WO2019164358A1 - 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 - Google Patents
브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 Download PDFInfo
- Publication number
- WO2019164358A1 WO2019164358A1 PCT/KR2019/002261 KR2019002261W WO2019164358A1 WO 2019164358 A1 WO2019164358 A1 WO 2019164358A1 KR 2019002261 W KR2019002261 W KR 2019002261W WO 2019164358 A1 WO2019164358 A1 WO 2019164358A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- bruton
- tyrosine kinase
- domain
- cancer
- present
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to a novel polypeptide that selectively binds to the Src homology 2 domain of Bruton's tyrosine kinase and its use. More specifically, the present invention relates to the S2 homology 2 domain of Bruton's tyrosine kinase.
- the present invention relates to a polypeptide that binds to a peptide, a method of producing the polypeptide, a complex of the peptide and a cell transfer peptide, and a use thereof.
- Tumor-induced phosphorylase plays an important role in cell growth, division, and signal transduction within the cell. Mutant tumor-induced phosphatase leads to abnormal cell proliferation due to excessive signal transduction, leading to the development of several types of cancer. Therefore, tumor-derived kinase is an important target in the development of cancer treatments.
- Bruton's tyrosine kinase is a protein belonging to the non-receptor type tyrosine kinase of the Tec kinase group and is known as an important factor involved in cell division and proliferation in various B cell malignancies such as chronic lymphocytic leukemia and mantle cell lymphoma.
- Bruton's tyrosine kinase therapy which is currently being developed, is also limited to chemical drugs, and mutation resistance has been shown to occur in patients with chronic lymphocytic leukemia. (Johnson, A. R., et al., ACS chemical biology, Vol. 11 (10), pp. 2897-2907, 2016). Therefore, there is a great need for the development of a new drug substitute that targets allosteric domains that regulate activity, not the ATP binding site of bruton tyrosine kinase.
- Bruton's tyrosine kinase is composed of Pleckstrin homology (aka PH) domain, Src homology domain 3 (aka SH3), Src homology domain 2 (aka SH2), kinase domain.
- the SH3 and SH2 domains are allosteric proteins, each of which delivers signals through specific binding to higher active and lower regulatory factors. It is also known to alter the structure and function of kinase domains (Wang, Q., et al., Elife, Vol. 4, 2015). Therefore, it is possible to develop a novel kinase therapeutic agent by targeting the SH2 domain, blocking the site of identification between proteins and inhibiting the activity of bruton tyrosine kinase.
- the lipid body refers to a polypeptide optimized by consensus design by fusion based on the similarity of the structure of the VLR with the N-terminus of internalin B having the structure of LRR (Leucin-rich repeat). Lipbodies are about one-fifth the size of antibodies and can be mass-produced in E. coli, resulting in lower production costs, and excellent thermal and pH stability, which has great advantages for industrial use.
- the present inventors have made intensive efforts to develop a specific protein binder specific to the SH2 domain of Bruton's tyrosine kinase.
- the present inventors produced a mutant library using Lipibody and increased Bruton through module-based binding.
- a novel polypeptide having specific binding ability to the SH2 domain of tyrosine kinase was selected, and a complex in which the polypeptide and the cell transfer peptide were fused was developed, and the polypeptide and the complex of Bruton's tyrosine kinase targeted by conventional chemical drugs were selected.
- By selectively binding to the SH2 domain of the Brooktotyrosine Kinase not the ATP binding site, not only inhibits the activity of the phosphatase, but also confirms the effect of inhibiting biological cell growth.
- Another object of the present invention is a complex in which a cell delivery peptide is fused to the polypeptide; Polynucleotides encoding the complexes; A vector comprising said polynucleotide; It is to provide a recombinant microorganism into which the vector is introduced and a method for producing the complex using the recombinant microorganism.
- Still another object of the present invention is to provide a composition for preventing or treating cancer containing the polypeptide or the complex and a method for preventing or treating cancer, comprising administering the composition for preventing or treating cancer.
- the present invention provides a repeat body represented by the amino acid sequence of any one of SEQ ID NO: 2 to 4, and selectively binds to the SH2 domain of Bruton's tyrosine kinase.
- the present invention also provides a polynucleotide encoding the repeating body, a vector comprising the polynucleotide, a recombinant microorganism into which the vector is introduced, and a method for producing the repeating body using the recombinant microorganism.
- the present invention also provides a lipidbody-conjugate in which a lipidbody that selectively binds to the SH2 domain of the bruton tyrosine kinase and a cell transfer peptide represented by the amino acid sequence of SEQ ID NO: 6 are fused. do.
- the present invention also provides a polynucleotide encoding the lipid body complex, a vector comprising the polynucleotide, a recombinant microorganism into which the vector is introduced, and a method for producing the lipid body complex using the recombinant microorganism.
- the present invention also provides a composition for treating cancer containing the above-described lipid body or the lipid body complex as an active ingredient.
- the present invention also provides a method for preventing or treating cancer, which comprises administering the above-described lipid body or the lipid body complex.
- the present invention also provides a use for the prevention or treatment of cancer of the above lipida or lipida-complex.
- the present invention also provides a method of using the above lipida or lipida-complex for the manufacture of a medicament for preventing or treating cancer.
- Figure 1 is a schematic diagram showing the overall structure showing the amino acid residues that built a random library for the development of the lipid body binding to the SH2 domain of bruton tyrosine kinase in the present invention.
- Figure 3 is a view showing the result of inhibiting the self-activation of the purified Bruton tyrosine kinase when the F10 lipid body selected in the present invention by treatment.
- FIG. 4 is a view showing a result that the phosphorylation of the substrate is also reduced by suppressing the self-activation of purified Bruton tyrosine kinase when the F10 lipid body selected in the present invention is treated by concentration.
- Figure 5 is an immunoprecipitation after overexpressing the recombinant vector comprising a nucleotide encoding the F10 Lipibody selected in the present invention and a nucleotide encoding a bruton tyrosine kinase in animal cells HEK293 using lipid transfection method, Bruton tyrosine kinase is precipitated together when the F10 lipid body is precipitated by the method, F10 lipid body and bruton tyrosine kinase expressed in the animal cells is a diagram showing the result of maintaining the binding force.
- FIG. 6 is a recombinant vector comprising a nucleotide encoding the F10 lipid body selected in the present invention and a nucleotide encoding a drug resistance mutant brutontyrosine kinase, and then overexpressed in animal cells using lipid transfection in animal cell HEK293.
- the western blot shows that F10 lipida can reduce the phosphorylation of tyrosine 223, an autoactive site, despite being a drug resistant mutant brutontyrosine kinase.
- FIG. 7 is a diagram of an enzyme immunoassay (ELISA) showing the results of experiments confirming that the polypeptide to which the cell transfer peptide is fused binds to the entirety of the bruton tyrosine kinase and the SH2 domain of bruton tyrosine kinase.
- ELISA enzyme immunoassay
- FIG. 8 is a diagram showing the results of experiments confirming that the selected lipida target targeting the SH2 domain of bruton tyrosine kinase exerts the effect of inhibiting biological cell growth.
- a polypeptide that specifically binds to the SH2 domain of bruton tyrosine kinase was selected and the effect of inhibiting the activity of bruton tyrosine kinase of the polypeptide was determined.
- the N-terminal, variable lymphocyte receptor (Variable) of the Internalin B protein A library was constructed randomly containing the repeat module of the polypeptide to which the Leucine-rich repeat (LRR) protein portion of Lymphocyte Receptor (VLR) was fused.
- Polypeptides included in the library for the development of the lipida binding to the SH2 domain of Bruton's tyrosine kinase are encoded by the polynucleotide sequence of SEQ ID NOS: 2 to 4 or 75%, preferably 85%, of the polynucleotide sequence; More preferably 90%, even more preferably 95% or more homologous polynucleotide sequences.
- the library may be in the form of a phagemid containing the polynucleotide.
- phagemid refers to a circular polynucleotide molecule derived from phage, which is an E. coli-host virus, and includes sequences of proteins and surface proteins necessary for propagation and propagation.
- Recombinant phagemids can be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes or the like generally known in the art.
- the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, an enhancer, and mainly fused a desired protein with the surface protein of the phage to label the phage surface. It can be used for the method.
- the promoter of phagemid is mainly inducible and may include a selectable marker for selecting host cells.
- the phagemid comprises MalEss, DsbAss or PelBss, which is a signal sequence or leader sequence for expressing and secreting a polynucleotide encoding the polypeptide constituting the library, and expresses the recombinant protein on the surface of the phage.
- the sequence described in our prior patent (No. 10-2012-0019927) comprising a histidine-tag for identification and a polynucleotide encoding the gp3 domain, which is a type of surface protein of M13 phage for expression on the phage surface Polynucleotide of No. 2, but is not particularly limited thereto.
- the present inventors screened a novel polypeptide (SEQ ID NO: 2) in the form of a lipid body having excellent binding ability to the SH2 domain of bruton tyrosine kinase using a phage display method using a library corresponding to SEQ ID NO: 1 containing the phagemid. It was.
- site directed mutagenesis was performed to increase the binding capacity of Bruton's tyrosine kinase to the SH2 domain, and a novel polypeptide (SEQ ID NO: 3) having increased binding strength was selected.
- the present invention relates to a repeat body represented by the amino acid sequence of any one of SEQ ID NOs: 2 to 4, which selectively binds to the SH2 domain of Bruton's tyrosine kinase.
- the term "Repebody” of the present invention refers to a polypeptide which is optimized based on the consensus design by fusion based on the similarity between the N-terminus and VLR structure of an internalin having an LRR structure.
- Lipibody proteins can be divided into concave and convex regions in structure (FIG. 1). The concave regions are known for their high degree of sequence diversity and important sites for protein interaction. Convex regions, on the other hand, play a role in keeping the overall structure of the protein stable based on highly conserved sequences.
- the lipid body protein may include all of the fusion LRR family proteins in which all proteins belonging to the LRR family having a repeat module are improved in water soluble expression and protein biophysical properties by the above method.
- VLR Variable Lymphocyte Receptor
- Polypeptides fused with the N-terminus and VLR protein of the internalin B protein have increased water solubility and expression than the VLR protein to which the internalin B protein is not fused, and thus can be used for the preparation of novel protein therapeutics based thereon.
- LRR protein means a protein composed of a combination of modules in which leucine is repeated at a predetermined position, and (i) has one or more LRR repeating modules, and (ii) the LRR.
- the repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN" in a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan Hydrophobic amino acids, such as N, asparagine, glutamine, serine, cysteine or threonine, x means any amino acid, (iv) LRR family protein means a protein having a three-dimensional structure, such as horseshoe.
- the LRR family protein of the present invention is a repeat module having a sequence known in nature or having a sequence unknown in nature through the design of a consensus design, etc., as well as found using a newly induced mRNA or cDNA in vivo. It may include all variants having a skeletal structure of.
- the term "internal B protein” is a type of LRR family protein expressed in Listeria strains, and has an N-terminal structure different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule. It is known to have a stable expression in microorganisms.
- the N-terminus of these internalin proteins is stable in the microorganisms because the N-terminus, which is the most important for the folding of the repeat module, is not only derived from the microorganism but also has a stable shape in which its shape includes an alpha helix. Can be used effectively.
- N-terminus of an internalin protein refers to the N-terminus of an internalin protein necessary for water-soluble expression and folding of the protein, and refers to an alpha helical capping motif and a repeat module of an internalin protein. it means.
- the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein necessary for water soluble expression and folding of the protein, including, for example, the alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" (SEQ ID NO: 9) and a repeat module. can do.
- the repeating module pattern may include "LxxLxxLxLxxN" (SEQ ID NO: 10).
- L in the repeating module pattern is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine, x means any hydrophilic amino acid.
- the N-terminus of the internalin protein can be selected as the N-terminus having high structural similarity according to the type of LRR family protein that can be fused, and the most stable amino acid can be selected through calculation of binding energy and the like. Variation is possible.
- the term "brutontyrosine kinase” is a protein belonging to the non-receptor type tyrosine kinase in the Tec kinase group, and is important for cell division and proliferation in various B cell malignancies such as chronic lymphocytic leukemia and mantle cell lymphoma.
- a molecular weight of about 76,200 consisting of a Pleckstrin homology (aka PH) domain, Src homology domain 3 (aka SH3), Src homology domain 2 (aka SH2), a kinase domain.
- Pleckstrin homology aka PH
- Src homology domain 3 aka SH3
- Src homology domain 2 aka SH2
- the present invention also relates to a polynucleotide encoding the above lipida body.
- the present invention also relates to a vector comprising the polynucleotide.
- the polynucleotide is not particularly limited thereto, but may be a polynucleotide encoding an amino acid sequence of any one of SEQ ID NOs: 2 to 4, 70% or more of the polynucleotide, more preferably 80 It may be a polynucleotide having a nucleotide sequence having at least%, more preferably at least 90% homology, but is not particularly limited thereto.
- the term "vector” refers to a DNA preparation containing a nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence to allow expression of the target protein in a suitable host.
- the regulatory sequence includes a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosomal binding site, and a sequence regulating termination of transcription and translation.
- the vector used in the present invention is not particularly limited as long as it can be replicated in the host, and any vector known in the art may be used.
- Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
- pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A can be used as the phage vector or cosmid vector
- pBR, pUC, and pBluescriptII systems are used as plasmid vectors.
- pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
- the vector usable in the present invention is not particularly limited and known expression vectors can be used.
- pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a, pcDNA3.1 vector and the like can be used.
- pET-21a, pET-32a, pcDNA3.1 vectors can be used.
- the present invention also relates to a recombinant microorganism into which the polynucleotide or the vector comprising the polynucleotide is introduced.
- the term "recombinant microorganism” refers to a cell in which a vector having a gene encoding at least one target protein is transfected into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells.
- bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; Yeast cells; Fungal cells such as Pchia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, bow melanoma cells; Or plant cells.
- the host cell usable in the present invention is not particularly limited, but Escherichia coli may be preferably used as the host cell. Most preferably E. coli BL21 (DE3), OrigamiB (DE3) can be used as the host cell. In addition, preferably, animal cells can be used as host cells. Most preferably HEK293, Ramos can be used as a host cell.
- the term “transformation” refers to introducing a vector comprising a polynucleotide encoding a target protein into a host cell or integrating a polynucleotide encoding a target protein into a chromosome of the host cell to complete the polynucleotide in the host cell. Means that the protein that is encoded by the gene can be expressed. Transformed polynucleotides include all of them, as long as they can be expressed within the host cell, whether they are inserted into or located outside the chromosome of the host cell. The polynucleotide also includes DNA and RNA encoding the target protein.
- the polynucleotide may be introduced in any form as long as it can be introduced into and expressed in a host cell.
- the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct containing all elements necessary for self-expression.
- the expression cassette typically includes a promoter, transcription termination signal, ribosomal binding site and translation termination signal operably linked to the polynucleotide.
- the expression cassette may be in the form of an expression vector capable of self replication.
- the polynucleotide may be introduced into the host cell in its own form and operably linked with a sequence required for expression in the host cell.
- the present invention comprises the steps of: (i) culturing the recombinant microorganism to express the lipid body; And (ii) comprising the step of recovering the expressed lipid body, relates to a method for producing a lipid body.
- the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, continuous culture method, fed-batch culture method, and the like, and the culture conditions are not particularly limited thereto.
- a basic compound e.g. sodium hydroxide, potassium hydroxide or ammonia
- an acidic compound e.g.
- Controllable, oxygen or oxygen-containing gas mixture can be introduced into the culture to maintain aerobic conditions, the incubation temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, for about 10 to 160 hours It is preferable to incubate.
- the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
- the culture medium used may include sugars and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), fats and fats (e.g. soybean oil, sunflower seeds) as carbon sources.
- sugars and carbohydrates e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
- fats and fats e.g. soybean oil, sunflower seeds
- fatty acids e.g. palmitic acid, stearic acid and linoleic acid
- alcohols e.g. glycerol and ethanol
- organic acids e.g. acetic acid
- Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and Ammonium nitrate) and the like can be used individually or in combination;
- As a source of phosphorus, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, a corresponding sodium-containing salt, and the like can be used individually or in combination;
- Other metal salts such as magnesium sulfate or iron sulfate, and essential growth-promoting substances such as amino acids and vitamins.
- the method for recovering the lipid body produced in the present invention can collect the lipid body using a suitable method known in the art according to a culture method, for example, batch, continuous or fed-batch culture method.
- the present invention provides a lipid body in which a lipid body that selectively binds to the SH2 domain of Bruton's tyrosine kinase and a cell transfer peptide represented by the amino acid sequence of SEQ ID NO: 6 are fused to a body body. conjugate).
- the repeating body (repebody-conjugate) may be characterized in that represented by the amino acid sequence of SEQ ID NO: 5.
- the present invention also relates to a polynucleotide encoding said lipido-complex.
- the present invention also relates to a vector comprising the polynucleotide.
- the present invention also relates to a recombinant microorganism into which the polynucleotide or the vector comprising the polynucleotide is introduced.
- the present invention comprises the steps of: (i) culturing the recombinant microorganism to express the lipido-complex; And (ii) recovering the expressed lipido-complex.
- the cell transfer peptide may be linked to the C-terminus of the lipidi through a linker for the purpose of preserving the protein's original structure and maximizing activity.
- the linker is generally composed of amino acids, but the type and length thereof are not particularly limited, and as in one embodiment of the present invention, a (G3S) n spacer having flexible properties, that is, three glycines and one serine It can be arranged repeatedly, or GSAGSAAGSG linker or alpha-helix linker with rigid properties, i.e.
- EAAAK EAAAK
- n is an integer greater than or equal to 1, but in the case of G3S, glycine and serine may be modified in various numbers and arrangements, and DRDD (where D is aspartic acid, R in order to introduce more hydrophilic properties in consideration of physical properties)
- DRDD DRDD
- D is aspartic acid, R in order to introduce more hydrophilic properties in consideration of physical properties
- Various linkers containing charged amino acids such as silver and arginine may also be used.
- the recombinant vector is transiently overexpressed by delivering the recombinant vector to an animal cell, and then the binding of the overexpressed lipidobody and bruton tyrosine kinase in the animal cell was confirmed, and the mutant bruton tyrosine It was confirmed to inhibit the autoactive site of kinase (FIG. 6).
- the mutant bruton tyrosine kinase used a form in which the cysteine amino acid 481, which is the most frequent drug resistance mutation, was mutated to serine. After overexpressing a polynucleotide encoding a mutant brutontyrosine kinase with drug resistance and a recombinant vector encoding a lipidi to an animal cell using lipid transfection, it is preferably brutontyrosine using Western blot. The degree of phosphorylation of tyrosine 223, a self-activating site of kinases, was confirmed.
- the present invention relates to a composition for treating cancer containing the above-described lipid body or the lipid body complex as an active ingredient.
- the cancer is non-Hodgkin lymphoma, non-Hodgkin lymphoma, acute myeloid leukemia, acute lymphocytic leukemia, multiple myeloma ( group consisting of multiple myeloma, head and neck cancer, lung cancer, glioblastoma, colon / rectal cancer, pancreatic cancer, breast cancer, ovarian cancer, melanoma, prostate cancer, kidney cancer and mesothelioma It may be characterized in that selected from.
- treatment in the present invention means not only inhibiting or alleviating the cancer or one or more symptoms caused by the administration of the composition, but also preventing the treatment or progression of the cancer to reverse the symptoms of the cancer.
- prevention in the present invention means any action that inhibits or delays the onset of the disease by administration of the composition.
- the prevention or treatment of cancer is achieved by combining the lipid body or the lipid body complex developed in the present invention with the substrate of the lipid body, for example, when the substrate of the lipid body is the SH2 domain of bruton tyrosine kinase.
- the substrate of the lipid body is the SH2 domain of bruton tyrosine kinase.
- Lipibody and the SH2 domain of bruton tyrosine kinase bind to inhibit the activity of bruton tyrosine kinase or mutant bruton tyrosine kinase to prevent or treat cancer.
- composition for preventing or treating cancer containing the lipid body or the lipid body complex of the present invention as an active ingredient may further include a pharmaceutically acceptable carrier, and may be formulated together with the carrier.
- the amount of the lipida or lipida-composite in the composition is not limited but may be added at 0.01 to 95% by weight of the total composition weight.
- the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not irritate an organism and does not inhibit the biological activity and properties of the administered compound.
- Acceptable pharmaceutical carriers in compositions formulated as liquid solutions are sterile and physiologically compatible, including saline, sterile water, Ringer's solution, buffered saline, albumin injectable solutions, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers and bacteriostatic agents may be added as necessary.
- diluents may be additionally added to formulate into injectable formulations, pills, capsules, granules or tablets such as aqueous solutions, suspensions, emulsions and the like.
- Cancer preventive or therapeutic composition comprising the polypeptide of the present invention and a pharmaceutically acceptable carrier is applicable to any formulation comprising it as an active ingredient, it can be prepared in oral or parenteral formulations.
- Pharmaceutical formulations of the invention may be oral, rectal, nasal, topical (including the cheek and sublingual), subcutaneous, vaginal or parenteral (intramuscular, subcutaneous). And forms suitable for administration by inhalation or insufflation.
- Oral dosage forms containing the composition of the present invention as an active ingredient include, for example, tablets, troches, lozenges, water-soluble or oily suspensions, preparation powders or granules, emulsions, hard or soft capsules, syrups or elixirs. can do.
- lactose For formulation into tablets and capsules, lactose, saccharose, sorbitol, mannitol, starch, amylopectin, binders such as cellulose or gelatin, excipients such as dicalcium phosphate, disintegrants such as corn starch or sweet potato starch, stearic acid masne It may include a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax, and in the case of a capsule, it may further contain a liquid carrier such as fatty oil in addition to the above-mentioned materials.
- a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax
- a liquid carrier such as fatty oil in addition to the above-mentioned materials.
- Formulations for parenteral administration comprising the composition of the present invention as an active ingredient, for injection, such as subcutaneous injection, intravenous injection or intramuscular injection, a suppository injection method or aerosol for spraying by inhalation through the respiratory system It can be formulated as To formulate injectable formulations, the compositions of the present invention may be mixed in water with stabilizers or buffers to prepare solutions or suspensions, which may be formulated for unit administration of ampoules or vials. For infusion into suppositories, it may be formulated into rectal compositions such as suppositories or enemas, including conventional suppository bases such as cocoa butter or other glycerides. When formulated for spraying such as aerosols, a propellant or the like may be combined with the additives to disperse the dispersed dispersion or wet powder.
- a propellant or the like may be combined with the additives to disperse the dispersed dispersion or wet powder.
- the present invention relates to a method for preventing or treating cancer, comprising administering a composition for preventing or treating cancer comprising the lipida or lipida-complex as an active ingredient.
- the invention also relates to a method for preventing or treating cancer comprising the step of administering said lipido or lipido-complex.
- the present invention also relates to the use of the above-described lipido or lipido-complex for the prophylaxis or treatment of cancer.
- the present invention also relates to a method of using said lipido or lipido-complex for the manufacture of a medicament for preventing or treating cancer.
- the term "administration" means introducing a pharmaceutical composition of the present invention to a patient in any suitable manner.
- the route of administration of the composition of the present invention may be administered via various routes orally or parenterally as long as it can reach the target tissue, and specifically, oral, rectal, topical, intravenous, intraperitoneal, intramuscular, intraarterial, It may be administered in a conventional manner via transdermal, nasal, inhaled, intraocular or intradermal routes.
- the treatment method of the present invention includes administering a composition for preventing or treating cancer of the present invention in a pharmaceutically effective amount.
- a suitable total daily dose may be determined by the practitioner within the correct medical judgment.
- the specific therapeutically effective amount for a particular patient may be based on the specific composition, including the type and severity of the reaction to be achieved, whether or not other agents are used in some cases, the age, weight, general health, sex and diet of the patient, time of administration, It is desirable to apply differently depending on the route of administration and the rate of release of the composition, the duration of treatment, and the various factors and similar factors well known in the medical arts, including drugs used with or concurrent with the specific composition. Therefore, the effective amount of the composition for preventing or treating cancer suitable for the purpose of the present invention is preferably determined in consideration of the above-mentioned matters.
- FIG. 1 is a schematic diagram showing the overall structure showing the amino acid residues to build a random library.
- Mutagenic primers for library construction were synthesized to replace the selected amino acids with NNK degenerate codons.
- the primer sequence is as follows.
- SEQ ID NO: 7 M1 CTG AAA GAA CTG ACC AAT CTG ACG TAT CTG NNK CTG NNK NNK AAC CAA CTG CAG AGC CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA;
- SEQ ID NO: 8 M2 GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC GGT GTC TTC GAT AAA CTG ACC AAC CTG ACG TAC
- the primers were used to perform overlap polymerase chain reaction (overlap PCR) on two modules to obtain library DNA, and to phagemid pBEL118N described in the prior patent of the inventor (No. 10-2012-0019927).
- overlap PCR overlap polymerase chain reaction
- the obtained library was introduced into E. coli TG-1 by electroporation to obtain a transformant, thereby constructing a library having a diversity of 1.0 ⁇ 10 8 level.
- a polypeptide that can bind to the SH2 domain of Bruton's tyrosine kinase was selected and purified.
- the SH2 domain of bruton tyrosine kinase was added to the immunotube at a concentration of 10 ⁇ g / ml and coated at 4 ° C. for 16 hours. .
- the coated immunotubes were washed once with PBS and blocked with PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 for 2 hours at 4 ° C.
- the purified phages were then added to the coated immunotubes at a concentration of 10 12 cfu / ml and allowed to react at room temperature for 2 hours. After the reaction was completed, washed 5 times with a PBS solution (TPBS) containing 0.05% Tween 20 for a total of 2 minutes. Finally, 1 ml 0.2 M Glycine-HCl (pH 2.2) was added to the immunotube, and the reaction was carried out at room temperature for 12 minutes, so that the phage which expressed the surface of a candidate ribibody capable of binding to the SH2 domain of brutontyrosine kinase. Eluted.
- Phages selected by the method of Example 2 were subjected to an Enzyme-linked immunosorbent assay (ELISA) using 96-well plates coated with the Bru2 tyrosine kinase SH2 domain and Bovine serum albumin (BSA).
- ELISA Enzyme-linked immunosorbent assay
- BSA Bovine serum albumin
- the module-based affinity enhancement technology built in the prior patent (No. 10-2012-0019927) was used to secure the repeat body with increased binding force.
- the first library and the adjacent module (LRRV1) are selected to select the prior patent example. In the same manner as 2, four residues in the concave region were mutated.
- Example 6 Confirmation of binding of selected Lipibodies to bruton tyrosine kinase in animal cells and analysis of the possibility of inhibiting self-activation of drug resistance mutant bruton tyrosine kinase
- the supernatant which is a cell lysate, was isolated and mixed with protein A-bound agarose beads to remove proteins in the supernatant that bind nonspecifically to the beads. After removing the beads by centrifugation and the supernatant was separated.
- the supernatant was treated with immunoglobulin G, which recognizes the myc polypeptide sequence introduced at the end of F10 lipida, and reacted at 4 ° C. for 1 hour, and then treated with protein A-bound agarose beads for 1 hour at 4 ° C. Thereafter, the diluted cell membrane digestion solution was washed five times, and beads, immunoglobulin G, and proteins were separated using 5-fold concentrated SDS-PAGE buffer. The sample boiled at 95 for 10 minutes was injected into 12% acrylamide SDS-PAGE, separated by protein size, and transferred to the nitrocellulose membrane through the transfer process. The blocking process was performed by treating PBS solution (TPBSA) containing Tween 20.
- TPBSA PBS solution
- primary immunoglobulin G that recognizes myc polypeptide inserted at the end of Bruton's tyrosine kinase and F10 lipidobody was treated, and primary immunoglobulin G that recognizes beta-actin as a control. After 16 hours reaction at 4 ° C it was washed three times with TPBS. After treatment with horseradish peroxidase (HRP) -conjugated secondary immunoglobulin G, the reaction was washed three times with TPBS after one hour at room temperature. Substrates were processed to detect chemiluminescent signals.
- HRP horseradish peroxidase
- the process of injecting a recombinant vector into animal cells and obtaining a supernatant as a cell lysate was performed in the same manner as the above method.
- the concentration of the cell lysate was measured, and 10 g of protein was separated by size through SDS-PAGE, and the procedure was performed in the same manner as the above method.
- novel polypeptide according to the present invention specifically binds to the SH2 domain of Bruton's tyrosine kinase, replaces existing chemical drugs with high side effects, and minimizes drug resistance by secondary mutation of phosphatase. Since the lipid body can be effectively delivered to B lymphocytic cells by fusing the polypeptide of the present invention and the cell delivery peptide, the present invention can be widely used for the development of a prophylactic or therapeutic agent for various diseases associated with bruton tyrosine kinase.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로는 브루톤티로신키나아제의 SH2 도메인에 결합하는 폴리펩티드, 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현벡터, 상기 발현벡터가 도입된 재조합 미생물 및 상기 재조합 미생물을 이용하여 상기 폴리펩티드를 생산하는 방법에 관한 것이다. 또한, 상기 리피바디와 세포 전달 펩티드가 융합된 리피바디-복합체, 상기 리비파디-복합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현벡터, 상기 발현벡터가 도입된 재조합 미생물 및 상기 재조합 미생물을 이용하여 상기 리피바디-복합체를 생산하는 방법에 관한 것이다. 본 발명에 따른 신규한 폴리펩티드는 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하여 종양 유발 인산화 효소의 활성을 억제할 수 있으므로, 브루톤티로신키나아제와 연관된 다양한 암의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있을 것이다.
Description
본 발명은 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도에 관한 것으로, 보다 구체적으로 본 발명은 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 결합하는 폴리펩티드, 상기 폴리펩티드를 생산하는 방법 및 상기 펩타이드와 세포 전달 펩티드가 융합한 복합체 및 이의 용도에 관한 것이다.
종양 유발 인산화 효소는 세포 내에서 세포의 성장, 분열, 및 신호 전달에 중요한 역할을 한다. 돌연변이가 발생된 종양 유발 인산화 효소는 과도한 신호 전달로 인하여 비정상적인 세포 증식으로 이어져 여러 종류의 암 발생으로 발전된다. 따라서 암 치료제 개발에 있어서 종양 유발 인산화 효소는 중요한 표적 물질이다.
종양 유발 인산화 효소를 표적으로 하고 그 기능을 저해하는 대부분의 화학 약물들은 인산화 효소의 ATP 결합 부위를 표적으로 하고 있다. 하지만 화학 약물들은 부작용이 크고 인산화 효소의 이차 돌연변이에 의한 약물 저항성에 매우 취약하다는 단점이 있다(Johnson, A. R., et al., ACS chemical biology, Vol. 11(10), pp. 2897-2907, 2016).
브루톤티로신키나아제는 Tec 키나아제 그룹 중 비수용체형 티로신 키아나제에 속하는 단백질로, 만성 림프구성 백혈병, 외투세포림프종 등 다양한 B 세포 악성 종양에서 세포 분열과 증식에 관여하는 중요한 인자로 알려져 있다. 현재 개발된 브루톤티로신키나아제 치료제 또한 화학 약물로 한정되어 있으며, 만성 림프구성 백혈병 재발 환자에서 돌연변이로 인한 약물 저항성이 나타나는 것이 알려졌다. (Johnson, A. R., et al., ACS chemical biology, Vol. 11(10), pp. 2897-2907, 2016). 따라서 브루톤티로신키나아제의 ATP 결합 부위가 아닌, 활성을 조절하는 알로스테릭 도메인을 표적으로 하는 새로운 약물 대체제 개발이 매우 필요한 실정이다.
브루톤티로신키나아제는 Pleckstrin homology (일명 PH) 도메인, Src homology domain 3 (일명 SH3), Src homology domain 2 (일명 SH2), 키나아제 도메인으로 이루어져 있다. SH3 도메인과 SH2 도메인은 알로스테릭 단백질로, 각각의 도메인은 상위 활성 인자와 하위 조절 인자들과 특이적인 결합을 통해 신호를 전달한다. 또한, 키나아제 도메인의 구조와 기능을 변화시키는 것으로 알려져 있다 (Wang, Q., et al., Elife, Vol. 4, 2015). 따라서 SH2 도메인을 표적으로 하여 단백질들 간의 식별 부위를 차단하고 브루톤티로신키나아제의 활성을 억제함으로써 새로운 인산화 효소 치료제 개발이 가능하다.
이러한 배경 하에, 본 발명자들은 리피바디 (repebody)라는 단백질을 이용하여 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 새로운 폴리펩티드를 설계하였다. 상기 리피바디는 LRR (Leucin-rich repeat)의 구조를 갖는 인터날린 B의 N-말단과 VLR의 구조의 유사성을 바탕으로 융합하여 컨센시스 디자인으로 최적화시킨 폴리펩티드를 의미한다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산이 가능하여 생산 단가를 낮출 수 있고, 열 및 pH 안정성이 매우 우수하여 산업적인 사용에 큰 장점을 가지고 있다. 또한 표적 물질에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며 표적 물질에 대한 특이성이 매우 탁월함을 입증한 바가 있다(대한민국 등록특허 제10-1356075호, 제10-1587622호, 제10-1713944호 및 제10-1751501호).
이에, 본 발명자들은 브루톤티로신키나아제의 SH2 도메인에 특이적인 결합 단백질 (Specific protein binder)을 개발하기 위해, 예의 노력한 결과, 리피바디를 이용하여 돌연변이 라이브러리를 제작하고, 모듈 기반 결합력 증대를 통해 브루톤티로신키나아제의 SH2 도메인에 특이적인 결합력을 갖는 신규한 폴리펩티드를 선별하였으며, 상기 폴리펩티드와 세포 전달 펩티드가 융합한 복합체를 개발하였고, 상기 폴리펩티드 및 상기 복합체가 기존의 화학 약물들이 표적하는 브루톤티로신키나아제의 ATP 결합 부위가 아닌, 브룩토티로신키나아제의 SH2 도메인에 선별적으로 결합하여 인산화 효소의 활성을 저해할 뿐만 아니라, 생물학적인 세포 성장을 억제하는 효과를 확인하고, 본 발명을 완성하게 되었다.
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
발명의 요약
본 발명의 목적은 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하는 신규한 폴리펩티드; 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 벡터; 상기 벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용하여 상기 폴리펩티드를 생산하는 방법을 제공하는 것이다.
본 발명의 다른 목적은 상기 폴리펩티드에 세포 전달 펩티드가 융합된 복합체; 상기 복합체를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 벡터; 상기 벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용하여 상기 복합체를 생산하는 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 폴리펩티드 또는 상기 복합체를 함유하는 암 예방 또는 치료용 조성물 및 상기 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 2 내지 4 중 어느 하나의 아미노산 서열로 표시되고, 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody)를 제공한다.
본 발명은 또한, 상기 리피바디를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 상기 벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용한 상기 리피바디의 제조방법을 제공한다.
본 발명은 또한, 상기 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody)와 서열번호 6의 아미노산 서열로 표시되는 세포 전달 펩티드가 융합된 리피바디-복합체(repebody-conjugate)를 제공한다.
본 발명은 또한, 상기 리피바디-복합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 상기 벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용한 상기 리피바디-복합체의 제조방법을 제공한다.
본 발명은 또한, 상기 리피바디 또는 리피바디-복합체를 유효성분으로 함유하는 암 치료용 조성물을 제공한다.
본 발명은 또한 상기 리피바디 또는 리피바디-복합체를 투여하는 단계를포함하는 암 예방 또는 치료 방법을 제공한다.
본 발명은 또한, 상기 리피바디 또는 리피바디-복합체의 암 예방 또는 치료 용도를 제공한다.
본 발명은 또한, 암 예방 또는 치료용의 약제를 제조하기 위한 상기 리피바디 또는 리피바디-복합체의 사용방법을 제공한다.
도 1은 본 발명에서 브루톤티로신키나아제의 SH2 도메인에 결합하는 리피바디 개발을 위해 무작위적인 라이브러리를 구축한 아미노산 잔기들을 표시한 전체 구조를 나타내는 개략도이다.
도 2는 본 발명에서 구축한 파지 라이브러리를 이용하여 브루톤티로신키나아제의 SH2 도메인에 대한 파지 디스플레이 바이오 패닝을 수행 후 최종적으로 선별된 리피바디 클론의 결합력을 표면 플라스몬 공명 (Surface plasmon resonance, SPR, A) 및 등온 적정 열량측정법 (Isothermal titration calorimetry, ITC, B)으로 측정한 결과를 나타내는 도면이다.
도 3은 본 발명에서 선별된 F10 리피바디를 농도 별로 처리하였을 때, 정제된 브루톤티로신키나아제의 자가 활성을 억제하는 결과를 나타내는 도면이다.
도 4는 본 발명에서 선별된 F10 리피바디를 농도 별로 처리하였을 때, 정제된 브루톤티로신키나아제의 자가 활성이 억제되어 기질의 인산화 또한 줄어드는 결과를 나타내는 도면이다.
도 5는 본 발명에서 선별된 F10 리피바디를 인코딩하는 뉴클레오티드와 브루톤티로신키나아제를 인코딩하는 뉴클레오티드를 포함하는 재조합 벡터를 동물 세포 HEK293에 지질 형질주입법을 이용하여 동물 세포 내에서 과발현 시킨 후, 면역침강법을 통해 F10 리피바디를 침강하였을 때 브루톤티로신키나아제가 함께 침강되는 결과를 보여줌으로써, 동물 세포에서 발현된 F10 리피바디와 브루톤티로신키나아제는 결합력을 유지하고 있다는 결과를 나타내는 도면이다.
도 6은 본 발명에서 선별된 F10 리피바디를 인코딩하는 뉴클레오티드와 약물 저항성 돌연변이 브루톤티로신키나아제를 인코딩하는 뉴클레오티드를 포함하는 재조합 벡터를 동물 세포 HEK293에 지질 형질주입법을 이용하여 동물 세포 내에서 과발현 시킨 후, 웨스턴 블롯 (western blot)을 통해 F10 리피바디는 약물 저항성 돌연변이 브루톤티로신키나아제임에도 불구하고 자가 활성 부위인 티로신223번의 인산화를 감소시킬 수 있다는 것을 확인한 결과를 나타내는 도면이다.
도 7은 세포 전달 펩티드가 융합된 폴리펩티드가 표적 단백질인 브루톤티로신키나아제의 SH2 도메인 및 브루톤티로신키나아제의 전체에 결합하는지를 확인한 실험 결과를 나타내는 효소면역측정법 (ELISA) 의 도면이다.
도 8은 브루톤티로신키나아제의 SH2 도메인을 표적하는 선별된 리피바디가 생물학적인 세포 성장을 억제하는 효과를 발휘한다는 것을 확인한 실험 결과를 나타내는 도면이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하는 폴리펩티드를 선별하고, 상기 폴리펩티드의 브루톤티로신키나아제의 활성 억제 효과를 확인하고자 하였다.
본 발명에서는, 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드를 브루톤티로신키나아제의 SH2 도메인의 파지미드를 이용한 바이오패닝을 통해 특이적으로 결합하는 폴리펩티드의 선별을 수행하고, 이들의 결합력을 개선하는 작업을 수행하였다. 그 결과 브루톤티로신키나아제의 SH2 도메인에 특이적인 폴리펩티드를 제조하였다.
즉, 본 발명의 일 실시예에서는 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합할 수 있는 신규한 폴리펩티드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 N-말단, 가변 림프구 수용체 (Variable Lymphocyte Receptor, VLR) 의 LRR (Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩티드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다. 상기 브루톤티로신키나아제의 SH2 도메인에 결합하는 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드는 서열번호 2 내지 4 의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 해당 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로 부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩티드를 코딩하는 폴리뉴클레오티드를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명자들은 상기 파지미드를 포함하는 서열번호 1에 해당하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 브루톤티로신키나아제의 SH2 도메인에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩티드(서열번호 2)를 선별하였다.
이후, 브루톤티로신키나아제의 SH2 도메인에 대한 결합력을 증대시키기 위하여 위치지정 돌연변이(site directed mutagenesis)를 수행한 결과 결합력이 증대된 신규한 폴리펩티드(서열번호 3)를 선별하였다.
이후, 충분한 결합력을 갖기 위한 결합력 증대 실험을 한 번 더 실시하였고, 위치지정 돌연변이(site directed mutagenesis)를 수행한 결과 결합력이 증대된 신규한 폴리펩티드(서열번호 4)를 선별하여, 그 결합력이 매우 높은 것을 확인할 수 있었다(도 1 내지 2).
따라서, 본 발명은 일 관점에서, 서열번호 2 내지 4 중 어느 하나의 아미노산 서열로 표시되고, 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody)에 관한 것이다.
본 발명의 용어 "리피바디(Repebody)"란, LRR 구조를 갖는 인터날린의 N-말단과 VLR 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리펩티드이다. 리피바디 단백질은 구조상 오목한 지역(concave)과 볼록한 지역(convex)으로 나누어 질 수 있다 (도 1). 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명의 용어 "가변 림프구 수용체(Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성장어에서 발현되는 면역 기능 단백질로 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩티드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규 단백질 치료제 제조에 사용될 수 있다.
본 발명에서 용어 "LRR(Leucine Rich Repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌을, x는 임의의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체 내에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것과 더불어 컨센서스 디자인(consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명에서 용어 "인터날린 B 단백질"이란, 리스테리아(Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종으로, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 상이한 N-말단 구조를 가지고 있어 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘(folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐만 아니라 그 형태가 알파 나선을 포함하는 안정적인 모양을 가졌기에 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명에서 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프(capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 제한 없이 포함하며, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE"(서열번호 9) 및 반복 모듈을 포함할 수 있다. 또한 반복 모듈 패턴은 "LxxLxxLxLxxN"(서열번호 10)을 포함할 수 있다. 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 임의의 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어, "브루톤티로신키나아제”는 Tec 키나아제 그룹 중 비수용체형 티로신 키아나제에 속하는 단백질로, 만성 림프구성 백혈병, 외투세포림프종 등 다양한 B 세포 악성 종양에서 세포 분열과 증식에 관여하는 중요한 인자이다. 분자량은 약 76,200인 단백질로서, Pleckstrin homology (일명 PH) 도메인, Src homology domain 3 (일명 SH3), Src homology domain 2 (일명 SH2), 키나아제 도메인으로 이루어져 있다. SH3 도메인과 SH2 도메인은 알로스테릭 단백질로, 각각의 도메인은 상위 활성 인자와 하위 조절 인자들과 특이적인 결합을 통해 신호를 전달한다. 또한, 키나아제 도메인의 구조와 기능을 변화시키는 것으로 알려져 있다.
또한 본 발명은 상기 리피바디를 코딩하는 폴리뉴클레오티드에 관한 것이다.
또한 본 발명은 상기 폴리뉴클레오티드를 포함하는 벡터에 관한 것이다.
본 발명에 있어서, 상기 폴리뉴클레오티드는 특별히 이에 제한되지 않으나, 상기 서열번호 2 내지 4 중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오티드가 될 수 있고, 상기 폴리뉴클레오티드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오티드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오티드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a, pcDNA3.1 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a, pcDNA3.1 벡터를 사용할 수 있다.
또한 본 발명은 상기 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 벡터가 도입된 재조합 미생물에 관한 것이다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다. 또한, 바람직하게는 동물 세포를 숙주 세포로 사용할 수 있다. 가장 바람직하게는 HEK293, Ramos를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오타이드를 포함하는 벡터를 숙주 세포 내에 도입하거나 표적 단백질을 암호화하는 폴리뉴클레오타이드를 숙주 세포의 염색체에 통합 완성시켜 숙주 세포 내에서 상기 폴리뉴클레오타이드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질전환된 폴리뉴클레오타이드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오티드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주 세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오타이드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트(expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
또한 본 발명은 (i) 상기 재조합 미생물을 배양하여 상기 리피바디를 발현시키는 단계; 및 (ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 리피바디의 생산방법에 관한 것이다.
상기 방법에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지중으로 분비되거나 세포 내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예:팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예:아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명에서 생산된 상기 리피바디를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 리피바디를 수집할 수 있다.
한편, 본 발명의 리피바디에 세포 전달 펩티드를 융합할 경우, 세포 투과 효과가 향상하여 세포 내에서 브루톤티로신키나아제의 활성을 억제할 수 있을 것으로 예측하였다.
즉, 본 발명의 다른 실시예에서는 서열번호 6의 아미노산 서열로 표시되는 세포 전달 펩티드와 상기 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하는 리피바디가 융합된 리피바디-복합체의 경우, 세포 내에서 브루톤티로신키나아제의 활성을 억제하여 암 세포의 성장을 억제하는 것을 확인하였다(도 8).
따라서, 본 발명은 다른 관점에서, 상기 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody)와 서열번호 6의 아미노산 서열로 표시되는 세포 전달 펩티드가 융합된 리피바디-복합체(repebody-conjugate)에 관한 것이다.
본 발명에 있어서, 상기 리피바디-복합체(repebody-conjugate)는 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
또한 본 발명은 상기 리피바디-복합체를 코딩하는 폴리뉴클레오티드에 관한 것이다.
또한 본 발명은 상기 폴리뉴클레오티드를 포함하는 벡터에 관한 것이다.
또한 본 발명은 상기 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 벡터가 도입된 재조합 미생물에 관한 것이다.
또한 본 발명은 (i) 상기 재조합 미생물을 배양하여 상기 리피바디-복합체를 발현시키는 단계; 및 (ii) 상기 발현된 리피바디-복합체를 회수하는 단계를 포함하는, 리피바디의 생산방법에 관한 것이다.
본 발명에서 상기 세포 전달 펩티드는 단백질의 본래 구조를 온전히 보존하며 활성을 최대화 시킬 수 있도록 하는 목적으로 링커(linker)를 통하여 리피바디의 C-말단에 연결될 수 있다.
여기서 링커는 일반적으로 아미노산으로 구성되지만, 그 종류와 길이가 특별히 제한되는 것은 아니며, 본 발명의 하나의 실시예에서와 같이 flexible 한 성질을 가진 (G3S)n spacer, 즉, glycine 3개와 serine 1개가 반복적으로 배열될 수 있고, 또는 GSAGSAAGSG 링커 혹은 rigid 한 성질을 가진 alpha-helix linker, 즉 (EAAAK)n (여기서 E는 glutamate, A 는 alanine, K는 lysine, G는 glycine, S는 serine 이며, 상기 n 은 일반적으로 1 이상 정수이나 G3S 의 경우 glycine 과 serine 의 숫자 및 배열이 다양한 변형체도 가능하다) 도 가능하며, 물성을 고려하여 보다 hydrophilic 한 성질을 도입하기 위해 DRDD (여기서 D는 aspartic acid, R은 arginine) 등의 charged 아미노산이 포함된 다양한 링커들도 이용될 수 있다.
본 발명의 다른 실시예에서는 상기 재조합 벡터를 동물 세포에 전달하여 리피바디를 일시적으로 과발현시킨 다음, 동물 세포 내에서 상기 과발현된 리피바디와 브루톤티로신키나아제의 결합 여부를 확인하였으며, 돌연변이 브루톤티로신키나아제의 자가 활성 부위를 억제하는 것을 확인하였다(도 6).
본 발명에서 돌연변이 브루톤티로신키나아제는 약물 저항성 돌연변이 중 가장 빈도가 높은 481번 아미노산인 시스테인이 세린으로 변이된 형태를 사용하였다. 약물 저항성을 가지는 돌연변이 브루톤티로신키나아제를 코딩하는 폴리뉴클레오티드와 리피바디를 코딩하는 재조합 벡터를 동물 세포에 지질 형질주입법을 이용하여 과발현 한 후, 바람직하게 웨스턴 블롯 (Western blot)을 이용하여 브루톤티로신키나아제의 자가 활성 부위인 티로신223번의 인산화 정도의 감소 여부를 확인하였다. 자가 활성 부위인 티로신223번의 인산화가 이루어지지 않으면 브루톤티로신키나아제는 완벽하게 활성화되지 않는 것을 의미한다. 따라서 상기 리피바디를 세포 내에서 과발현시켜 브루톤티로신키나아제의 자가 활성 부위인 티로신223번의 변화를 관찰할 경우, 돌연변이 브루톤티로신키나아제의 활성을 확인할 수 있다.
따라서, 본 발명은 또 다른 관점에서, 상기 리피바디 또는 리피바디-복합체를 유효성분으로 함유하는 암 치료용 조성물에 관한 것이다.
본 발명에서 상기 암은 비호지킨 림프종 (non-Hodgkin lymphoma), 호지킨 림프종 (non-Hodgkin lymphoma), 급성 골수성 백혈병(acute-myeloid leukemia), 급성 림프구성 백혈병 (acute-lymphoid leukemia), 다발성 골수종 (multiple myeloma), 경부암 (head and neck cancer), 폐암, 교모세포종 (glioblastoma), 대장/직장암, 췌장암, 유방암, 난소암, 흑색종 (melanoma), 전립선암, 신장암 및 중피종 (mesothelioma)으로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.
본 발명에서 용어 "치료"란 조성물의 투여로 암이나 그로부터 야기된 하나 또는 그 이상의 증상을 억제하거나 완화하는 것뿐만 아니라 암의 증상을 반전시키는 암의 치료 또는 암의 진행을 방지하는 것을 의미한다. 본 발명에서 용어 "예방"이란 조성물의 투여로 질병을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다.
본 발명에서 암의 예방 또는 치료는 본 발명에서 개발한 리피바디 또는 리피바디-복합체가 리피바디의 기질과 결합하여 이루어지는 것으로, 예를 들어, 리피바디의 기질이 브루톤티로신키나아제의 SH2 도메인일 경우, 리피바디와 브루톤티로신키나아제의 SH2 도메인이 결합하여, 브루톤티로신키나아제 또는 돌연변이 브루톤티로신키나아제의 활성을 억제하여 암을 예방 또는 치료하는 것이다.
본 발명의 리피바디 또는 리피바디-복합체를 유효성분으로 함유하는 암 예방 또는 치료용 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있으며, 담체와 함께 제제화 될 수 있다.
본 발명에서 상기 조성물에서 리피바디 또는 리피바디-복합체의 양은 제한되지는 않지만 전체 조성물 중량의 0.01 내지 95 중량%로 가할 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화 할 수 있다.
본 발명의 상기 폴리펩타이드 및 약학적으로 허용 가능한 담체를 포함하는 암 예방 또는 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입 (inhalation) 또는 주입(insufflation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화 할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화 할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화 할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화 할 수 있다. 에어로졸제 등의 스프레이용으로 제형화 하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
본 발명은 또 다른 관점에서, 상기 리피바디 또는 리피바디-복합체를 유효성분으로 포함하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는 암을 예방 또는 치료하는 방법에 관한 것이다. 본 발명은 또한 상기 리피바디 또는 리피바디-복합체를 투여하는 단계를 포함하는 암 예방 또는 치료 방법 에 관한 것이다. 본 발명은 또한, 상기 리피바디 또는 리피바디-복합체의 암 예방 또는 치료 용도에 관한 것이다. 본 발명은 또한, 암 예방 또는 치료용의 약제를 제조하기 위한 상기 리피바디 또는 리피바디-복합체의 사용방법에 관한 것이다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 암 예방 또는 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
실시예
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 파지 디스플레이를 이용한 브루톤티로신키나아제의 SH2 도메인에 특이적 결합 리피바디 선별을 위한 라이브러리 구축
브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하는 리피바디 선별을 위해 선행특허 (제10-2012-0019927호)에서 이미 구축한 라이브러리 파지를 이용하여 파지 디스플레이를 수행하였다 (도 1). 도 1은 무작위적인 라이브러리를 구축하고자 하는 아미노산 잔기들을 표시한 전체 구조를 나타내는 개략도이다.
상기 선택한 아미노산을 NNK 동의코돈 (degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다. 프라이머 서열은 아래와 같다.
서열번호 7 M1: CTG AAA GAA CTG ACC AAT CTG ACG TAT CTG NNK CTG NNK NNK AAC CAA CTG CAG AGC CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA;
서열번호 8 M2: GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC GGT GTC TTC GAT AAA CTG ACC AAC CTG ACG TAC
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응 (overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 파지미드 pBEL118N에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법 (electroporation)으로 대장균 TG-1에 도입하여 형질전환체를 수득함으로써, 1.0x108수준의 다양성을 갖는 라이브러리를 구축하였다.
실시예 2: 리피바디 라이브러리의 패닝 과정을 통한 브루톤티로신키나아제의 SH2 도메인과 결합하는 폴리펩티드 선별
실시예 1에서 구축한 라이브러리를 사용하여 브루톤티로신키나아제의 SH2 도메인에 결합할 수 있는 폴리펩티드를 선별하여 정제하였다. 브루톤티로신키나아제의 SH2 도메인에 결합할 수 있는 후보를 선별하기 위하여, 브루톤티로신키나아제의 SH2 도메인를 면역튜브 (Immuno-tube)에 10 ㎍/㎖의 농도로 가하고, 4 ℃에서 16시간동안 코팅하였다. 상기 코팅된 면역튜브를 PBS로 1회 세척하고, 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액 (TPBSA)으로 4 ℃에서 2시간동안 블로킹 (Blocking) 하였다. 그런 다음, 상기 정제된 파지를 1012cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 세척하였다. 마지막으로, 1 ml 0.2 M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 12분간 반응시킴으로써, 브루톤티로신키나아제의 SH2 도메인과 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 60 ㎕의 1.0 M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 10 ml 대장균 TG1 용액 (OD600=0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝 (Bio-panning) 과정을 동일하게 6회 반복하여 수행하였다.
그 결과, 각 패닝 과정을 통해 브루톤티로신키나아제의 SH2 도메인과 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 브루톤티로신키나아제의 SH2 도메인과 결합하는 라이브러리 파지가 특이적으로 증가하는 것을 확인하였다.
실시예 3: 선별된 브루톤티로신키나아제의 SH2 도메인에 대한 특이적인 결합여부 확인 및 서열 분석
실시예 2의 방법을 통하여 선별한 파지를 브루톤티로신키나아제의 SH2 도메인과 Bovine serum albumin (BSA)가 코팅된 96-웰 플레이트를 이용하여 Enzyme-linked immunosorbent assay (ELISA)를 수행하였다. BSA 대비 브루톤티로신키나아제의 SH2 도메인을 코팅한 웰의 흡광도(OD450)가 가장 높은 9개의 리피바디 후보들을 선별하고, 이들 각각의 아미노산 서열을 확인한 결과, 시스테인이 삽입된 파지를 제외한 후 한 종류의 리피바디 파지를 선별하였다 (서열번호 2).
실시예 4: 리피바디의 결합력 증가를 위한 모듈 기반 친화력 증대 방법 수행
브루톤티로신키나아제의 SH2 도메인에 결합하여 활성을 억제하기 위해서는 세포 내에서 작용할 수 있을 정도의 결합력을 갖는 리피바디 개량이 필요하다. 따라서 결합력이 증대된 리피바디를 확보하기 위해 선행특허 (제10-2012-0019927호)에서 구축한 모듈 기반 친화력 증대 기술을 사용하였다. 우선, 상기 실시예 3에서 선별한 브루톤티로신키나아제의 SH2 도메인에 결합하는 B5 리피바디의 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 기반으로 첫 번째 라이브러리와 인접한 모듈 (LRRV1)을 선택하여 상기 선행특허 실시예 2와 동일한 방식으로 오목한 지역의 4개 잔기를 돌연변이 시켰다. 다시 총 여섯 번의 패닝 과정을 거쳐 결합력이 증대된 총 5가지 리피바디 클론들을 확보하였고, Surface plasmon resonance (SPR) 을 통해 해리상수를 측정한 결과 720 nM 수준의 가장 높은 결합력을 가지는 B10 리피바디를 확보하였다 (서열변호 3).
다음으로, 한 번 더 결합력 증대를 위해 B10 리피바디의 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 기반으로 첫 번째 라이브러리와 인접한 모듈 (LRRV4)을 선택하여 상기 선행특허 실시예 2와 동일한 방식으로 오목한 지역의 4개 잔기를 돌연변이 시켰다. 다시 총 여섯 번의 패닝 과정을 거쳐 결합력이 증대된 총 5가지 리피바디 클론들을 확보하였고, Surface plasmon resonance (SPR) 및 등온열량측정법 (ITC) 을 통해 해리상수를 측정한 결과 20 nM 수준의 가장 높은 결합력을 가지는 F10 리피바디를 확보하였다 (서열번호 4) (도 1 내지 2).
각 리피바디의 서열을 정리하면 하기 표 1과 같다.
실시예 5: 선별한 리피바디의 브루톤티로신키나아제의 자가 활성 및 기질 인산화 활성 억제 가능성 분석
선별한 F10 리피바디를 이용하여 정제된 브루톤티로신키나아제의 자가 활성을 억제할 수 있는지를 확인하는 실험을 수행하였다. 키나아제 활성은 ATP의 소모 정도를 이용하여 분석할 수 있다. 96-웰 플레이트의 각 웰에 10 nM 브루톤티로신키나아제와 ATP, 10 nM 브루톤티로신키나아제와 ATP, 그리고 F10 리피바디를 50 nM, 500 nM씩 함께 섞어주었다. 30℃에서 30분 동안 반응 후, ATP 소모를 멈추고 잔량의 ATP를 제거하는 용액을 첨가하여 반응을 중지하였다. 이후 ATP에서 변환된 ADP를 다시 ATP로 변환하는 용액을 첨가한 후, 상온에서 한 시간 동안 반응시켰다. 변환된 ATP를 측정하는 발광 물질을 첨가하여 상온에서 40분간 반응 후, 발광 측정 장치를 통해 발광 정도를 측정하였다. F10 리피바디를 처리한 결과 처리한 리피바디의 농도가 높아질수록 브루톤티로신키나아제의 자가 활성 정도가 점진적으로 감소하는 것을 확인하였다 (도 3).
다음으로, 브루톤티로신키나아제의 기질 인산화 활성을 억제할 수 있는지를 확인하는 실험을 수행하였다. 상기 방법과 동일하나 기질을 추가하여 수행하였다. 그 결과, F10 리피바디를 처리한 군에서 브루톤티로신키나아제의 활성이 저해되어 기질 인산화 활성을 억제하는 것을 확인하였다 (도 4).
실시예 6: 선별한 리피바디의 동물 세포 내 브루톤티로신키나아제와의 결합 여부 확인 및 약물 저항성 돌연변이 브루톤티로신키나아제의 자가 활성 억제 가능성 분석
동물 세포 내에서 SH2 도메인을 포함하는 모든 도메인이 발현된 형태인 브루톤티로신키나아제와의 F10 리피바디의 결합 여부를 확인하는 실험을 수행하였다. 동물 세포 HEK293에 브루톤티로신키나아제를 코딩하는 폴리뉴클레오티드와 리피바디를 코딩하는 재조합 벡터를 지질 주입법 (lipofectamin)을 이용하여 동시 주입을 하였다. 48시간 동안 배양 후, 형질 주입된 세포들을 회수한 후 세포 막 분해 용액을 첨가하여 4℃에서 30분 동안 반응시킨다. 이후 세포 막 지질 및 잔해물 제거를 위해 4℃에서 10분 동안 19000 g 로 원심 분리를 한다. 세포 용해물인 상층액을 분리한 다음, protein A가 결합된 agarose beads와 섞어 주어 beads에 비특이적으로 결합하는 상층액 속 단백질들을 제거하는 과정을 수행하였다. 이후 원심 분리를 통해 beads를 제거하고 상층액을 분리하였다.
상층액과 F10 리피바디 말단에 추가적으로 도입한 myc 폴리펩티드 서열을 인식하는 면역글로불린G를 처리하여 4℃에서 1시간 반응 후, protein A가 결합된 agarose beads를 처리하여 4℃ 에서 1시간 반응시켰다. 이후 희석된 세포 막 분해 용액을 5번 처리하여 세척하였고, 5배 농축된 SDS-PAGE 버퍼를 사용하여 beads, 면역글로불린G, 단백질들을 분리하였다. 10분간 95 에서 끓여준 샘플을 12 % 아크릴아마이드 SDS-PAGE에 주입 후, 단백질의 크기 별로 분리하였고, transfer 과정을 통해 나이트로셀룰로오스 멤브레인에 단백질을 옮겨 단백질이 붙지 않은 나머지 구역을 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)를 처리하여 블로킹 (blocking)과정을 수행하였다. 이후 브루톤티로신키나아제와 F10 리피바디 말단에 추가적으로 삽입한 myc 폴리펩티드를 인식하는 일차 면역글로불린 G, 대조군으로 beta-actin을 인식하는 일차 면역글로불린G를 처리하였다. 4℃에서 16시간 반응 후 TPBS로 3번 세척하였다. 이후 Horseradish peroxidase (HRP)가 결합된 이차 면역글로불린G를 처리하고 상온에서 한 시간 반응 후 TPBS로 3번 세척하였다. 기질을 처리하여 chemiluminescent 신호를 검출하였다.
그 결과, F10 리피바디의 말단에 존재하는 myc 폴리펩티드를 인식하는 면역글로불린G를 처리한 군에서 모든 도메인이 발현된 형태인 브루톤티로신키나아제이 결합되어 함께 검출되었다 (도 5).
약물 저항성 돌연변이 브루톤티로신키나아제에도 F10 리피바디의 효과 여부를 확인하기 위한 방법으로, 동물 세포에 재조합 벡터를 주입 및 세포 용해물인 상층액을 획득하는 과정은 상기 방법과 동일하게 수행하였다. 세포 용해물의 농도를 측정하여 10 g 의 단백질을 SDS-PAGE를 통해 크기 별로 분리하였고, 이후 과정은 상기 방법과 동일하게 수행하였다.
그 결과, 약물 저항성 돌연변이 브루톤티로신키나아제의 자가 활성부위인 티로신223번의 인산화 정도가 줄어드는 것을 확인하였다 (도 6).
실시예 7: 세포 전달 펩티드와 융합된 브루톤티로신키나아제의 SH2 도메인을 표적하는 선별된 리피바디의 특이적인 결합 여부 확인
상기 실시예 4에서 확보한 브루톤티로신키나아제의 SH2 도메인을 표적하는 리피바디가 세포 전달 펩티드와 융합되었을 때 표적 단백질에 결합하는지 확인하는 실험을 수행하였다. 결합 여부는 효소면역측정법 (ELISA)를 이용하여 분석할 수 있다. 브루톤티로신키나아제 SH2 도메인과 해당 키나아제를 96-웰 프레이트에 코팅하여 효소면역측정법을 수행한 결과, 세포 전달 펩티드가 융합된 브루톤티로신키나아제의 SH2 도메인을 표적하는 리피바디 F10은 표적 단백질인 브루톤티로신키나아제의 SH2 도메인과 전체 길이의 브루톤티로신키나아제 모두에 결합하는 것을 확인하였다 (도 7).
실시예 8: 세포 전달 펩티드와 융합된 브루톤티로신키나아제의 SH2 도메인을 표적하는 선별된 리피바디의 세포 성장 억제 효과 확인
브루톤티로신키나아제의 SH2 도메인을 표적하도록 선별한 리피바디가 생물학적인 세포 성장을 억제하는 효과를 지니는지 확인하는 실험을 수행하였다. 브루톤티로신키나아제가 발현되는 버킷 림프종 세포 (Ramos, KCLB number 21596)에 서열번호 6의 아미노산 서열(YGRKKRRQRRR)로 표시되는 세포 전달 펩티드와 브루톤티로신키나아제의 SH2 도메인을 표적하는 상기 리피바디 F10가 융합된 리피바디-복합체(서열번호 5)를 처리 하여 37℃에서 3일의 배양을 하였다. 3일의 배양 후, 세포 성장이 억제되었는지를 확인하기 위하여 CCK-8 분석법을 사용하여 살아 있는 세포의 비율을 분석하였다.
그 결과, 세포 전달 펩티드가 융합된 브루톤티로신키나아제의 SH2 도메인을 표적하는 상기 리피바디 F10이 세포에 전달되었을 때 세포 성장이 저해되는 것을 확인하였다(도 8).
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명에 따른 신규한 폴리펩티드는 브루톤티로신키나아제의 SH2 도메인에 특이적으로 결합하고, 기존의 부작용이 큰 화학 약물을 대체하며 인산화 효소의 이차 돌연변이에 의한 약물 저항성을 최소화 할 수 있을 뿐만 아니라, 본 발명의 폴리펩티드와 세포 전달 펩티드를 융합하여 효과적으로 B 림프구성 세포에 상기 리피바디를 전달할 수 있으므로 브루톤티로신키나아제와 연관된 다양한 질환의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있다.
전자파일 첨부하였음.
Claims (13)
- 서열번호 2 내지 4 중 어느 하나의 아미노산 서열로 표시되고, 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody).
- 제1항의 리피바디를 코딩하는 폴리뉴클레오티드.
- 제2항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제3항의 재조합 벡터가 도입되어 있는 재조합 미생물.
- (i) 제4항의 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및(ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 제1항의 리피바디의 제조방법.
- 브루톤티로신키나아제의 SH2 도메인에 선택적으로 결합하는 리피바디(repebody)와 서열번호 6의 아미노산 서열로 표시되는 세포 전달 펩티드가 융합된 리피바디-복합체(repebody-conjugate).
- 제6항에 있어서, 상기 리피바디-복합체는 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 하는 리피바디-복합체(repebody-conjugate).
- 제6항의 리피바디-복합체를 코딩하는 폴리뉴클레오티드.
- 제8항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제9항의 재조합 벡터가 도입되어 있는 재조합 미생물.
- (i) 제10항의 재조합 미생물을 배양하여 리피바디-복합체를 발현시키는 단계; 및(ii) 상기 발현된 리피바디-복합체를 회수하는 단계를 포함하는, 제6항의 리피바디-복합체의 제조방법.
- 제1항의 리피바디 또는 제6항의 리피바디-복합체를 유효성분으로 함유하는 암 치료용 조성물.
- 제12항에 있어서, 상기 암은 비호지킨 림프종 (non-Hodgkin lymphoma), 호지킨 림프종 (non-Hodgkin lymphoma), 급성 골수성 백혈병 (acute-myeloid leukemia), 급성 림프구성 백혈병 (acute-lymphoid leukemia), 다발성 골수종 (multiple myeloma), 경부암 (head and neck cancer), 폐암, 교모세포종 (glioblastoma), 대장/직장암, 췌장암, 유방암, 난소암, 흑색종 (melanoma), 전립선암, 신장암 및 중피종 (mesothelioma)으로 구성된 군에서 선택되는 것을 특징으로 하는 암 치료용 조성물.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2018-0022052 | 2018-02-23 | ||
| KR1020180022052A KR102056386B1 (ko) | 2018-02-23 | 2018-02-23 | 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019164358A1 true WO2019164358A1 (ko) | 2019-08-29 |
Family
ID=67688261
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2019/002261 Ceased WO2019164358A1 (ko) | 2018-02-23 | 2019-02-25 | 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR102056386B1 (ko) |
| WO (1) | WO2019164358A1 (ko) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102582417B1 (ko) * | 2020-11-06 | 2023-09-26 | 한국과학기술원 | 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017201302A1 (en) * | 2016-05-18 | 2017-11-23 | The University Of Chicago | Btk mutation and ibrutinib resistance |
-
2018
- 2018-02-23 KR KR1020180022052A patent/KR102056386B1/ko not_active Expired - Fee Related
-
2019
- 2019-02-25 WO PCT/KR2019/002261 patent/WO2019164358A1/ko not_active Ceased
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017201302A1 (en) * | 2016-05-18 | 2017-11-23 | The University Of Chicago | Btk mutation and ibrutinib resistance |
Non-Patent Citations (4)
| Title |
|---|
| BORRELLI, ANTONELLA ET AL.: "Cell Penetrating Peptides as Molecular Carriers for Anti-Cancer Agents", MOLECULES, vol. 23, no. 2, 31 January 2018 (2018-01-31), pages 1 - 28, XP055633649 * |
| LEE, S. C . ET AL.: "Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by moduleengineering", PROC. NATL. ACAD. SCI. USA, vol. 109, no. 9, 10 February 2012 (2012-02-10), pages 3299 - 3304, XP055540940 * |
| LI, Q. ET AL.: "Arginine-rich membrane-permeable peptides are seriously toxic", PHARMACOL. RES. PERSPECT., vol. 5, no. 5, October 2017 (2017-10-01), pages 1 - 5, XP055633652 * |
| SINGH, SIMAR PAL ET AL.: "Role of Bruton's tyrosine kinase in B cells and malignancies", MOL. CANCER, vol. 17, no. 57, 19 February 2018 (2018-02-19), pages 1 - 23, XP055633633 * |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20190101720A (ko) | 2019-09-02 |
| KR102056386B1 (ko) | 2019-12-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Bunz et al. | cDNAs encoding the large subunit of human replication factor C. | |
| CN101573376B (zh) | 选择性胰高血糖素样肽-2(glp-2)类似物 | |
| CN100400657C (zh) | 磷酸激酶及其应用 | |
| WO2013169077A1 (ko) | 악액질 예방 또는 치료용 조성물 | |
| WO2012050402A2 (ko) | 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물 | |
| KR20250034352A (ko) | TGF-β 신호전달을 억제할 수 있는 신규한 펩타이드 및 이의 용도 | |
| WO2022098220A1 (ko) | 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도 | |
| KR102056386B1 (ko) | 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| WO2013129852A1 (ko) | 신규한 인터루킨-6에 대한 리피바디 및 그 용도 | |
| WO2016018133A9 (ko) | 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 | |
| WO2019027224A2 (ko) | 결핵균 독소-항독소 체계를 표적으로 하는 펩타이드 및 이의 용도 | |
| WO2024058590A1 (ko) | 신규한 인간 인터류킨-4 수용체 결합 나노바디 및 이의 용도 | |
| CN100467487C (zh) | 具有多种功能的多肽 | |
| WO2021158092A2 (ko) | 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 | |
| WO2015072750A1 (ko) | 항염증 활성을 갖는 펩티드 및 이를 포함하는 조성물 | |
| KR102280725B1 (ko) | 인간 b 세포 림프종-2 단백질에 선택적으로 결합하는 신규한 폴리펩타이드 및 이의 용도 | |
| WO2023014128A1 (ko) | Api5에 특이적으로 결합하는 항체 및 이의 용도 | |
| WO2021040336A1 (ko) | 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| WO2022005117A1 (ko) | 항-SARS-CoV-2 S 단백질 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 SARS-CoV-2 감염증의 예방 또는 치료용 약제학적 조성물 | |
| WO2022260468A1 (ko) | 신규 fgf21 변이체 개발 및 이의 생산기법과 용도 | |
| WO2022010254A1 (ko) | 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 | |
| CN116785402B (zh) | 预防和/或治疗乳腺癌的多肽及其应用 | |
| WO2025105860A1 (ko) | Skp2 단편 및 이의 변이체, 및 이의 용도 | |
| WO2026101331A1 (ko) | 신규의 il10ra 변이 단백질 및 이의 염증성 질환 치료 용도 | |
| Kitani et al. | L-amino acid oxidase, a novel antibacterial protein in the rockfish Sebastes schlegeli |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19756873 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 19756873 Country of ref document: EP Kind code of ref document: A1 |

