,
도 4는 본 발명의 일 실시예에 따른 형질전환된 세포주의 줄기세포성을 종양구 형성으로 확인한 결과를 나타낸 도면이다.
도 5는 본 발명의 일 실시예에 따른 형질전환된 세포주의 유전자 발현 패턴을 비교한 결과를 나타낸 도면이다.
도 6은 본 발명의 일 실시예에 따른 형질전환된 세포주의 마우스 이종이식을 이용하여 종양 성장 곡선을 비교한 결과를 나타낸 도면이다.
도 7은 본 발명의 일 실시예에 따른 형질전환된 세포주의 마우스 이종이식을 이용하여 최종 종양 크기을 비교한 결과를 나타낸 도면이다.
도 8은 본 발명의 일 실시예에 따른 마우스 이종이식 종양에서 조직면역염색법을 이용하여 염색의 정도를 비교 확인한 결과를 나타낸 도면이다.
도 9는 본 발명의 일 실시예에 따른 마우스 이종이식 종양에서 조직면역염색법을 이용하여 조직의 분화를 확인한 결과를 나타낸 도면이다.
도 10은 본 발명의 일 실시예에 따른 PP1과 OCT4 S236 인산화와의 연관관계를 웨스턴 블롯팅을 이용하여 확인한 결과를 나타낸 도면이다.
도 11은 본 발명의 일 실시예에 따른 PP1과 OCT4 S236 인산화와의 연관관계를 면역형광염색법을 이용하여 확인한 결과를 나타낸 도면이다.
도 12는 본 발명의 일 실시예에 따른 PP1 발현 저해가 OCT4 S236 인산화를 증가시킴을 웨스턴 블롯팅을 이용하여 확인한 결과를 나타낸 도면이다.
도 13은 본 발명의 일 실시예에 따른 PP1 발현 저해가 OCT4 S236 인산화를 증가시킴을 면역형광염색법을 이용하여 확인한 결과를 나타낸 도면이다.
도 14는 본 발명의 일 실시예에 따른 PP1 발현 저해가 줄기세포성을 감소시킴을 확인한 결과를 나타낸 도면이다.
도 15는 본 발명의 일 실시예에 따른 OCT4 단백질의 3D 구조를 예측한 결과를 나타낸 도면이다.
도 16은 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드들의 활성을 웨스턴 블롯팅을 이용하여 확인한 결과를 나타낸 도면이다.
도 17은 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드들의 활성을 면역형광염색법을 이용하여 확인한 결과를 나타낸 도면이다.
도 18은 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드들의 줄기세포성 저해 및 암 장기 생존 능력 감소 활성을 확인한 결과를 나타낸 도면이다.
도 19는 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드가 PP1에 결합함을 형광편광법으로 확인한 결과를 나타낸 도면이다.
도 20은 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드 서열 중 PP1에 결합하는 자세한 서열을 형광편광법으로 확인한 결과를 나타낸 도면이다.
도 21은 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드 서열을 포함한 세포투과성 펩티드를 세포주에 처리함이 OCT4 S236 인산화를 증가시킴을 면역형광염색법을 이용하여 확인한 결과를 나타낸 도면이다.
도 22는 본 발명의 일 실시예에 따른 본 발명의 OCT4 기능 저해용 펩티드 서열을 포함한 세포투과성 펩티드를 세포주에 처리함이 줄기세포성을 감소시킴을 알칼리성 인산가수분해효소 염색법을 이용하여 확인한 결과를 나타낸 도면이다.
암 사망의 주원인은 암 전이와 치료내성으로, 그 근본 원인이 줄기세포성을 띤 암 세포라는 사실이 최근 들어 엄밀히 증명되고 있다. 그래서 암 세포의 줄기세포성을 감소시키는 항암전략을 통해 암으로 인한 사망을 실질적으로 줄일 수 있을 것으로 기대한다.
암 세포가 줄기세포성을 획득하는 경로는 크게 두 가지로 요약할 수 있는데, 하나는 정상 줄기세포가 암세포화 된 경우이며, 또 다른 하나는 암세포가 역분화를 통해 줄기세포성을 획득한 경우이다. 암 환자에서는 특히 배아줄기세포 핵심인자들이 암세포의 줄기세포성 유지에 중요한 역할을 하고 있으며, 암의 악성화가 진행될수록 정상 조직줄기세포 관련 유전자가 아닌 배아줄기세포 관련 유전자군의 발현이 증가하는 것으로 보고되었다. 배아줄기세포의 줄기세포성을 유지하는 네트워크에서 Oct4, Sox2, Nanog의 세 전사인자가 중심에 있으며, 이중에서도 OCT4(유전자 Pou5f1)가 암의 줄기세포성 유지에 중요한 역할을 하는 것으로 알려져 있다.
본 발명에서는 인간 세포에서 PP1(protein phosphatase 1)이 인간 OCT4(Octamer-binding transcription factor 4)의 236번째 세린(마우스의 229번째 세린에 해당)의 탈인산화를 유도함을 밝히고, OCT4와 PP1의 기능을 저해하는 펩티드 서열을 동정하였다. PP1은 다양한 기질을 가진 탈인산화 효소로, 일반적인 PP1 저해는 OCT4 이외의 다른 많은 단백질들의 기능에도 영향을 주어, 여러 부작용을 초래할 수 있으나 본 발명의 펩티드는 PP1과 OCT4의 결합을 특이적으로 저해하여, 줄기세포성을 감소시킨다. 본 발명의 펩티드는 OCT4의 인산화를 유도함으로써 암 및 정상 줄기세포성을 감소시키고, 특히 항암 치료를 받은 환자의 재발을 억제하는 용도로 사용될 수 있을 것으로 기대한다.
본 발명의 OCT4 기능 저해 펩티드는 OCT4와 PP1의 결합을 저해하여 인간 OCT4의 236번째 세린의 인산화를 유지함으로써 OCT4 기능을 저해하여 OCT4 100% 결핍과 같은 수준의 효과를 나타낸다. 이로 인해 정상줄기세포는 줄기세포성을 잃고 분화하게 되며, 암세포는 줄기세포성을 잃어 장기 생존이 불가능해지고, 항암 치료 후 재발하지 못하게 된다. 이는 OCT4와 단백질 탈인산화 효소 PP1의 결합을 특이적으로 저해하는 펩티드에 의해 OCT4의 236번째 인산화가 유지되어, OCT4가 DNA에 결합하지 못함으로써 전사활성을 잃게 됨에 기인하는 것이다.
본 명세서에 있어서, "줄기세포(stem cell)"란 여러 종류의 조직 세포로 분화할 수 있는 능력, 즉, 줄기세포성(stemness)을 가진 미분화 세포를 총칭하는 광의의 개념을 말한다. 이러한 줄기세포는 크게 배아를 이용하여 제조할 수 있는 배아줄기세포(embryonic stem cell), 성체줄기세포(adult stem cell), 생식세포(gamete), 암 줄기세포(cancer stem cell) 등으로 나뉘며, 배아줄기세포는 수정 후 구체적 장기를 형성하기 이전의 세포 덩어리 단계를 말하며, 최근에는 역분화를 통하여 정상세포로부터 배아줄기세포를 제조하기도 한다. 따라서, 신체를 이루는 모든 세포와 조직으로 분화할 수 있는 세포라면 이에 제한되지 않는다. 성체줄기세포는 제대혈, 골수, 혈액 등으로부터 추출해 낸 것으로서 뼈, 간, 혈액 등 구체적 장기의 세포로 분화되기 직전의 원시세포를 의미한다. 생식세포란, 생식을 통해서 유전 정보를 다음 세대로 전달하는 세포로서, 인간에게는 정자와 난자가 있으나, 이에 제한되지 않는다. 암 줄기세포란 줄기세포 특유의 능력인 줄기세포성인 자가재생이나 분화능력을 가지는 포괄적인 의미의 암세포를 의미한다. 암 줄기세포는 일반적으로 정상적인 종양생장 조건(세포 성장에 필요한 영양분(포도당)이 충분하고 종양미세환경의 생장여건이 풍족하여 세포 스트레스가 없는 상태를 지칭)에서 일반적인 암세포와 상이하게 느린 속도로 증식하거나 휴지기(dormant state) 상태를 유지하여 항암제에 대한 저항성을 가지고 있을 수 있으며, 예를 들어, PGC-1α 등의 전사조절인자의 발현이 정상적인 종양세포와 달리 통제되어 주요 대사조절물질의 기능이 일반 암세포와 비교하여 상이할 수 있다. 이러한 상이한 대사조절 능력과 이에 기전적으로 연계된 세포신호전달계의 조절을 통해 영양 결핍 상태에서 세포 사멸(apoptosis)에 대하여 저항성을 획득한, 침윤 및 전이능이 있는 세포를 포괄적으로 지칭한다. 그러나 일반적인 암 세포로 분화할 수 있는 세포라면 이에 제한되지 않는다.
본 발명에서 "예방"이란 본 발명에 따른 조성물의 투여에 의해 암 등의 질환을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다.
본 발명에서 "치료"란 본 발명에 따른 조성물의 투여에 의해 암 등의 질환의 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명에서 "개체"란 본 발명의 조성물이 투여될 수 있는 대상을 말하며, 그 대상에는 제한이 없다.
본 발명에 있어서, 상기 약학적 조성물은 캡슐, 정제, 과립, 주사제, 연고제, 분말 또는 음료 형태임을 특징으로 할 수 있으며, 상기 약학적 조성물은 인간을 대상으로 하는 것을 특징으로 할 수 있다. 상기 약학적 조성물은 이들로 한정되는 것은 아니지만, 각각 통상의 방법에 따라 산제, 과립제, 캡슐, 정제, 수성 현탁액 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 본 발명의 약학적 조성물은 약제적으로 허용가능한 담체를 포함할 수 있다. 약제학적으로 허용되는 담체는 경구투여시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다. 본 발명의 약제학적 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구투여시에는 정제, 트로키, 캡슐, 엘릭서(elixir), 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 캡슐, 서방형 제제 등으로 제형할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말디톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.
본 발명에 따른 약학적 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 경구 또는 비경구 투하가 바람직하다. 본원에 사용된 용어 "비경구"는 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골내 주사 또는 주입기술을 포함한다. 본 발명의 약학적 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다.
본 발명의 약학적 조성물은 사용된 특정 화합물의 활성, 연령, 체중, 일반적인 건강, 성별, 정식, 투여시간, 투여경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있고, 상기 약학적 조성물의 투여량은 환자의 상태, 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만 당업자에 의해 적절하게 선택될 수 있고, 1일 0.0001 내지 50mg/kg 또는 0.001 내지 50mg/kg으로 투여할 수 있다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명에 따른 의약 조성물은 환제, 당의정, 캡슐, 액제, 겔, 시럽, 슬러리, 현탁제로 제형화될 수 있다.
이하, 본 발명의 이해를 돕기 위하여 하기 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
실시예
실시예 1: OCT4 인산화와 줄기세포성과의 연관관계 확인
1.1. 외인성 OCT4를 발현하는 세포주 제작
OCT4(octamer-binding transcription factor 4) 단백질의 인산화와 줄기세포성(stemness)과의 연관관계를 확인하기 위하여, 우선 OCT4 S236 인산화 모방 돌연변이체인 236D로 치환된 OCT4를 발현하는 세포주를 제작하였다. 세포 제작을 위하여 독시사이클린(doxycycline) 의존적으로 short hairpin RNA(shRNA, 서열번호 1) 및 퓨로마이신(puromycin) 내성 유전자를 발현시키는 렌티바이러스를 제작하여 일차적으로 암줄기세포주인 NCCIT(ATCC ® CRL-2073™) 및 NTERA-2(ATCC ®　CRL-1973™)에 형질감염시켰다. 그리고 pCAG-Flag-B/S 벡터에 OCT4 야생형(wild type) 및 블라스티시딘(blasticidine) 내성 유전자, 또는 OCT4의 인산화 모방형인 236D로 치환된 OCT4 및 블라스티시딘 내성 유전자를 발현하도록 재조합된 플라스미드를 Lipofectamine 3000(Thermefisher)을 이용하여 상기 형질감염된 세포주에 2차적으로 형질주입하였다. 그리고 배지에 퓨로마이신 및 블라스티시딘을 처리하여 정상적으로 형질감염 및 형질주입된 세포주를 분리하였고, 분리된 세포주에 독시사이클린을 처리하여 내인성 OCT4의 발현이 저해되고 외인성 OCT4 단백질로 치환된 세포주를 제작하였다. 제작된 세포주는 웨스턴 블롯팅을 통하여 확인하였다. 독시사이클린을 처리하고 4일 내지 8일을 배양한 세포주를 인산염완충용액(phosphate buffered saline: PBS)을 이용하여 세척하고, 세포용해 완충용액(lysis buffer; 20mM Tris-Cl(pH 7.4), 150mM NaCl, 1mM EDTA, 1%(v/v) Triton X-100 and protease inhibitors)을 이용하여 세포를 용해시킨 후에 OCT4 항체(SantaCruz) 및 Flag 항체(Cell Signaling)를 이용하여 SDS-page 및 웨스턴 블롯팅으로 확인하였다. 대조군으로는 ACTB 항체(Abcam)를 사용하였다. 그 결과는 도 1에 나타내었다.
도 1에 나타난 바와 같이, 야생형 OCT4 또는 236D로 치환된 OCT4가 정상적으로 형질전환되었으며, 독시사이클린 의존적으로 외인성 OCT4 단백질이 발현되는 것을 확인하였다.
또한, 면역형광염색을 이용하여 외인성 OCT4 단백질의 발현 여부를 확인하였다. 확인을 위하여, 독시사이클린을 처리하고 4일 내지 8일을 배양한 세포주를 인산염완충용액을 이용하여 세척한 후, 4% 포름알데히드(formaldehyde) 용액을 이용하여 세포를 고정시킨 후에 다시 인산염완충용액으로 세척하고, 0.5% 트리톤 X-100을 처리하여 세포막의 투과성을 높여주었다. 그리고 1% BSA(bovine serum albumin) 용액을 이용하여 블로킹시키고, OCT4 항체를 처리하여 2시간 동안 실온에서 반응시켰다. 그리고 인산염완충용액으로 결합하지 않은 항체를 제거한 후 형광이 결합되어 있는 2차 항체(Thermo Fisher Scientific)를 처리하고 실온에서 1시간동안 반응시키고, 결합되지 않은 항체는 인산염완충용액을 이용하여 제거하고, 핵을 4',6-diamidino-2-phenylindole(DAPI, Calbiochem)을 이용하여 염색하였다. 그리고 마운팅 용액(mounting solution)을 세포 위에 첨가한 후에 공초점현미경(confocal microscope)을 이용하여 단백질 발현 여부를 확인하였다. 그 결과는 도 2에 나타내었다.
도 2에 나타난 바와 같이, 야생형 OCT4 또는 236D로 치환된 OCT4가 정상적으로 형질전환되었으며, 독시사이클린 의존적으로 외인성 OCT4 단백질이 발현되는 것을 확인하였다.
1.2. OCT4 인산화와 줄기세포성 연관관계 확인
OCT4 단백질과 줄기세포성과의 연관관계를 확인하기 위하여, 실시예 1.1의 방법으로 제작된 외인성 OCT4를 발현하는 세포주를 트립신 처리를 통하여 단일 세포로 분리한 후에 6-웰 플레이트에 각 웰당 1,000개의 세포를 분주하고, 37℃, 5% CO 2 조건에서 일주일 이상 배양한 후에 알칼리성 인산가수분해효소 분석 키트(Alkaline phosphatase assay kit, Medsource Ozone Biomedicals)를 이용하여 염색을 진행하고, 현미경으로 관찰하였다. 그 결과는 도 3에 나타내었다.
도 3에 나타난 바와 같이, 야생형 OCT4를 발현하는 세포의 경우에는 대조군과 동일한 세포 형태를 유지하며, 줄기세포성이 유지되어 알칼리성 인산가수분해효소에 대해 양성 반응을 나타내는 반면에, 236D로 치환된 OCT4를 발현하는 세포의 경우에는 세포 모양이 변이되어 응집하지 못하며, 알칼리성 인산가수분해효소에 대해 음성 반응을 나타내는 것을 확인하였다.
또한, 종양구 형성 여부를 확인하였다. 종양구 형성을 위해서, 1mL의 B27(Invitrogen), 20ng/mL의 표피성장인자(Epidermal Growth Factor; EGF, Sigma), 20ng/ml 염기성 섬유아세포 성장 인자(basic fibroblast growth factor-2; bFGF2, Sigma), 및 4ug/ml heparin(Sigma)이 첨가된 DMEM/F12(Hyclone) 배지를 이용하여 96-well Ultra Low Attachment plates(Corning)에 각 웰당 10,000개의 세포를 분주하고, 37℃, 5% CO 2 조건에서 이틀 동안 배양한 후에 동량의 배지를 첨가하였다. 그리고 3일 후에 1/10의 비율로 계대배양한 후에 다시 7일간 배양하고, Cytation3(BioTek)로 96-웰 전체 이미지를 촬영하고 직경이 10㎛ 이상인 회전 타원체를 계수하였다. 그 결과는 도 4에 나타내었다.
도 4에 나타난 바와 같이, 236D로 치환된 OCT4를 발현하는 세포의 경우에는 종양구의 형성이 현저히 감소된 것을 확인하였고, 이를 통하여, 236D로 치환된 OCT4의 경우에는 줄기세포성이 저해된 것을 확인할 수 있었다.
또한, 실시예 1.1의 방법으로 제작된 외인성 OCT4를 발현하는 NCCIT 세포에 독시사이클린을 처리하고 배양한 세포와 처리하지 않고 배양한 세포를 RNeasy Purification Kit(Qiagen)를 이용하여 전체 RNA를 정제한 후 Macrogen에 의뢰하여 whole RNA-seq을 진행하였다. 그 결과는 도 5에 나타내었다.
도 5에 나타난 바와 같이, 야행성 OCT4를 발현하는 형질전환 세포주의 경우에는 원 세포주와 유사한 유전자 발현 패턴을 나타내었고, 236D로 치환된 OCT4를 발현하는 형질전환 세포주의 경우에는 OCT4가 제거된 세포주와 유사한 발현 패턴을 나타내는 것을 확인하였다.
상기 결과들을 통하여, OCT4는 줄기세포성의 유지에 중요한 역할을 담당하고 있으며, 특별히, OCT4의 236번째 아미노산을 D로 치환하여 S236의 인산화를 모방한 경우 줄기세포성이 현저히 저해되며, 이를 통하여 OCT4 S236 인산화가 줄기세포성에 중요한 역할을 하는 것을 확인할 수 있었다.
실시예 2: 동물 모델에서 OCT4 인산화와 종양 성장 연관관계 확인
2.1 OCT4 인산화와 종양 성장 연관관계 확인
실시예 1.1의 방법으로 제작된 외인성 OCT4를 발현하는 NTERA2 세포를 BALB/c-nu 쥐에 1x10 7개를 이종이식하고 종양의 크기가 약 50-100mm 3 일 때 두 그룹으로 나누어 한 그룹에는 독시사이클린을 투약하고 다른 그룹에는 투약 하지 않고 5주간 종양의 크기를 2-3일 간격으로 측정한 결과를 도 6에 나타내었다.
도 6에 나타난 바와 같이 236D로 치환된 OCT4를 발현하는 세포의 경우에는 이종이식 된 종양의 생장이 현저히 감소된 것을 확인하였다.
또한 약 5주 후 종양을 쥐에서 박리하고 종양 무게를 측정하여 그래프로 나타내고, 실제 종양 이미지를 도 7에 나타내었다.
도 7에 나타난 바와 같이 236D로 치환된 OCT4를 발현하는 세포의 경우에는 이종이식 된 종양의 크기가 현저히 작은 것을 확인하였다.
2.2 OCT4 인산화와 종양 조직의 분화 연관관계 확인
실시예 2.1에서 박리한 종양을 포르말린에 고정 후 파라핀 블럭을 제작하여 조직면역화학염색을 이용하여 생장표지자 Ki67 안티바디로 염색한 결과를 도 8에 나타내었다.
도 8에 나타난 바와 같이 236D로 치환된 OCT4를 발현하는 종양 조직에서는 Ki67 염색율이 현저히 낮은 것을 확인하였다.
또한 종양 조직의 형태를 확대하여 도 9에 나타내었다.
도 9에 나타낸 바와 같이 236D로 치환된 OCT4를 발현하는 종양 조직에서는 줄기세포성을 잃고 다양한 형태로 분화 경향성을 가진 조직을 확인하였다.
실시예 3: PP1과 OCT4 인산화의 연관관계 확인
3.1. PP1과 OCT4 인산화의 연관관계 확인
PP1(protein phosphatase 1)과 OCT4의 연관관계를 확인하기 위하여, PP1의 저해제로 알려져 있는 오카다산(Okadaic acid)을 NCCIT 및 NTERA-2 세포주에 처리하고, 실시예 1.1과 동일한 방법으로 웨스턴블롯팅 및 면역형광염색법을 실시하였다. OCT4 S236 인산화 항체는 GenScript사에 의뢰하여 제작한 항체를 사용하였다(ref. eLIFE2016). 그 결과는 도 10 및 도 11에 각각 나타내었다.
도 10 및 도 11에 나타난 바와 같이, PP1를 저해시킨 경우 OCT4의 인산화가 증가되는 것을 확인하였다.
3.2. PP1 발현 저해 조절용 세포주 제작
또한, PP1 발현 저해 조절용 세포주를 제작하기 위하여, 독시사이클린 의존적으로 서열번호 2 또는 서열번호 3의 shRNA를 발현시키는 렌티바이러스를 제작하고 NCCIT 세포주에 형질감염시켜, 독시사이클린을 통하여 PP1의 발현을 조절할 수 있는 세포주를 제작하였다. 그리고 실시예 2.1과 동일한 방법으로 웨스턴블롯팅 및 면역형광염색법을 실시하였다. 그 결과는 도 12 및 도 13에 각각 나타내었다.
도 12 및 도 13에 나타난 바와 같이, 독시사이클린을 이용하여 PP1의 발현을 억제시킨 경우 인산화된 OCT4가 증가되는 것을 확인하였다.
3.3. PP1 저해로 인한 OCT4 인산화의 증가가 줄기세포성에 미치는 영향 확인
PP1 저해로 인한 OCT4 인산화의 증가가 줄기세포성에 미치는 영향을 확인하기 위하여, 실시예 1.2와 동일한 방법으로 알칼리성 인산가수분해효소 염색법 및 종양구 형성 여부를 확인하였다. 그 결과는 도 14에 나타내었다.
도 14에 나타난 바와 같이, 독시사이클린을 처리하여 PP1의 발현을 억제시킨 경우 알칼리성 인산가수분해효소에 의하여 염색되지 않으며, 역시 종양구의 형성도 현저히 감소되는 것을 확인하였다.
상기 결과들을 통하여, PP1을 억제시키면 OCT4의 인산화가 증가되고, 이로 인하여 줄기세포성이 저해되는 것을 확인할 수 있었다.
실시예 4: OCT4의 구조 분석
4.1. 인간 OCT4 구조 예측
인간의 OCT4(octamer-binding transcription factor 4)의 구조 예측을 위하여, 현재 일부 구조가 알려져 있는 마우스의 OCT4 X-선 결정구조(PDB ID: 3L1P)를 대조군으로 이용하여 PP1과의 결합에 관여할 것으로 예상하는 부위의 구조를 예측하였다. 그 결과는 도 15에 나타내었다.
도 15에 나타난 바와 같이, PP1과의 결합에 관여할 것으로 예상되는 부위의 경우 인간의 OCT4와 마우스 OCT4의 아미노산 서열이 매우 유사하며, 이를 통하여 해당 부위의 인간 OCT4 단백질의 구조는 알파-나선 1(α-helix 1), 알파-나선 2(α-helix 2) 및 알파-나선 3(α-helix 3)으로 구성되어 있는 3D(삼차원) 구조를 가지고 있음을 예측할 수 있었다.
실시예 5: OCT4 기능 저해용 펩티드 제작
실시예 4의 구조 분석을 통하여, OCT4와 PP1과의 결합을 감소시켜 OCT4의 기능을 저해할 수 있는 OCT4 기능 저해용 펩티드를 제작하기 위하여, 서열번호 4의 나선 1-3(Helix 1-3), 서열번호 6의 나선 1(Helix-1), 서열번호 8의 나선 2(Helix-2), 및 서열번호 10의 나선 3(Helix-3)의 염기서열을 제작하였다. 그리고 제작된 염기서열들은 각각 pCAG-F-puro vector(Addgene)에 삽입하여 재조합 벡터를 제작하였다.
실시예 6: OCT4 기능 저해용 펩티드 활성 확인
6.1. OCT4 기능 저해용 펩티드의 줄기세포성 저해 활성 확인
실시예 5의 방법으로 제작된 벡터를 NCCIT 세포주에 lipofectamine 3000을 이용하여 삽입하여 형질전환시킨 후에 36시간 내지 48시간 동안 배양한 후에, 실시예 2.1과 동일한 방법으로 웨스턴 블롯팅을 실시하였다. 웨스턴 블롯팅의 정량화는 ImageJ를 이용하여 분석하였다. 그 결과는 도 16에 나타내었다.
도 16에 나타난 바와 같이, 실시예 5의 방법으로 제작된 OCT4 기능 저해용 펩티드들은 모두 NCCIT 세포주 내에서 OCT4의 인산화를 증가시켰으며, 특히, 나선 1 및 나선 1-3의 효과가 가장 높은 것을 확인하였다.
또한, 실시예 5의 방법으로 제작된 벡터를 NCCIT 및 NTERA-2 세포주에 lipofectamine 3000을 이용하여 삽입하여 형질전환시킨 후에 36시간 내지 48시간 동안 배양한 후에, 실시예 2.1과 동일한 방법으로 면역형광염색법을 실시하여 그 결과를 도 17에 나타내었다.
OCT4-PP1 결합저해 펩티드에 의해, 줄기세포성이 감소되는지 확인하기 위하여, 실시예 5의 방법으로 제작된 벡터를 lipofectamine 3000을 이용하여 마우스의 배아줄기세포(mouse embryonic stem cell, mESC), NCCIT 및 NTERA-2 세포주에 각각 형질전환시킨 후에 2일 동안 배양하고, 퓨로마이신(puromycin)을 처리하고 2일 동안 추가로 배양하여 벡터가 삽입된 형질전환 세포주만을 분리하였다. 그리고 실시예 1.2와 동일한 방법으로 알칼리성 인산가수분해효소 분석 및 암세포의 생존 능력(clonigenic assay)을 실시하였다. 그 결과는 도 18에 나타내었다.
도 18에 나타난 바와 같이, OCT4 기능 저해용 펩티드가 처리된 세포의 경우에는 줄기세포성이 감소되어 세포 모양이 변이되어 응집하지 못하며, 알칼리성 인산가수분해효소에 대해 음성 반응을 나타내고 암세포의 생존 능력 또한 감소되는 것을 확인하였다.
실시예 4의 나선 1(Helix-1), 나선 2(Helix-2) 나선 3(Helix-3)에 FITC가 결합된 펩티드를 합성하였다.
펩티드를 최종 20nM로 형광편광반응 완충용액(10mM HEPES pH7.5, 50mM NaCl, 1mM DTT, 1mM EDTA, 0.0025% Tween 20)에 균일하게 분주하고, 정제된 PP1 단백질을 추가한 후 30분 동안 반응시키고, 형광편광을 TECAN infinite F200 pro를 이용하여 측정한 결과를 도 19에 나타내었다.
도 19에 나타난 바와 같이, PP1 단백질 추가시 형광편광값이 현저히 증가하여, PP1과 나선 3 펩티드가 결합함을 확인할 수 있었다.
19개의 아미노산으로 구성된 나선 3(Helix-3) 서열 (서열번호 11) 중 PP1과의 결합에 관여하는 서열을 좁혀, 나선 3-1 (서열번호 14), 나선 3-2 (서열번호 15), 나선 3-3 (서열번호 13)과 나선 3의 결합력을 비교해 보았다. 그 결과, 최종적으로 12개 아미노산으로 구성된 나선 3-3(Helix-3-3) (서열번호 13)이 나선 3(Helix-3) 과 동일한 결합력을 가짐을 보여주는 결과를 도 20에 나타내었다.
또한, 나선 3-3(Helix-3-3)의 서열을 연결한 세포투과성 펩티드(11R-GGG-VVRVWFCNRRQK)를 제작하였으며 10uM 의 농도로 세포배양액에 추가하여 2일 이상 처리하였다. 처리 후 OCT4의 인산화를 증가를 면역형광염색으로 확인한 결과를 도 21에 나타내었다.
또한, 실시예 1.2와 동일한 방법으로 알칼리성 인산가수분해효소 분석 및 암세포의 생존 능력(clonigenic assay)을 실시하였다. 그 결과는 도 22에 나타내었다.
도 21 및 도 22에 나타난 바와 같이, OCT4 기능 저해용 펩티드가 처리된 세포의 경우에는 OCT4 인산화에 의하여 줄기세포성이 감소되어 세포 모양이 변이되어 응집하지 못하며, 알칼리성 인산가수분해효소에 대해 음성 반응을 나타내고 암세포의 생존 능력 또한 감소되는 것을 확인하였다.
상기 결과들을 통하여, 본 발명의 OCT4 기능 저해용 펩티드들은 OCT4와 PP1과의 결합을 효과적으로 억제하여, 인간 OCT4의 236번째 아미노산인 세린의 인산화를 유지하여 OCT4의 기능을 저해하여 OCT4가 DNA에 결합하지 못함으로써 전사활성을 잃게 되고, 최종적으로는 암 줄기세포의 줄기세포성을 감소시켜 암의 증식 억제, 암의 재발 억제, 암의 전이 억제, 암의 항암제 내성 발생 억제 등에 효과적으로 사용될 수 있다는 것을 확인할 수 있었을 뿐만 아니라, 일반 줄기세포에서도 줄기세포성을 감소시킬 수 있기 때문에 배아줄기세포의 특정 세포로의 분화에 있어서 시간은 단축시키고, 효율을 증대시킬 수 있을 뿐만 아니라, 배아줄기세포를 이용한 세포 치료에서, 이후 남아있는 미분화된 배아줄기세포로 인한 암 발생의 부작용들을 효과적으로 억제할 수 있기 때문에 본 발명의 OCT4 기능 저해용 펩티드들은 줄기세포의 줄기세포성 억제를 통한 다양한 분야에 적용이 가능한 것을 확인할 수 있었다.
상기 진술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
본 발명에 따른 OCT4 기능 저해용 펩티드들은 다양한 줄기세포의 줄기세포성을 효과적으로 감소시킬 수 있기 때문에, 암의 증식 억제, 암의 재발 억제, 암의 전이 억제, 암의 항암제 내성 발생 억제 등에 효과적으로 사용될 수 있을 뿐만 아니라 일반 줄기세포에서도 줄기세포성을 감소시킬 수 있기 때문에 배아줄기세포의 특정 세포로의 분화에 있어서 시간은 단축시키고, 효율을 증대시킬 수 있다. 또한 배아줄기세포를 이용한 세포 치료에서, 본 발명의 조성물을 이용하게 되면, 치료 이후 남아있는 미분화된 배아줄기세포를 완전히 제거할 수 있으며, 따라서 암 발생의 부작용들을 효과적으로 억제할 수 있기 때문에 배아줄기세포를 이용한 세포치료요법의 안정성을 현저히 증대시킬 수 있다. 따라서, 산업상 이용가능성 면에서 가치가 우수하다.
서열번호 1: OCT4의 shRNA
5'-TCATTCACTAAGGAAGGAATT-3'
서열번호 2: PP1의 shRNA #1
5'-GCGAATTATGCGACCAACTGA-3'
서열번호 3: PP1의 shRNA #2
5'-ACATTTGGTGCAGAAGTGGTTCT-3'
서열번호 4: Helix 1-3의 DNA 서열
AACCGAGTGAGAGGCAACCTGGAGAATTTGTTCCTGCAGTGCCCGAAACCCACACTGCAGCAGATCAGCCACATCGCCCAGCAGCTTGGGCTCGAGAAGGATGTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAGCGATCA
서열번호 5: Helix 1-3의 아미노산 서열
NRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRS
서열번호 6: Helix 1의 DNA 서열
AACCGAGTGAGAGGCAACCTGGAGAATTTG
서열번호 7: Helix 1의 아미노산 서열
NRVRGNLENL
서열번호 8: Helix 2의 DNA 서열
CTGCAGCAGATCAGCCACATCGCCCAGCAGCTTGGG
서열번호 9: Helix 2의 아미노산 서열
LQQISHIAQQLG
서열번호 10: Helix 3의 DNA 서열
AAGGATGTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAGCGATCA
서열번호 11: Helix 3의 아미노산 서열
KDVVRVWFCNRRQKGKRSS
서열번호 12: Helix 3-3의 DNA 서열
GTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAG
서열번호 13: Helix 3-3의 아미노산 서열
VVRVWFCNRRQK
서열번호 14: Helix 3-1의 아미노산 서열
KDVVRVWFCN
서열번호 15: Helix 3-2의 아미노산 서열
CNRRQKGKRSS

Claims (30)

  1. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는, 줄기세포의 줄기세포성 억제용 조성물.
  2. 제 1항에 있어서,
    상기 펩티드는 OCT4(Octamer-binding transcription factor 4)와 PP1(protein phosphatase 1) 사이의 결합을 저해하는 것을 특징으로 하는, 조성물.
  3. 제 1항에 있어서,
    상기 줄기세포는 배아줄기세포, 생식세포, 및 암 줄기세포로 이루어진 군으로부터 선택된 어느 하나인 것을 특징으로 하는, 조성물.
  4. 제 1항에 있어서,
    상기 조성물은 줄기세포의 증식, 또는 생존을 억제하는 것을 특징으로 하는, 조성물.
  5. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는, 암 예방 또는 치료용 약학적 조성물.
  6. 제 5항에 있어서,
    상기 펩티드는 OCT4(Octamer-binding transcription factor 4)와 PP1(protein phosphatase 1) 사이의 결합을 저해하는 것을 특징으로 하는, 약학적 조성물.
  7. 제 5항에 있어서,
    상기 약학적 조성물은 항암제를 추가로 포함하는 것을 특징으로 하는, 약학적 조성물.
  8. 제 5항에 있어서,
    상기 약학적 조성물은 암의 증식, 생존, 전이, 재발 또는 항암제 내성을 억제하는 것을 특징으로 하는, 약학적 조성물.
  9. 인간 OCT4의 아미노산 서열에서 236번째 세린을 인산화시키는 또는 인산화를 유지하는 펩티드를 유효성분으로 포함하는, 줄기세포성 억제용 조성물.
  10. 제 9항에 있어서,
    상기 펩티드는 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 것을 특징으로 하는, 조성물.
  11. 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는, 암 예방 또는 치료용 약학적 조성물.
  12. 제 11항에 있어서,
    상기 펩티드는 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 것을 특징으로 하는, 약학적 조성물.
  13. 제 1항, 제 5항, 제 9항 및 제 11항 중 어느 한 항에 있어서, 상기 펩티드는 세포투과성 펩티드에 연결되는 것을 특징으로 하는, 조성물.
  14. 제 1항, 제 5항, 제 9항 및 제 11항 중 어느 한 항에 있어서, 상기 펩티드는 서열번호 4, 6, 8, 10 및 12로 이루어진 군으로부터 선택된 어느 하나 이상의 염기서열을 포함하는 폴리뉴클레오티드가 코딩된 것을 특징으로 하는, 조성물.
  15. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드 및 세포 치료용 줄기세포를 유효성분으로 포함하는, 세포 치료제.
  16. 제 15항에 있어서,
    상기 펩티드는 OCT4(Octamer-binding transcription factor 4)와 PP1(protein phosphatase 1) 사이의 결합을 저해하는 것을 특징으로 하는, 세포치료제.
  17. 제 15항에 있어서,
    상기 세포치료제는 치료용 줄기세포의 전이, 생존, 또는 암화를 억제하는 것을 특징으로 하는, 세포치료제.
  18. 제 15항에 있어서, 상기 펩티드는 세포투과성 펩티드에 연결되는 것을 특징으로 하는, 세포치료제.
  19. 제 15항에 있어서, 상기 펩티드는 서열번호 4, 6, 8, 10 및 12로 이루어진 군으로부터 선택된 어느 하나 이상의 염기서열을 포함하는 폴리뉴클레오티드가 코딩된 것을 특징으로 하는, 세포치료제.
  20. 하기 단계를 포함하는 항암제 스크리닝 방법:
    a) 인간 OCT4를 발현하는 세포에 PPI (protein phosphatase 1) 및 후보물질을 처리하는 단계;
    b) 상기 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화 여부를 확인하는 단계; 및
    c) 상기 236번째 세린이 인산화가 유지된 경우, 상기 후보물질을 항암후보물질로 선택하는 단계.
  21. 하기 단계를 포함하는 항암제 스크리닝 방법:
    a) 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드에 형광물질을 결합시키는 단계;
    b) 상기 형광물질이 결합된 펩티드에 PPI(protein phosphatase 1) 및 후보물질을 처리 및 반응시키는 단계; 및
    c) 형광 편광(fluorescence polarization) 값을 측정하여 형광 값이 감소된 후보물질을 항암제로 선택하는 단계.
  22. 제 21항에 있어서, 상기 펩티드는 서열번호 4, 6, 8, 10 및 12로 이루어진 군으로부터 선택된 어느 하나 이상의 염기서열을 포함하는 폴리뉴클레오티드가 코딩된 것을 특징으로 하는, 방법.
  23. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 줄기세포의 줄기세포성 억제 방법.
  24. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물의, 줄기세포의 줄기세포성 억제 용도.
  25. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법.
  26. 서열번호 5, 7, 9, 11 및 13으로 이루어진 군으로부터 선택된 어느 하나 이상의 아미노산 서열을 포함하는 펩티드를 유효성분으로 포함하는 조성물의 암 예방 또는 치료 용도.
  27. 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 줄기세포의 줄기세포성 억제 방법.
  28. 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물의, 줄기세포의 줄기세포성 억제 용도.
  29. 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암 치료방법.
  30. 인간 OCT4의 아미노산 서열에서 236번째 세린의 인산화를 유지시키는 펩티드를 유효성분으로 포함하는 조성물의, 암 예방 또는 치료 용도.
PCT/KR2019/002527 2018-03-27 2019-03-05 Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물 Ceased WO2019190066A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/041,926 US11717556B2 (en) 2018-03-27 2019-03-05 Stemness-suppressing composition comprising OCT4 function-inhibiting peptide

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2018-0035418 2018-03-27
KR20180035418 2018-03-27
KR10-2019-0024944 2019-03-04
KR1020190024944A KR102209108B1 (ko) 2018-03-27 2019-03-04 Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물

Publications (1)

Publication Number Publication Date
WO2019190066A1 true WO2019190066A1 (ko) 2019-10-03

Family

ID=68062288

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/002527 Ceased WO2019190066A1 (ko) 2018-03-27 2019-03-05 Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물

Country Status (1)

Country Link
WO (1) WO2019190066A1 (ko)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009061837A1 (en) * 2007-11-05 2009-05-14 Novostem Therapeutics Inc Neoplastic stem cell system and method

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009061837A1 (en) * 2007-11-05 2009-05-14 Novostem Therapeutics Inc Neoplastic stem cell system and method

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
LIN, YUANJI ET AL.: "Reciprocal regulation of Akt and Oct4 promotes the self-renewal and survival of embryonal carcinoma cells", MOLECULAR CELL, vol. 48, no. 4, 2012, pages 627 - 640, XP055638843 *
MALAK, PETER N ET AL.: "Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4", CELL CYCLE, vol. 14, no. 23, 2015, pages 3748 - 3754, XP055638845 *
SHIN, JIHOON ET AL.: "Aurkb/PP1-mediated resetting of Oct4 during the cell cycle determines the identity of embryonic stem cells", ELIFE, vol. 5, 2016, pages 1 - 21, XP055548776 *
SHIN, JIHOON ET AL.: "Oct4 resetting by Aurkb-PP1 cell cycle axis determines the identity of mouse embryonic stem cells", BMB REPORTS, vol. 49, no. 10, 2016, pages 527 - 528, XP055638844 *

Similar Documents

Publication Publication Date Title
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
WO2015156649A1 (ko) 섬유증 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
WO2022220517A1 (ko) 줄기세포의 염증 또는 노화 억제용 조성물 및 이의 염증 또는 노화 억제 방법
WO2011052883A2 (ko) Ｓｏｃｓ２ 유전자의 발현을 조절하여 자연 살해 세포를 활성화시키는 방법
WO2014178653A1 (ko) 지방세포 분화 과정에서 인간 작은 류신 지퍼 단백질의 용도
WO2019190066A1 (ko) Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물
WO2016159575A9 (ko) 만성 골수성 백혈병 암 줄기세포의 성장 또는 증식 억제용 조성물 및 이의 스크리닝 방법
WO2018212503A1 (ko) 조혈모세포의 항상성 유지에 관여하는 cotl1 단백질 및 이의 용도
WO2009151304A2 (ko) 에이케이에이피일이를 함유하는 조성물 및 동물 모델로서 에이케이에이피일이 돌연변이 제브라피쉬의 용도
WO2021194186A1 (ko) Vgll1 펩타이드를 포함하는 암 치료용 조성물
WO2020071641A1 (ko) Tsp1 단백질 억제제를 유효성분으로 함유하는 파브리 병의 예방 또는 치료용 약학적 조성물
WO2020091137A1 (en) Composition comprising material for regulating oct4 modification to repress stemness
WO2020159191A1 (ko) Mls-stat3를 포함하는 면역질환의 예방 또는 치료용 조성물
WO2016027990A1 (ko) Ｄｕｓｐ５를 유효성분으로 모두 포함하는 골대사성 질환의 예방 또는 치료용 약학적 조성물
WO2024177416A1 (ko) Egfr 표적치료제 내성암 치료용 약학 조성물
WO2019235876A1 (ko) C-src의 발현 또는 활성 억제제를 포함하는 시누클레인병증의 예방 또는 치료용 약학 조성물
WO2019245269A1 (ko) Flt3 억제제를 유효성분으로 포함하는 만성 골수성 백혈병 약물 내성 억제용 조성물
KR102209108B1 (ko) Oct4 기능 저해용 펩티드를 포함하는 줄기세포성 억제용 조성물
WO2010016706A2 (ko) Ｉｄｂｆ의 신규 용도
WO2021201516A1 (ko) 인슐린 수용체 특이적 압타머 및 이의 용도
WO2022158844A1 (ko) Igsf4의 막 관통 도메인을 발현하는 t 세포 및 이의 이용
WO2020080656A1 (ko) Fgf2 또는 api5 유래 펩타이드 및 그의 용도
WO2017164486A1 (ko) Tesk1 억제제를 포함하는 항암제 내성 억제용 조성물 및 tesk1 억제제의 스크리닝 방법
WO2016159695A1 (ko) Ssu72를 유효성분으로 포함하는 자가면역질환의 예방 또는 치료용 조성물
WO2024232499A1 (ko) 피부 노화 억제용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19777305

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 19777305

Country of ref document: EP

Kind code of ref document: A1