WO2019118791A1 - Fcrn antibodies and methods of use thereof - Google Patents

Fcrn antibodies and methods of use thereof Download PDF

Info

Publication number
WO2019118791A1
WO2019118791A1 PCT/US2018/065568 US2018065568W WO2019118791A1 WO 2019118791 A1 WO2019118791 A1 WO 2019118791A1 US 2018065568 W US2018065568 W US 2018065568W WO 2019118791 A1 WO2019118791 A1 WO 2019118791A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
cdr
antibody
heavy chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/065568
Other languages
English (en)
French (fr)
Inventor
Jan HILLSON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Momenta Pharmaceuticals Inc
Original Assignee
Momenta Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/771,147 priority Critical patent/US11773168B2/en
Priority to CN201880089334.7A priority patent/CN111712259A/zh
Priority to AU2018386193A priority patent/AU2018386193B2/en
Priority to SG11202005021PA priority patent/SG11202005021PA/en
Priority to NZ765250A priority patent/NZ765250A/en
Priority to EP18836751.0A priority patent/EP3723802A1/en
Priority to BR112020011310-7A priority patent/BR112020011310A2/pt
Priority to KR1020207019955A priority patent/KR102904658B1/ko
Priority to KR1020257042733A priority patent/KR20260008175A/ko
Application filed by Momenta Pharmaceuticals Inc filed Critical Momenta Pharmaceuticals Inc
Priority to JP2020532551A priority patent/JP7420720B2/ja
Priority to CA3085751A priority patent/CA3085751A1/en
Publication of WO2019118791A1 publication Critical patent/WO2019118791A1/en
Priority to IL275070A priority patent/IL275070A/en
Anticipated expiration legal-status Critical
Priority to US18/452,346 priority patent/US20240158509A1/en
Priority to JP2023177190A priority patent/JP7690538B2/ja
Priority to JP2025089576A priority patent/JP2025143252A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]

Definitions

  • Therapeutic proteins e.g., therapeutic antibodies
  • Numerous autoimmune and alloimmune diseases are mediated by pathogenic antibodies.
  • the present invention features novel antibodies to human neonatal Fc receptor (FcRn). These anti- FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, or to treat immunological diseases (e.g., autoimmune diseases) in a subject.
  • FcRn human neonatal Fc receptor
  • the invention features an isolated antibody that binds to human FcRn.
  • the isolated antibody contains: (1) a light chain variable region that includes a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region that includes a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises a sequence having no more than two amino acid substitutions relative to the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1),the CDR L2 comprises a sequence having no more than one amino acid substitutions relative to the sequence of GDSERPS (SEQ ID NO: 2), the CDR L3 comprises a sequence having no more than one amino acid substitutions relative to the sequence of SSYAGSGIYV (SEQ ID NO:
  • the CDR H1 comprises a sequence having no more than one amino acid substitutions relative to the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: )
  • the CDR H2 comprises a sequence having no more than two amino acid substitutions relative to the sequence of SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGSQTRYADS (SEQ ID NO: ), SIGASGAQTRYADS (SEQ ID NO: 9), or SIGASGGQTRYADS (SEQ ID NO: 10)
  • the CDR H3 comprises a sequence having no more than one amino acid substitutions relative to the sequence of LAIGDSY (SEQ ID NO: 11).
  • the antibody binds human FcRn with a K D of less than 200, 150, 100, 50, or
  • the antibody binds human FcRn with a K D that is less than or equal to that of an antibody having the light chain variable region and heavy chain variable region of N022, N023, N024, N026, or N027, and further having the same Fc region as that of the antibody to which it is being compared.
  • the invention features an isolated antibody containing: ( ) a light chain variable region that includes a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region that includes a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises the sequence of
  • the CDR L2 comprises the sequence of GDX X RPS (SEQ ID NO: 13)
  • the CDR L3 comprises the sequence of X SYX 6 GSGIYV (SEQ ID NO: 14)
  • the CDR H1 comprises the sequence of Z YAMG (SEQ ID NO: 15)
  • the CDR H2 comprises the sequence of SIGZ SGZ QTZ YADS (SEQ ID NO: 16)
  • the CDR H3 comprises the sequence of LAZ Z 6 DSY (SEQ ID NO: 17), wherein X is a polar or hydrophobic amino acid, X is a hydrophobic amino acid, X is a polar amino acid, X is a polar or acidic amino acid, Xs is a polar or hydrophobic amino acid, X 3 is a hydrophobic amino acid, Zi is a polar or acidic amino acid, Z 2 is a polar or hydrophobic amino acid, Z 3 is G, S,
  • Xi is T, A, S, or I.
  • X 2 is L or I.
  • X 3 is S, N, or T.
  • X 4 is Q, E, or N, Xs is C, S, I, or Y.
  • X 3 is A or V, Zi is E, T, D, or N.
  • Z 2 is S or A.
  • Z 4 is K or R.
  • Z 5 is I, L, or FI.
  • the invention features an isolated antibody containing a light chain variable region that includes a CDR L1 having the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), and a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), and a heavy chain variable region that includes a CDR H1 having the sequence of ZiYAMG (SEQ ID NO: 15), a CDR H2 having the sequence of SIGZ 2 SGZ 3 QTRYADS (SEQ ID NO: 18), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1), wherein Zi is T, D, or N, Z 2 is S or A, and Z 3 is G, S or A.
  • a light chain variable region that includes a CDR L1 having the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (S
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of TYAMG (SEQ ID NO: 4), a CDR H2 having the sequence of SIGSSGAQTRYADS (SEQ ID NO: 7), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of DYAMG (SEQ ID NO: 5), a CDR H2 having the sequence of SIGASGSQTRYADS (SEQ ID NO: 8), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of NYAMG (SEQ ID NO: 6), a CDR H2 having the sequence of SIGASGAQTRYADS (SEQ ID NO: 9), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of TYAMG (SEQ ID NO: 4), a CDR H2 having the sequence of SIGASGGQTRYADS (SEQ ID NO: 10), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the isolated antibody contains a CDR L1 having the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of TYAMG (SEQ ID NO: 4), a CDR H2 having the sequence of SIGASGSQTRYADS (SEQ ID NO: 8), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the light chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the heavy chain of the isolated antibody of the invention comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20- 24.
  • the light chain of the isolated antibody of the invention comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19.
  • the isolated antibody of the invention further includes amino acid substitution N297A, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the isolated antibody further includes amino acid substitutions D355E and L357M, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the isolated antibody of the invention further includes any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24 and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 19.
  • the isolated antibody of the invention does not contain a C-terminal lysine at residue 446, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the antibody of any of the above aspects binds human FcRn with a K D that is less than or equal to that of an antibody having the light chain variable region and heavy chain variable region of N022, N023, N024, N026, or N027 and also having the same Fc region as that of the antibody being compared.
  • the KD of the antibody is less than 200, 150, 100,
  • CDRs complementary determining regions
  • FRs framework regions
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the isolated antibody of the invention is a monoclonal antibody. In some embodiments, the isolated antibody is lgG1 . In some embodiments, the isolated antibody includes a l light chain. In some embodiments, the isolated antibody includes a kappa light chain.
  • the isolated antibody of the invention is a humanized or fully human antibody.
  • the isolated antibody binds to human FcRn with a K D of 1-100, 5-150, 5-100, 5-75, 5-50, 10-50, or 10-40 pM.
  • the isolated antibody of the invention binds rodent, e.g., mouse or rat FcRn.
  • the isolated antibody of the invention binds rodent, e.g., mouse or rat, FcRn with a K D of less than 200, 150, 100, 50, or 40 pM.
  • the invention features a nucleic acid molecule encoding any isolated antibody described herein.
  • the invention features a vector containing a nucleic acid molecule encoding any antibody described herein.
  • the invention features a host cell that expresses any isolated antibody described herein.
  • the host cell includes a nucleic acid molecule encoding any isolated antibody described herein or a vector containing a nucleic acid molecule encoding any isolated antibody described herein, wherein the nucleic acid molecule or vector is expressed by the host cell.
  • the host cell is a Chinese hamster ovary (CHO) cell. In some embodiment, the host cell is an Sp2 cell or NS0 cell.
  • the invention features a method of preparing any isolated antibody described herein.
  • the method includes: a) providing a host cell that includes a nucleic acid molecule encoding any isolated antibody described herein or a vector containing a nucleic acid molecule encoding any isolated antibody described herein, and b) expressing the nucleic acid molecule or vector in the host cell under conditions that allow for the formation of the antibody.
  • the method includes the step of recovering the antibody from the host cell, e.g., at a concentration of about 1 -100, 1-50, 1 -25, 2-50, 5-50, or 2-20 mg/ml.
  • the host cell used in the method is a CHO cell.
  • the invention features a pharmaceutical composition including any isolated antibody described herein and one or more pharmaceutically acceptable carriers or excipients.
  • the pharmaceutical composition includes the antibody in a therapeutically effective dose amount.
  • the invention features a method of increasing IgG catabolism in a subject. In another aspect, the invention features a method of reducing autoantibodies in a subject. In yet another aspect, the invention features a method of treating or reducing an immune complex-based activation of an immune response in a subject. The methods include administering to the subject any isolated antibody described herein or a pharmaceutical composition including any isolated antibody described herein.
  • the immune response in the subject is an acute or chronic immune response.
  • the subject has or the acute immune response is activated by a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura ( ⁇ TR), autoimmune haemolytic anaemia (AIHA), immune neutropenia, dilated cardiomyopathy, and serum sickness.
  • a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic
  • the subject has or the chronic immune response is activated by a medical condition selected from the group consisting of chronic inflammatory demyelinating polyneuropathy (CIDP), systemic lupus, a chronic form of a disorder indicated for acute treatment, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, and antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis.
  • CIDP chronic inflammatory demyelinating polyneuropathy
  • ANCA antineutrophil cytoplasmic antibody
  • the subject has or the immune response is activated by an autoimmune disease.
  • the autoimmune disease is selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves' disease, Hashimoto's thyroiditis, hypothyroidism, inflammatory bowel disease,
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence having no more than two amino acid substitutions relative to the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 comprises, consists of, or consists essentially of a sequence having no more than one amino acid substitutions relative to the sequence of GDSERPS (SEQ ID NO: 2), the C
  • SIGASGAQTRYADS (SEQ ID NO: 9), or SIGASGGQTRYADS (SEQ ID NO: 10)
  • the CDR H3 comprises, consists of, or consists essentially of a sequence having no more than one amino acid substitutions relative to the sequence of LAIGDSY (SEQ ID NO: 1 1).
  • the antibody binds human FcRn with a KD of less than or equal to that of antibody N026.
  • the CDR L1 comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1)
  • the CDR L2 comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of the sequence TYAMG (SEQ ID NO: 4)
  • the CDR H2 comprises, consists of, or consists essentially of the sequence SIGSSGAQTRYADS (SEQ ID NO: 7)
  • the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1).
  • the CDR L1 comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1)
  • the CDR L2 comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of the sequence DYAMG (SEQ ID NO: 5)
  • the CDR H2 comprises, consists of, or consists essentially of the sequence SIGASGSQTRYADS (SEQ ID NO: 8)
  • the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1).
  • the CDR L1 comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1)
  • the CDR L2 comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of the sequence NYAMG (SEQ ID NO: 6)
  • the CDR H2 comprises, consists of, or consists essentially of the sequence SIGASGAQTRYADS (SEQ ID NO: 9)
  • the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1).
  • the CDR L1 comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1)
  • the CDR L2 comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of the sequence TYAMG (SEQ ID NO: 4)
  • the CDR H2 comprises, consists of, or consists essentially of the sequence SIGASGGQTRYADS (SEQ ID NO: 10)
  • the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1).
  • the CDR L1 comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1)
  • the CDR L2 comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of the sequence TYAMG (SEQ ID NO: 4)
  • the CDR H2 comprises, consists of, or consists essentially of the sequence SIGASGSQTRYADS (SEQ ID NO: 8)
  • the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1).
  • the subject has a history of having had a previous fetal and neonatal alloimmune and/or autoimmune disorder. For example, in some embodiments the pregnant subject has previously had a pregnancy wherein the fetus or neonate has had a fetal and neonatal alloimmune and/or autoimmune disorder. In some embodiments of all aspects, the subject is at risk of having a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the fetal and neonatal alloimmune and/or autoimmune disorder is selected from the group consisting of fetal and neonatal alloimmune thrombocytopenia, hemolytic disease of the fetus and newborn, alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma, Behcet's disease, neonatal Graves’ disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • the fetal and neonatal autoimmune and/or autoimmune disorder is hemolytic disease of the fetus and newborn. In some embodiments of all aspects, the fetal and neonatal autoimmune and/or autoimmune disorder is fetal and neonatal alloimmune thrombocytopenia. In some embodiments of all aspects, the fetal and neonatal autoimmune and/or autoimmune disorder is congenital heart block.
  • treatment reduces the risk of a miscarriage.
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12), the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13), the CDR L3 comprises, consists of, or consists essentially of a sequence X
  • X2 is a hydrophobic amino acid
  • X3 is a polar amino acid
  • X4 is a polar or acidic amino acid
  • X5 is a polar or hydrophobic amino acid
  • X6 is a hydrophobic amino acid
  • Z1 is a polar or acidic amino acid
  • Z2 is a polar or hydrophobic amino acid
  • Z3 is G, S, or A
  • Z4 is a basic amino acid
  • Z5 is a hydrophobic or basic amino acid
  • Z6 is G, S, D, Q, or H, and wherein the antibody binds human FcRn with a KD of less than 200, 150,
  • the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12), the CDR 12 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13), the CDR L3 comprises, consists of, or consists essentially of a sequence X5SYX6GSGIYV (SEQ ID NO: 14), the CDR H1 comprises, consists of, or consists essentially of a sequence Z1YAMG (SEQ ID NO: 15), the CDR H2 comprises, consists of, or consists essentially of a sequence SIGZ2SGZ3QTZ4YADS (SEQ ID NO: 16), the CDR H3 comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17), wherein X1 is T, A, S, or I; X2 is L or l; X
  • the CDR L1 comprises, consists of, or consists essentially of a sequence having no more than two amino acid substitutions relative to the sequence of
  • the CDR L2 comprises, consists of, or consists essentially of a sequence having no more than one amino acid substitutions relative to the sequence of GDSERPS (SEQ ID NO: 2)
  • the CDR L3 comprises, consists of, or consists essentially of a sequence having no more than one amino acid substitutions relative to the sequence of SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 comprises, consists of, or consists essentially of a sequence having no more than one amino acid substitutions relative to the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: 6)
  • the CDR H2 comprises, consists of, or consists essentially of a sequence having no more than two amino acid substitutions relative to the sequence of SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGSQTRYADS (SEQ ID NO: 8), SIGASGAQTRYADS (SEQ ID NO:
  • the subject has a history of having had a previous fetal and neonatal alloimmune and/or autoimmune disorder.
  • the pregnant subject has had a previous pregnancy wherein the fetus or neonate had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the subject is at risk of having a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the fetal and neonatal alloimmune and/or autoimmune disorder is selected from the group consisting of fetal and neonatal alloimmune thrombocytopenia, hemolytic disease of the fetus and newborn, alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma, Behcet's disease, neonatal Graves’ disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • the fetal and neonatal autoimmune and/or autoimmune disorder is hemolytic disease of the fetus and newborn. In some embodiments of all aspects, the fetal and neonatal autoimmune and/or autoimmune disorder is fetal and neonatal alloimmune thrombocytopenia. In some embodiments of all aspects, the fetal and neonatal autoimmune and/or autoimmune disorder is congenital heart block. In some embodiments of all aspects, treatment reduces the risk of a miscarriage.
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 having the sequence
  • TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 having the sequence GDSERPS (SEQ ID NO: 2), and a CDR L3 having the sequence SSYAGSGIYV (SEQ ID NO: 3), and a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR H1 comprises, consists of, or consists essentially of a sequence Z1YAMG (SEQ ID NO: 15), the CDR H2 comprises, consists of, or consists essentially of a sequence SIGZ2SGZ3QTRYADS (SEQ ID NO: 18), and the CDR H3 comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1), and wherein Z1 is T, D, or N; Z2 is S or A; and Z3 is G, S or A.
  • the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • S (SEQ ID NO: 19); and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • S (SEQ ID NO: 19); and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMGWVRQAPGKGLEWVSSIGASGSQTRYADSVKGRFTI
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • S (SEQ ID NO: 19); and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • S (SEQ ID NO: 19); and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • S (SEQ ID NO: 19); and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain comprises, consists of, or consists essentially of a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20-24.
  • the light chain comprises, consists of, or consists essentially of a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19.
  • the antibody further comprises, consists of, or consists essentially of amino acid substitution N297A, relative to the sequence of any one of SEQ ID NOs: 20-24. In some embodiments of all aspects, the antibody further comprises, consists of, or consists essentially of amino acid substitutions D355E and L357M, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the antibody further comprises, consists of, or consists essentially of any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24 and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 19.
  • the antibody does not contain a C-terminal lysine at residue 446, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the heavy chain comprises, consists of, or consists essentially of the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKGLEWVSSIGSSGAQTRYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the heavy chain comprises, consists of, or consists essentially of the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMGWVRQAPGKGLEWVSSIGASGSQTRYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the heavy chain comprises, consists of, or consists essentially of the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMGWVRQAPGKGLEWVSSIGASGAQTRYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the invention features a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKSGN TASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP GAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
  • the heavy chain comprises, consists of, or consists essentially of the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKGLEWVSSIGASGSQTRYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
  • the invention features a method of treating fetal anemia associated with hemolytic disease of the fetus and newborn, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: (1) a light chain comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence
  • the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence X5SYX6GSGIYV (SEQ ID NO: 14); the CDR H1 comprises, consists of, or consists essentially of a sequence Z1 YAMG (SEQ ID NO: 15); the CDR H2 comprises, consists of, or consists essentially of a sequence SIGZ2SGZ3QTZ4YADS (SEQ ID NO: 16); the CDR H3 comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17); wherein X1 is T, A, S, or I; X2 is L or I; X3 is S, N, or T; X4 is Q, E, or N; X5 is C, SEQ ID NO: 17); wherein X1 is T, A, S, or
  • the invention features a method of treating fetal anemia associated with hemolytic disease of the fetus and newborn, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of treating fetal anemia associated with hemolytic disease of the fetus and newborn, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the method treats the pregnant subject, a fetus of the pregnant subject, and/or a combination thereof.
  • the invention features a method of treating an autoimmune disorder, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence X5SYX6GSGIYV (SEQ ID NO:
  • the CDR H3 comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17); wherein X1 is T, A, S, or I;
  • the invention features a method of treating an autoimmune disorder, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of treating an autoimmune disorder, comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the autoimmune disorder is selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue- dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating
  • polyneuropathy Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves’ disease, Hashimoto's thyroiditis, hypothyroidism, inflammatory bowel disease, autoimmune lymphoproliferative syndrome, idiopathic pulmonary fibrosis, IgA nephropathy, insulin dependent diabetes, juvenile arthritis, lichen planus, lupus, Meniere's Disease, mixed connective tissue disease, multiple sclerosis, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis, primary agammaglobulinemia, primary biliary cir
  • the treatment reduces the risk of miscarriage/loss of fetus.
  • the invention features a method of reducing the risk of or reducing the risk of developing an autoimmune or alloimmune disorder, comprising, consisting of, or consisting essentially of administering an FcRn antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of: (1)
  • X1 is T, A, S, or I
  • X2 is L or I
  • X3 is S, N, or T
  • X4 is Q, E, or N
  • X5 is C, S, I, or Y
  • X6 is A or V
  • Z1 is E, T, D, or N
  • Z2 is S or A
  • Z3 is G, S, or A
  • Z4 is K or R
  • Z5 is I, L, or H
  • Z6 is G, S, D, Q, or H.
  • the invention features a method of reducing the risk of or reducing the risk of developing an autoimmune or alloimmune disorder, comprising, consisting of, or consisting essentially of administering an FcRn antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of reducing the risk of or reducing the risk of developing an autoimmune or alloimmune disorder, comprising, consisting of, or consisting essentially of administering an FcRn antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the autoimmune disorder is selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue- dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating
  • polyneuropathy Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves’ disease, Hashimoto's thyroiditis, hypothyroidism, inflammatory bowel disease, autoimmune lymphoproliferative syndrome, idiopathic pulmonary fibrosis, IgA nephropathy, insulin dependent diabetes, juvenile arthritis, lichen planus, lupus, Meniere's Disease, mixed connective tissue disease, multiple sclerosis, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis, primary agammaglobulinemia, primary biliary cir
  • the treatment reduces the risk of miscarriage/loss of fetus.
  • the invention features a method of increasing antibody catabolism in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the administered antibody comprises, consists of, or consists essentially of: : (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence X5SYX6GS
  • the invention features a method of increasing antibody catabolism in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the administered antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of increasing antibody catabolism in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the administered antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • increasing antibody catabolism comprises increasing pathogenic antibody catabolism.
  • the pathogenic antibody is pathogenic to the mother, the fetus, or both the mother and the fetus.
  • the pathogenic antibody is an IgG antibody.
  • the antibody causes a fetal and neonatal alloimmune and/or autoimmune disorder in a fetus in the pregnant subject.
  • the fetal and neonatal alloimmune and/or autoimmune disorder is selected from the group consisting of fetal and neonatal alloimmune thrombocytopenia hemolytic disease of the fetus and newborn, alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma, Behcet's disease, neonatal Graves’ disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • the invention features a method of reducing autoantibodies in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: : (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence
  • the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence X5SYX6GSGIYV (SEQ ID NO: 14); the CDR H1 comprises, consists of, or consists essentially of a sequence Z1 YAMG (SEQ ID NO: 15); the CDR H2 comprises, consists of, or consists essentially of a sequence SIGZ2SGZ3QTZ4YADS (SEQ ID NO: 16); the CDR H3 comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17), wherein X1 is T, A, S, or I;
  • the invention features a method of reducing autoantibodies in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of reducing autoantibodies in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO:
  • the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of reducing an immune complex-based activation of an immune response in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: : (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence
  • the invention features a method of reducing an immune complex-based activation of an immune response in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of reducing an immune complex-based activation of an immune response in a subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the immune response is an acute or chronic immune response in the subject.
  • the acute immune response is activated by a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex- mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura, autoimmune haemolytic anaemia, immune neutropenia, dilated cardiomyopathy, and serum sickness.
  • the acute immune response is activated by a medical condition in the pregnant subject.
  • the acute immune response is activated in the fetus or neonate by a medical condition in the pregnant subject. In some embodiments of all aspects, the acute immune response is activated by a medical condition in the pregnant subject. In some embodiments of all aspects, the acute immune response is activated in the fetus or neonate by a medical condition in the pregnant subject. In some embodiments of all aspects, the acute immune response is activated by idiopathic thrombocytopenia purpura. In some embodiments of all aspects, the acute immune response is activated by pemphigus vulgaris. In some embodiments of all aspects, the acute immune response is activated by catastrophic anti-phospholipid antibody syndrome.
  • the acute immune response is activated by neuromyelitis optica. In some embodiments of all aspects, the acute immune response is activated by antibody-mediated rejection. In some embodiments of all aspects, the acute immune response is activated by myasthenia gravis.
  • Also described herein is a method of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising, consisting of, or consisting essentially of administering M281 (e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose) to a pregnant subject and ceasing administration if the subject exhibits hypoalbuminemia (e.g., a serum albumin level below 30 g/l, 25 g/l, 20 g/l).
  • M281 e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose
  • hypoalbuminemia e.g., a serum albumin level below 30 g/l, 25 g/l, 20 g/l.
  • Also described is method comprising, consisting of, or consisting essentially of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising administering M281 to a pregnant subject (e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose) and administering albumin if the subject exhibits hypoalbuminemia (e.g., a serum albumin level below 30 g/l, 25 g/l, 20 g/l).
  • hypoalbuminemia e.g., a serum albumin level below 30 g/l, 25 g/l, 20 g/l.
  • Also described is method comprising, consisting of, or consisting essentially of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising administering M281 to a pregnant subject (e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose) and administering a hyperosmolar solution (e.g., mannitol or other solution known in the art) if the subject exhibits hypoalbuminemia (e.g., a serum albumin level below 30 g/l, 25 g/l, 20 g/l).
  • a hyperosmolar solution e.g., mannitol or other solution known in the art
  • Also described is a method comprising, consisting of, or consisting essentially of treating a fetal and neonatal alloimmune and/or autoimmune disorder comprising administering M281 (e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose) to a pregnant subject and testing the serum albumin level of the subject at least once prior to or subsequent to administration of M281.
  • administering M281 e.g., at a dose of 15 mg/kg or 30 mg/kg, e.g., a weekly dose
  • administration of M281 can be continued or not.
  • the chronic immune response is activated by a medical condition selected from the group consisting of chronic inflammatory demyelinating polyneuropathy (CIDP), systemic lupus, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, and antineutrophil cytoplasmic antibody-associated vasculitis.
  • CIDP chronic inflammatory demyelinating polyneuropathy
  • the chronic immune response is activated by chronic inflammatory demyelinating polyneuropathy.
  • the subject has an autoimmune disease. In some embodiments of all aspects, the subject has an autoimmune disease.
  • the autoimmune disease is selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, warm autoimmune hemolytic anemia, anti-factor antibodies, heparin induced thrombocytopenia (, sensitized transplant, autoimmune hepatitis, hepatitis, Behcets disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves' disease, Hashimoto's thyroiditis
  • the autoimmune disease is warm autoimmune hemolytic anemia. In some embodiments of all aspects, the autoimmune disease is anti factor antibodies. In some embodiments of all aspects, the autoimmune disease heparin induced thrombocytopenia. In some embodiments of all aspects, the autoimmune disease is sensitized transplant.
  • the invention features a method of decreasing antibody transport across the placenta of a pregnant subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: : (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists essentially of a sequence X5S
  • the CDR H2 comprises, consists of, or consists essentially of a sequence SIGZ2SGZ3QTZ4YADS (SEQ ID NO: 16);
  • the CDR H3 comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17); wherein X1 is T, A, S, or l; X2 is L or I; X3 is S, N, or T; X4 is Q, E, or N; X5 is C, S, I, or Y; X6 is A or V; Z1 is E, T, D, or N; Z2 is S or A; Z3 is G, S, or A; Z4 is K or R; Z5 is I, L, or H; and Z6 is G, S, D, Q, or H.
  • the invention features a method of decreasing antibody transport across the placenta of a pregnant subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of decreasing antibody transport across the placenta of a pregnant subject, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of treating an anti body- mediated enhancement of viral disease in a fetus or a neonate, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: : (1) a light chain variable region comprising, consisting of, or consisting essentially of a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising, consisting of, or consisting essentially of a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12); the CDR L2 comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13); the CDR L3 comprises, consists of, or consists of, or
  • the invention features a method of treating an anti body- mediated enhancement of viral disease in a fetus or a neonate, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the invention features a method of treating an anti body- mediated enhancement of viral disease in a fetus or a neonate, the method comprising, consisting of, or consisting essentially of administering an antibody to a pregnant subject, wherein the antibody comprises, consists of, or consists essentially of: a light chain and a heavy chain, wherein the light chain comprises, consists of, or consists essentially of the sequence of SEQ ID NO: 19; and the heavy chain comprises, consists of, or consists essentially of the sequence selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24.
  • the viral disease is caused by a virus selected from the group consisting of an alpha virus infection, flavivirus infection, Zika virus infection, Chikungunya virus infection, Ross River virus infection, severe acute respiratory syndrome coronavirus infection, Middle East respiratory syndrome, avian influenza infection, influenza virus infection, human respiratory syncytial virus infection, Ebola virus infection, yellow fever virus infection, dengue virus infection, human immunodeficiency virus infection, respiratory syncytial virus infection, Hantavirus infection, Getah virus infection, Sindbis virus infection, Bunyamwera virus infection, West Nile virus infection, Japanese encephalitis virus B infection, rabbitpox virus infection, lactate dehydrogenase elevating virus infection, reovirus infection, rabies virus infection, foot-and-mouth disease virus infection, porcine reproductive and respiratory syndrome virus infection, simian hemorrhagic fever virus infection, equine infectious anemia virus infection, caprine arthritis virus infection, African swine fever virus infection, lenti
  • a virus selected from
  • the pregnant subject has or is at risk of having a medical condition that activates an immune response in the pregnant subject.
  • the medical condition is pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura, autoimmune haemolytic anaemia, immune neutropenia, dialated
  • cardiomyopathy serum sickness, chronic inflammatory demyelinating polyneuropathy, systemic lupus, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, antineutrophil cytoplasmic antibody (ANCA)- associated vasculitis, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia,
  • the pregnant subject has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the pregnant subject has had a previous pregnancy, wherein the fetus or neonate had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • an antibody associated with an immune disease is detected in a biological sample obtained from the pregnant subject.
  • the biological sample is a blood or urine sample.
  • the biological sample is a blood sample.
  • the administered antibody is a monoclonal antibody. In some embodiments of all aspects, the administered antibody is lgG1. In some embodiments of all aspects, the administered antibody comprises, consists of, or consists essentially of a l light chain.
  • the invention features a method for treating or reducing the risk of developing a fetal and neonatal alloimmune and/or autoimmune disorder, the method including: administering to a pregnant woman a composition comprising an antibody comprising a light chain having the amino acid sequence of SEQ ID NO:19 and a heavy chain having the amino acid sequence of SEQ ID NO:24 (M281), wherein the administration of M281 ceases after week 34 gestational age.
  • the invention features a method for treating or reducing the risk of developing a fetal and neonatal alloimmune and/or autoimmune disorder comprising administering to a pregnant woman a composition comprising an antibody comprising a light chain having the amino acid sequence of SEQ ID NO:19 and a heavy chain having the amino acid sequence of SEQ ID NO:24 (M281), wherein the administration of M281 ceases at least one week prior to birth.
  • the method includes: administering IVIG to the pregnant women after cessation of administration of M281 and prior to birth (e.g., 40 - 100 hrs or 1 - 15 days prior to birth);administration of M281 ceases after gestational week 35; administration of M281 ceases prior to gestational week 36, 37 or 38; the IVIG is administered at 200 mg/kg - 1000 mg/kg based on the weight of the pregnant women; M281 is administered at 30 mg/kg based on the weight of the pregnant women; M281 is administered at 15 mg/kg based on the weight of the pregnant women; the dose is dose per administration and is based on the weight of the pregnant women at first dosing and is not adjusted upward based on weight gain by the pregnant women; the dose is dose per administration and is based on the weight of the pregnant women at first dosing and is adjusted upward based on weight gain by the pregnant woman; the composition is administered at least every other week; the composition is administered every other week; the composition is administered at least every week; the composition is administered at least every
  • the pregnant women has an obstetrical history of severe fetal anemia or stillbirth at ⁇ 24 weeks gestation and elevated anti-D or anti-Kell IgG alloantibody titers and is pregnant with an antigen-positive fetus; the first dosing is weeks 12 to 16 of pregnancy; the first dosing is during week 14 of pregnancy; and administration is begun during the first trimester of pregnancy.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit FcRn antigen-binding activity.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab’, F(ab’)2, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, and multispecific antibodies.
  • the term“isolated antibody” refers to an antibody which has been separated and/or recovered from a component of its manufacturing host cell environment. Contaminant components of its manufacturing host cell environment are materials which would interfere with research, diagnostic, or therapeutic uses of the antibody. Contaminant components may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • an antibody is purified (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N- terminal or internal amino acid sequence by use of, for example, a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using, for example, Coomassie blue or silver stain.
  • An isolated antibody includes the antibody in situ within recombinant cells. Ordinarily, however, an isolated antibody will be prepared by at least one purification step.
  • a pharmaceutical preparation of an isolated antibody typically has less than 250 ppm (e.g., less than 200ppm, 150ppm. 100 ppm) of host cell proteins (HOP) as determined by an ELISA based HOP assay performed as recommended by an FDA“Guidance for Industry” document.
  • HOP host cell proteins
  • the term“monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., individual antibodies in the population have the same primary sequence except for possible naturally occurring mutations that may be present in minor amounts.
  • Monoclonal antibodies are highly specific and directed against a single antigenic site (i.e., an epitope on human FcRn). In contrast to polyclonal antibody preparations which typically include different antibodies directed against different epitopes, each monoclonal antibody is directed against a single epitope on the antigen.
  • the modifier“monoclonal” indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the terms“variable region” and“variable domain” refer to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1 , CDR L2, CDR L3, CDR H1 , CDR H2, and CDR H3) and framework regions (FRs).
  • CDRs complementary determining regions
  • FRs framework regions
  • amino acid positions assigned to CDRs and FRs are defined according to Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a CDR (defined further herein) or FR (defined further herein) of the variable region.
  • a heavy chain variable region may include a single inserted residue (i.e., residue 52a according to Kabat) after residue 52 of CDR H2 and inserted residues (i.e., residues 82a, 82b, 82c, etc. according to Kabat) after residue 82 of heavy chain FR.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a“standard” Kabat numbered sequence.
  • the terms“complementary determining regions” and“CDRs” refer to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • a CDR is also known as a hypervariable region.
  • the light chain and heavy chain variable regions each has three CDRs.
  • the light chain variable region contains CDR L1 , CDR L2, and CDR L3.
  • the heavy chain variable region contains CDR H1 , CDR H2, and CDR H3.
  • Each CDR may include amino acid residues from a complementarity determining region as defined by Kabat (i.e.
  • FcRn refers a neonatal Fc receptor that binds to the Fc region of an IgG antibody, e.g., an lgG1 antibody.
  • An exemplary FcRn is human FcRn having UniProt ID No. P55899.
  • Human FcRn is believed to be responsible for maintaining the half-life of IgG by binding and trafficking constitutively internalized IgG back to the cell surface for the recycling of IgG.
  • binding affinity refers to the strength of the binding interaction between two molecules.
  • binding affinity refers to the strength of the sum total of non- covalent interactions between a single binding site of a molecule and its binding partner, such as an isolated antibody and its target (e.g., an isolated anti-FcRn antibody of the invention and a human FcRn).
  • binding affinity refers to intrinsic binding affinity, which reflects a 1 :1 interaction between members of a binding pair.
  • the binding affinity between two molecules is commonly described by the dissociation constant (K D ) or the affinity constant (K A ). Two molecules that have low binding affinity for each other generally bind slowly, tend to dissociate easily, and exhibit a large K D .
  • K D Two molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small K D .
  • One method for determining the K D of an antibody to human FcRn is described in Example 2 (“the SPR method”). Using this method the K D of N022, N023, N024, N026, and N027 was 31 , 31 .4, 35.5, 36.5, and 19.3 pM, respectively.
  • the term“inhibit IgG binding to FcRn” refers to the ability of an anti-FcRn antibody of the invention to block or inhibit the binding of IgG (e.g., lgG1 ) to human FcRn.
  • an anti-FcRn antibody of the invention binds FcRn, for example, at the site on human FcRn to which IgG binds.
  • the anti-FcRn antibody of the invention is able to inhibit the binding of IgG (e.g., a subject’s autoantibodies) to FcRn.
  • the molecule e.g., an anti-FcRn antibody of the invention substantially or completely inhibits binding to IgG.
  • the binding of IgG is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • the term“inhibit pathogenic antibody binding to FcRn” refers to the ability of an anti- FcRn antibody to block or inhibit the binding of a pathogenic antibody (e.g., pathogenic IgG antibody) to human FcRn.
  • a pathogenic antibody e.g., pathogenic IgG antibody
  • an anti-FcRn antibody binds FcRn, for example, at the site on human FcRn to which the pathogenic antibody binds.
  • the anti-FcRn antibody is able to inhibit the binding of pathogenic antibodies (e.g., pathogenic IgG antibodies) to FcRn.
  • the molecule e.g., an anti-FcRn antibody
  • the binding of pathogenic antibodies to FcRn is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • hydrophobic amino acid refers to an amino acid having relatively low- water solubility. Hydrophobic amino acids include, but are not limited to, leucine, isoleucine, alanine, phenylalanine, valine, and proline. Particularly preferred hydrophobic amino acids in the present invention are alanine, leucine, isoleucine, and valine.
  • polar amino acid refers to an amino acid having a chemical polarity in its side chain induced by atoms with different electronegativity. The polarity of a polar amino acid is dependent on the electronegativity between atoms in the side chain of the amino acid and the asymmetry of the structure of the side chain.
  • Polar amino acids include, but are not limited to, serine, threonine, cysteine, methionine, tyrosine, tryptophan, asparagine, and glutamine.
  • Particularly preferred polar amino acids in the present invention are serine, threonine, asparagine, glutamine, cysteine, and tyrosine.
  • acidic amino acid refers to an amino acid whose side chain contains a carboxylic acid group having a pKa between 3.5 and 4.5.
  • acidic amino acids are aspartic acid and glutamic acid.
  • basic amino acid refers to an amino acid whose side chain contains an amino group having a pKa between 9.5 and 13.
  • basic amino acids are histidine, lysine, and arginine.
  • percent (%) identity refers to the percentage of amino acid (or nucleic acid) residues of a candidate sequence, e.g., an anti-FcRn antibody of the invention, that are identical to the amino acid (or nucleic acid) residues of a reference sequence, e.g., a wild-type anti-FcRn antibody, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity (i.e., gaps can be introduced in one or both of the candidate and reference sequences for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). Alignment for purposes of determining percent identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software.
  • the percent amino acid (or nucleic acid) sequence identity of a given candidate sequence to, with, or against a given reference sequence is calculated as follows:
  • A is the number of amino acid (or nucleic acid) residues scored as identical in the alignment of the candidate sequence and the reference sequence
  • B is the total number of amino acid (or nucleic acid) residues in the reference sequence.
  • the percent amino acid (or nucleic acid) sequence identity of the candidate sequence to the reference sequence would not equal to the percent amino acid (or nucleic acid) sequence identity of the reference sequence to the candidate sequence.
  • a reference sequence aligned for comparison with a candidate sequence may show that the candidate sequence exhibits from 50% to 100% identity across the full length of the candidate sequence or a selected portion of contiguous amino acid (or nucleic acid) residues of the candidate sequence.
  • the length of the candidate sequence aligned for comparison purpose is at least 30%, e.g., at least 40%, e.g., at least 50%, 60%, 70%, 80%, 90%, or 100% of the length of the reference sequence.
  • a substitution, deletion, or insertion may comprise a certain number of amino acids, (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, or more).
  • a substitution, deletion, or insertion of no more than n amino acids this is meant that the substitution, deletion, or insertion comprises, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, ... or n amino acids.
  • the number or substitutions, deletions, or insertions can comprise a percent of the total sequence (e.g., 1 %, 5%, 10%, 15%, 20%, or more) where the number of substitutions, deletions, or insertions alters 5%, 10%, 15%, 20% or more, of the amino acids in the total sequence.
  • the term“fetal and neonatal alloimmune and/or autoimmune disorder” refers to an immune disorder in a fetus and/or neonate that is caused by the transplacental transfer of maternal antibodies (e.g., pathogenic maternal antibodies) directed against fetal and/or neonate antigens.
  • antibodies e.g., pathogenic antibodies
  • antigens in the fetus e.g., antigens the fetus inherited from the fetus’ father.
  • antigens in the fetus e.g., antigens the fetus inherited from the fetus’ father.
  • fetal and neonatal alloimmune and/or autoimmune disorders are provided herein.
  • pathogenic antibody refers to an antibody that causes one or more immune diseases or disorders in a subject (e.g., a pregnant subject), a fetus in a pregnant subject, and/or a neonate.
  • pathogenic antibodies are autoantibodies produced in a subject (e.g., a pregnant subject) against one or more of the subject’s own proteins, thus causing autoimmune diseases or disorders in the subject.
  • pathogenic antibodies in a pregnant subject may transfer through the placenta to the fetus and react against antigens from the fetus (e.g., antigens that the fetus inherited from the fetus’ father), thus causing, e.g., fetal and neonatal alloimmune and/or autoimmune disorders.
  • antigens from the fetus e.g., antigens that the fetus inherited from the fetus’ father
  • an antibody may bind to a viral surface protein and the antibody/virus complex may bind to an FcRn receptor on a cell surface through interaction between the antibody and the receptor. Subsequently, the antibody/virus complex may be internalized into the cell.
  • the term“host cell” refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express proteins from their corresponding nucleic acids.
  • the nucleic acids are typically included in nucleic acid vectors that can be introduced into the host cell by conventional techniques known in the art (e.g., transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, etc.).
  • a host cell may be a prokaryotic cell, e.g., a bacterial cell, or a eukaryotic cell, e.g., a mammalian cell (e.g., a CFIO cell).
  • a host cell is used to express one or more polypeptides encoding anti-FcRn antibodies of the invention.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid molecule to which it has been linked.
  • a“plasmid” refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • a phage vector refers to a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as“recombinant expression vectors” (or simply,“recombinant vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • the term“subject” refers to a mammal, e.g., preferably a human. Mammals include, but are not limited to, humans and domestic and farm animals, such as monkeys (e.g., a cynomolgus monkey), mice, dogs, cats, horses, and cows, etc.
  • the term“gestational age” describes how far along the pregnancy is. The gestational age can be described in terms of weeks. Methods of determining gestational age are known in the art (e.q.. Committee on Obstetric Practice American Institute of Ultrasound in Medicine Society for Maternal-Fetal Medicine. Committee Opinion. Number 700. May 2017: which is incorporated herein in its entirety). In some instances, the gestational age can be determined by ultrasound, weeks since first day of last menstrual period (LMP), or combinations thereof.
  • LMP menstrual period
  • the term“pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that contains an active ingredient as well as one or more excipients and diluents to enable the active ingredient suitable for the method of administration.
  • the pharmaceutical composition of the present invention includes pharmaceutically acceptable components that are compatible with the anti-FcRn antibody.
  • the pharmaceutical composition may be in aqueous form for intravenous or subcutaneous administration or in tablet or capsule form for oral administration.
  • the term“pharmaceutically acceptable carrier” refers to an excipient or diluent in a pharmaceutical composition.
  • the pharmaceutically acceptable carrier must be compatible with the other ingredients of the formulation and not deleterious to the recipient.
  • pharmaceutically acceptable carrier must provide adequate pharmaceutical stability to the Fc construct.
  • the nature of the carrier differs with the mode of administration. For example, for intravenous administration, an aqueous solution carrier is generally used; for oral administration, a solid carrier is preferred.
  • the term“therapeutically effective amount” refers to an amount, e.g., pharmaceutical dose, effective in inducing a desired biological effect in a subject or patient or in treating a patient having a condition or disorder described herein. It is also to be understood herein that a“therapeutically effective amount” may be interpreted as an amount giving a desired therapeutic effect, either taken in one dose or in any dosage or route, taken alone or in combination with other therapeutic agents.
  • the term“no more than” refers to an amount that is less than equal to. This may be an amount in integers. For example, no more than two substitutions can refer to 0, 1 , or 2 substitutions.
  • treatment refers to reducing, decreasing, decreasing the risk of, or decreasing the side effects of a particular disease or condition. Reducing, decreasing, decreasing the risk of, or decreasing the side effects of are relative to a subject who did not receive treatment, e,g, a control, a baseline, or a known control level or measurement.
  • FIG. 1 includes two graphs and a table that show IgG competitive binding of antibodies N022-N024, N026, and N027 to human or cynomolgus monkey FcRn at pH 6.0.
  • FIG. 2 includes graphs that show the effects of antibodies N023, N024, N026, and N027 on IgG catabolism in mice.
  • FIG. 3 includes graphs that show the dose-dependent effects of antibody N027 on IgG levels and target occupancy in mice.
  • FIGS. 4A-4C includes graphs that show the selective induction of IgG catabolism and target occupancy in cynomolgus monkeys following administration of different doses of antibody N027.
  • FIG. 5 includes a graph that shows the biodistribution of N027 in mice.
  • FIG. 6 includes an experimental timeline and a graph that shows the efficacy of N027 in a mouse collagen antibody-induced arthritis model.
  • FIG. 7 includes an experimental timeline and two graphs that show the efficacy of N027 in a mouse chronic idiopathic thrombocytopenia purpura (ITP) model.
  • ITP chronic idiopathic thrombocytopenia purpura
  • FIGS. 8A-8C show graphs that show the dose-dependent FcRn occupancy achieved with N027 in aortic endothelial cells, venous endothelial cells, and placental trophoblast, respectively.
  • FIGS. 9A-9C show graphs that show 100% FcRn occupancy by N027 results in increased intracellular IgG accumulation in aortic endothelial cells, venous endothelial cells, and placental trophoblast, respectively.
  • FIG. 10 shows a graph that shows the amount of time it takes to achieve 100% FcRn occupancy by
  • FIGS. 11A and 11 B show graphs that show N027 treatment does not alter FcRn turnover rates in human endothelial and villous trophoblast cells, respectively.
  • FIGS. 12A and 12B show images of FcRn localized in endosomes in human endothelial and villous trophoblast cells.
  • FIGS. 13A and 13B show graphs that show the effect of N027 treatment on dynamics of IgG trafficking in human endothelial cells and human placental trophoblasts, respectively.
  • FIGS. 13C and 13D show images that show N027 increases intracellular IgG and co-localization of IgG with lysosomes (lysosomal markers: Lamp-1 and Dextran).
  • SD standard deviation
  • FIG. 15 is a graph that shows transplacental transfer of N027 over four hours of perfusion.
  • FIG. 16 is a graph showing maternal IgG concentrations after treatment with N027 during gestation.
  • FIG. 17 is a graph showing fetal IgG levels after treatment of mothers with N027 during gestation.
  • FIG. 18 is a graph showing mean (SD) FcRn receptor occupancy in circulating monocytes following single doses of 0.3, 3, 10, 30 and 60 mg/kg of N027.
  • FIG. 19 is a graph showing mean (SD) serum IgG levels Following Single Doses of 0.3, 3, 10, 30 and 60 mg/kg N027.
  • FIGS. 20A and 20B are graphs showing mean (SD) FcRn receptor occupancy in monocytes in the 30 and 15 mg/kg MAD cohorts by number of doses given.
  • FIGS. 21 A and 21 B are graphs showing mean (SD) serum IgG in the 30 and 15 mg/kg MAD cohorts by number of doses given.
  • FIG. 25 is a graph showing placental transfer of Humira® in the presence of varying concentrations of N027.
  • FIG. 27 is a graph showing placental transfer of Humira® in the presence of IVIg.
  • FIG. 29 is a graph showing placental transfer of Humira® in the presence of IVIg + N027.
  • FIG. 30 is a graph showing impact on serum albumin in subjects treated with 3 doses of N027 at 15 mg/kg or 30 mg/kg.
  • FIG. 31 is a graph showing impact on serum albumin in cynomolgus monkeys treated with N027 in a 26 week repeat dose toxicity study.
  • FIG. 32 is a table showing impact on serum albumin in pregnant cynomolgus monkeys treated with N027 during gestation in the EFD and ePPND phases.
  • the present invention features isolated antibodies that bind to human neonatal Fc receptor (FcRn) with high affinity.
  • the present invention features anti-FcRn antibodies, methods and compositions for preparing anti-FcRn antibodies, and methods for blocking FcRn activity, reducing immune complex-based activation of an immune response, and treating immunological diseases.
  • the present disclosure features anti-FcRn antibodies, methods and compositions for preparing anti-FcRn antibodies, and methods for blocking FcRn activity, reducing immune complex-based activation of an immune response, and treating immunological diseases.
  • anti-FcRn antibodies can be used to decrease pathogenic antibody transport across the placenta of a pregnant subject, to increase pathogenic antibody catabolism in a pregnant subject, and to treat an antibody-mediated enhancement of viral disease in a fetus or a neonate.
  • the invention features isolated antibodies that bind to the human FcRn with high affinity.
  • An anti-FcRn antibody of the invention refers to an antibody that can bind to human FcRn and inhibit IgG (e.g., IgG autoantibodies) binding to FcRn.
  • the antibody is a monoclonal antibody. In other embodiments, the antibody is a polyclonal antibody.
  • the antibody is selected from the group consisting of a chimeric antibody, an affinity matured antibody, a humanized antibody, and a human antibody in certain embodiments, the antibody is an antibody fragment, e.g., a Fab, Fab', Fab‘-SH, F(ab’) 2 , or scFv.
  • the antibody is a chimeric antibody.
  • an antibody contains antigen binding sequences from a non-human donor grafted to a heterologous non-human, human, or humanized sequence (e.g., framework and/or constant domain sequences).
  • the non human donor is a mouse.
  • an antigen binding sequence is synthetic, e.g., obtained by mutagenesis (e.g., phage display screening, etc.).
  • a chimeric antibody has non human (e.g., mouse) variable regions and human constant regions.
  • a mouse light chain variable region is fused to a human k light chain.
  • a mouse heavy chain variable region is fused to a human lgG1 constant region.
  • the invention features an isolated antibody capable of binding to human FcRn.
  • the isolated antibody contains: (1) a light chain variable region that includes a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region that includes a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 comprises a sequence having at least 92% identity to the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 comprises a sequence having at least 85% identity to the sequence of GDSERPS (SEQ ID NO: 2), the CDR L3 comprises a sequence having at least 90% identity to the sequence of SSYAGSGIYV (SEQ ID NO: 3), the CDR H1 comprises a sequence having at least 80% identity to the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: 6), the CDR H2 comprises a sequence having at least 92% identity to
  • the antibody binds human FcRn with a K D that is less than or equal to that of an antibody having the light chain variable region and heavy chain variable region of N022, N023, N024, N026, or N027, and further having the same Fc region as the antibody being compared.
  • an isolated antibody of the invention comprises a CDR L1 that comprises the sequence of X GTGSDVGSYNX VS (SEQ ID NO: 12), a CDR L2 that comprises the sequence of
  • GDX X RPS (SEQ ID NO: 13), a CDR L3 that comprises the sequence of X SYX 6 GSGIYV (SEQ ID NO: 14), a CDR H1 that comprises the sequence of Z YAMG (SEQ ID NO: 15), a CDR H2 that comprises the sequence of SIGZ SGZ QTZ 4 YADS (SEQ ID NO: 16), and a CDR H3 that comprises the sequence of LAZ Z 6 DSY (SEQ ID NO: 17), where X is a polar or hydrophobic amino acid (e.g., preferably T, A, S, or I), X is a hydrophobic amino acid (e.g., preferably L or I), X is a polar amino acid (e.g., preferably S, N, or T), X is a polar or acidic amino acid (e.g., preferably Q, E, or N), X is a polar or hydrophobic amino acid (e.g., preferably C, S
  • an isolated antibody of the invention comprises a CDR L1 that comprises the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1), a CDR L2 that comprises the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 that comprises the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 that comprises the sequence of ZiYAMG (SEQ ID NO: 15), a CDR H2 that comprises the sequence of
  • SIGZ SGZ QTRYADS SEQ ID NO: 18
  • CDR H3 that comprises the sequence of LAIGDSY (SEQ ID NO: 1 1), where Z is T, D, or N, Z is S or A, and Z is G, S or A.
  • Table 1 shows the amino acid sequences of the light and heavy chain complementary determining regions (CDRs) of some exemplary anti-FcRn antibodies of the invention.
  • Table 2 shows the SEQ ID NOs of the light and heavy chains of these exemplary anti-FcRn antibodies of the invention.
  • the light chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of an isolated antibody of the invention comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody including a light chain and a heavy chain, where the light chain comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody including a light chain and a heavy chain, where the light chain comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody including a light chain and a heavy chain, where the light chain comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody including a light chain and a heavy chain, where the light chain comprises a sequence having at least 90% identity to the sequence of
  • the invention features an isolated antibody including a light chain and a heavy chain, where the light chain comprises a sequence having at least 90% identity to the sequence of
  • the heavy chain of the antibody comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20-24.
  • the light chain comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19.
  • the antibodies of the invention may further contain amino acid substitutions, additions, and/or deletions outside of the CDRs (i.e., in framework regions (FRs)).
  • the antibodies of the invention may further include any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24, and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 19.
  • the antibodies may further contain amino acid substitutions, additions, and/or deletions outside of the CDRs (i.e., in framework regions (FRs)).
  • An amino acid substitution, addition, and/or deletion can be a substitution, addition, and/or deletion of one or more amino acids (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, or more).
  • An amino acid substitution, addition, and/or deletion can be a substitution, addition, and/or deletion of eight or fewer, seven or fewer, six or fewer, five or fewer, four or fewer, three or fewer, or two or fewer single amino acids.
  • the antibodies may further include any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24, and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 19.
  • the antibodies of the invention may include amino acid substitutions, additions, and/or deletions in the constant regions (e.g., Fc region) of the antibody that, e.g., lead to decreased effector function, e.g., decreased complement-dependent cytolysis (CDC), antibody-dependent cell-mediated cytolysis (ADCC), and/or antibody-dependent cell-mediated phagocytosis (ADCP), and/or decreased B-cell killing.
  • the constant regions are not involved directly in binding an antibody to its target, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • the antibodies of the invention are characterized by decreased binding (i.e., absence of binding) to human complement factor C1 q and/or human Fc receptor on natural killer (NK) cells. In other embodiments, the antibodies of the invention are characterized by decreased binding (i.e., absence of binding) to human FcyRI, FcyRIIA, and/or FcyRIIIA.
  • antibodies of the invention may be of the IgG class and contain one or more amino acid substitutions E233, L234, G236, D265, D270, N297, E318, K320, K322, A327, A330, P331 , and/or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda,
  • the antibodies contain the mutations L234A/L235A or D265A/N297A.
  • an anti-FcRn antibody of the invention contains amino acidhdfn substitution N297A, relative to the sequence of any one of SEQ ID NOs: 20-24, such that the antibody of the invention is changed to an aglycosylated form.
  • the resulting effectorless antibody shows very little binding to complement or Fc receptors (i.e., complement C1q binding), indicating low CDC potential.
  • the antibodies of the invention may include those having specific amino acid changes that improve stability of the antibody.
  • some antibodies of the invention may undergo an allotype change from G1 m17.1 to G1 m17 by substituting amino acids D355 and L357 (relative to the sequence of any one of SEQ ID NOs: 20-24) to glutamic acid and methionine, respectively.
  • the antibodies of the invention do not contain a C-terminal lysine at residue 446, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the invention features an isolated antibody containing a light chain and a heavy chain, wherein the light chain comprises the sequence of
  • the antibody binds mouse or rat FcRn with a K D of less than 200, 150, 100, 50, or 40 pM.
  • the antibody binds to human FcRn with an affinity of between 1-100, 5-150, 5-100, 5-75, 5-50, 10-50, or 10-40 pM.
  • the anti-FcRn antibodies of the invention may be of immunoglobulin antibody isotype IgG, IgE, IgM, IgA, or IgD.
  • the anti-FcRn antibodies are of immunoglobulin antibody isotype IgG.
  • the anti- FcRn antibodies may also be of any immunoglobulin antibody isotype subclasses.
  • the anti- FcRn antibodies may be of IgG subclass lgG1 , lgG2, lgG3, or lgG4.
  • the anti-FcRn antibodies are of subclass lgG1 .
  • the anti-FcRn antibodies of the invention contain an IgG G1 m17 or G1 m17.1 allotype heavy chain.
  • the light chain of the anti-FcRn antibodies may be a K light chain, a l light chain, or a k-l chimeric light chain.
  • the anti-FcRn antibodies of the invention contain a full-length l light chain.
  • the antibodies of the invention are monoclonal.
  • the antibodies of the invention may also be polyclonal, chimeric, humanized or fully human.
  • the antibody of the invention may be affinity matured.
  • the antibody of the invention may be an antibody fragment.
  • the anti-FcRn antibodies of the invention compete with and inhibit the binding of IgG to human FcRn.
  • Epitope mapping by hydrogen-deuterium exchange of the antibodies of the invention indicates that the antibodies bind to an epitope on FcRn located in and/or adjacent to the Fc-FcRn interaction interface, which suggests that the antibodies of the invention block IgG binding to FcRn by direction inhibition.
  • the epitope-mapped binding site is distant from the albumin-binding site of FcRn. Accordingly, serum albumin-binding should not be inhibited and serum albumin levels should not be decreased. Indeed, experimental evidence shows mouse albumin levels remained constant after anti-FcRn antibody administration, indicating that albumin recycling is not disturbed by antibody binding to FcRn.
  • FcRn is a type I transmembrane protein that functions as an IgG- and serum albumin-binding, intracellular vesicular trafficking protein.
  • FcRn is expressed in endothelial cells, luminal epithelial cells, hepatocytes, podocytes, granulocytes, monocytes, macrophages, dendritic cells, and NK cells, but not on B or T cells.
  • FcRn maintains the half-life of IgG by binding and trafficking constitutively internalized IgG back to the cell surface.
  • FcRn Binding of both Fc and serum albumin by FcRn occurs in the early endosome at pH 6.0, followed by sorting of the FcRn into vesicles, which traffic the FcRn-bound IgG or albumin back to the cell surface where FcRn rapidly releases the IgG or albumin at pH 7.4. This trafficking cycle maintains the half- life of IgG and albumin by recycling both into the circulation and preventing trafficking to the lysosomes for degradation.
  • FcRn also captures internalized IgG Fc in epithelial cells and transports them bidirectionally to the opposing apical or basolateral membranes. This function allows IgG to traffic to the lumen of organs such as the gastrointestinal tract or the transport of IgG or IgG-antigen complexes from the lumen to the vasculature or lymphoid tissues in the stromal layers.
  • mice In order to study the contribution of FcRn to IgG homeostasis, mice have been engineered so that parts of the light and heavy chains of FcRn have been“knocked out” so that these proteins are not expressed (Junghans et al., Proc Natl Acad Sci USA 93:5512, 1996). In these mice, the serum half-life and concentrations of IgG were dramatically reduced, suggesting an FcRn-dependent mechanism of IgG homeostasis. Studies in rodent models, such as the one discussed above, suggest that blockage of FcRn can increase IgG catabolism, including that of pathogenic autoantibodies, thereby inhibiting disease (e.g., an autoimmune disease) development. FcRn may also contribute to antigen presentation through trafficking of immune complexes to antigen degradation and MFIC loading compartments.
  • the present invention provides isolated anti-FcRn antibodies that bind to human FcRn with high affinity.
  • the anti-FcRn antibodies of the invention compete with and effectively inhibit the binding of other anti-FcRn antibodies (e.g., IgG, IgG autoantibodies) to FcRn, thereby increasing the catabolism and decreasing the half-life of other anti-FcRn antibodies (e.g., IgG, IgG autoantibodies).
  • the anti-FcRn antibodies of the invention may be used in a method of treating or reducing immune complex-based activation of an immune response in a subject, such as an immune response caused by autoantibodies in an autoimmune disease.
  • Placental transfer of maternal IgG antibodies to the fetus is an important FcRn-dependent mechanism that provides protection to the neonate while his/her humoral response is inefficient.
  • FcRn in the syncytiotrophoblast layers of the placenta is responsible for the transfer of maternal IgG antibodies to the fetus.
  • Pathogenic maternal antibodies e.g., pathogenic maternal IgG antibodies
  • pathogenic antibodies in the pregnant subject cause a fetal and neonatal alloimmune and/or autoimmune disorder in a fetus in the pregnant subject.
  • the anti-FcRn antibodies described herein e.g., N022-N024, N026, and N027, preferably N027 and/or N024
  • the present disclosure provides isolated anti-FcRn antibodies that bind to human FcRn.
  • the anti- FcRn antibodies may compete with and inhibit the binding of other anti-FcRn antibodies (e.g., IgG, IgG autoantibodies) to FcRn, thereby increasing the catabolism and decreasing the half-life of other anti-FcRn antibodies (e.g., IgG, IgG autoantibodies).
  • the anti-FcRn antibodies may be used in a method of treating or reducing immune complex-based activation of an immune response in a subject, such as an immune response caused by autoantibodies in an autoimmune disease.
  • Reducing an immune response may be described as reducing an immune response relative to a subject who does not receive treatment (e.g., a control subject).
  • the anti-FcRn antibodies may also be used in methods of decreasing pathogenic antibody transport (e.g., pathogenic maternal IgG antibody transport) across the placenta of a pregnant subject, increasing pathogenic antibody catabolism in a pregnant subject, and treating an antibody-mediated enhancement of viral disease in a fetus or a neonate by administering to a pregnant subject an isolated antibody that binds to human FcRn.
  • Decreasing pathogenic antibody transport across the placenta of a pregnant subject may be described as decreasing pathogenic antibody transport relative to a subject who does not receive treatment (e.g., a control subject).
  • the anti-FcRn antibodies of the invention can be produced from a host cell.
  • a host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and constructs described herein from their corresponding nucleic acids.
  • the nucleic acids may be included in nucleic acid vectors that can be introduced into the host cell by conventional techniques known in the art (e.g., transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc).
  • the choice of nucleic acid vectors depends in part on the host cells to be used. Generally, preferred host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.
  • a nucleic acid sequence encoding the amino acid sequence of an anti-FcRn antibody of the invention may be prepared by a variety of methods known in the art. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis.
  • a nucleic acid molecule encoding an anti-FcRn antibody of the invention may be obtained using standard techniques, e.g., gene synthesis.
  • a nucleic acid molecule encoding a wild-type anti-FcRn antibody may be mutated to contain specific amino acid substitutions using standard techniques in the art, e.g., QuikChangeTM mutagenesis.
  • Nucleic acid molecules can be synthesized using a nucleotide synthesizer or PCR techniques.
  • Nucleic acid sequences encoding anti-FcRn antibodies of the invention may be inserted into a vector capable of replicating and expressing the nucleic acid molecules in prokaryotic or eukaryotic host cells.
  • each vector may contain various components that may be adjusted and optimized for compatibility with the particular host cell.
  • the vector components may include, but are not limited to, an origin of replication, a selection marker gene, a promoter, a ribosome binding site, a signal sequence, the nucleic acid sequence encoding protein of interest, and a transcription termination sequence.
  • mammalian cells are used as host cells for the invention.
  • mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK 293F), Chinese hamster ovary (CHO), HeLa, COS, PC3, Vero, MC3T3, NS0, Sp2/0, VERY, BHK, MDCK, W138, BT483, Hs578T, HTB2, BT20, T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7030, and HsS78Bst cells.
  • £ coli cells are used as host cells for the invention.
  • E. coli strains include, but are not limited to, £. coli 294 (ATCC ® 31 ,446), £. coli l 1776 (ATCC ® 31 ,537, £. coli BL21 (DE3) (ATCC ® BAA- 1025), and £. coli RV308 (ATCC ® 31 ,608).
  • Different host cells have characteristic and specific mechanisms for the posttranslational processing and modification of protein products. Appropriate cell lines or host systems may be chosen to ensure the correct modification and processing of the anti-FcRn antibody expressed.
  • the above-described expression vectors may be introduced into appropriate host cells using conventional techniques in the art, e.g., transformation, transfection, electroporation, calcium phosphate precipitation, and direct microinjection.
  • host cells are cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • Methods for expression of therapeutic proteins are known in the art, see, for example, Paulina Baibas, Argelia Lorence (eds.) Recombinant Gene Expression: Reviews and Protocols (Methods in Molecular Biology), Humana Press; 2nd ed. 2004 (July 20, 2004) and Vladimir Voynov and Justin A. Caravella (eds.) Therapeutic Proteins: Methods and Protocols (Methods in Molecular Biology) Humana Press; 2nd ed. 2012 (June 28, 2012).
  • Host cells used to produce the anti-FcRn antibodies of the invention may be grown in media known in the art and suitable for culturing of the selected host cells.
  • suitable media for mammalian host cells include Minimal Essential Medium (MEM), Dulbecco’s Modified Eagle’s Medium (DMEM), Expi293TM Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-1640.
  • suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicillin.
  • Host cells are cultured at suitable temperatures, such as from about 20 °C to about 39 °C, e.g., from 25 °C to about 37 °C, preferably 37 °C, and C0 2 levels, such as 5 to 10% (preferably 8%).
  • the pH of the medium is generally from about 6.8 to 7.4, e.g., 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter.
  • Protein recovery typically involves disrupting the host cell, generally by such means as osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris may be removed by centrifugation or filtration. The proteins may be further purified.
  • An anti-FcRn antibody of the invention may be purified by any method known in the art of protein purification, for example, by protein A affinity, other chromatography (e.g., ion exchange, affinity, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins (see Process Scale Purification of Antibodies, Uwe Gottschalk (ed.) John Wiley & Sons, Inc., 2009).
  • an anti-FcRn antibody can be conjugated to marker sequences, such as a peptide to facilitate purification.
  • marker sequences such as a peptide to facilitate purification.
  • An example of a marker amino acid sequence is a hexa-histidine peptide (His-tag), which binds to nickel-functionalized agarose affinity column with micromolar affinity.
  • His-tag hexa-histidine peptide
  • Other peptide tags useful for purification include, but are not limited to, the hemagglutinin“HA” tag, which corresponds to an epitope derived from the influenza hemagglutinin protein.
  • anti-FcRn antibodies of the invention can be produced by the cells of a subject (e.g., a human), e.g., in the context of therapy, by administrating a vector (e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vector, and alphaviral vector) containing a nucleic acid molecule encoding the anti-FcRn antibody of the invention.
  • a vector e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)
  • vaccinia viral vector such as Modified Vaccinia Ankara (MVA)
  • alphaviral vector e.g., vaccinia viral vector, such as Modified Vaccinia Ankar
  • the vector once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc) will promote expression of the anti-FcRn antibody, which is then secreted from the cell. If treatment of a disease or disorder is the desired outcome, no further action may be required. If collection of the protein is desired, blood may be collected from the subject and the protein purified from the blood by methods known in the art.
  • compositions that include one or more anti-FcRn antibodies described herein.
  • pharmaceutical compositions of the invention contain one or more antibodies of the invention, e.g., N022-N024, N026, and N027, as the therapeutic proteins.
  • pharmaceutical compositions of the invention containing one or more antibodies of the invention, e.g., N022-N024, N026, and N027 may be used in combination with other agents (e.g., therapeutic biologies and/or small molecules) or compositions in a therapy.
  • the pharmaceutical compositions may contain one or more agents (e.g., therapeutic biologies and/or small molecules) or compositions in a therapy.
  • the pharmaceutical compositions may contain one or more agents (e.g., therapeutic biologies and/or small molecules) or compositions in a therapy.
  • the pharmaceutical compositions may contain one or more agents (e.g., therapeutic biologies and/or small molecules) or compositions in a therapy.
  • the pharmaceutical compositions may contain one or more
  • Acceptable carriers and excipients in the pharmaceutical compositions are nontoxic to recipients at the dosages and concentrations employed. Acceptable carriers and excipients may include buffers, antioxidants, preservatives, polymers, amino acids, and carbohydrates.
  • Pharmaceutical compositions of the invention can be administered parenterally in the form of an injectable formulation.
  • Pharmaceutical compositions for injection i.e., intravenous injection
  • Pharmaceutically acceptable vehicles include, but are not limited to, sterile water, physiological saline, and cell culture media (e.g., Dulbecco’s Modified Eagle Medium (DMEM), a-Modified Eagles Medium (a-MEM), F-12 medium) .
  • Formulation methods are known in the art, see e.g., Banga (ed.) Therapeutic Peptides and Proteins: Formulation, Processing and Delivery Systems (2nd ed.) Taylor & Francis Group, CRC Press (2006).
  • the pharmaceutical composition may be formed in a unit dose form as needed.
  • the amount of active component e.g., one or more anti-FcRn antibodies of the invention (e.g., N022-N024, N026, and N027, preferably N027 and/or N024), included in the pharmaceutical preparations is such that a suitable dose within the designated range is provided (e.g., a dose within the range of 0.01 -500 mg/kg of body weight).
  • compositions of the invention that contain one or more anti-FcRn antibodies (e.g., N022-N024, N026, and N027, preferably N027 and/or N024) as the therapeutic proteins may be formulated for intravenous administration, parenteral administration, subcutaneous administration, intramuscular administration, intra-arterial administration, intrathecal administration, or intraperitoneal administration. In particular, intravenous administration is preferred.
  • the pharmaceutical composition may also be formulated for, or administered via, oral, nasal, spray, aerosol, rectal, or vaginal administration.
  • various effective pharmaceutical carriers are known in the art.
  • the dosage of the pharmaceutical compositions of the invention depends on factors including the route of administration, the disease to be treated, and physical characteristics, e.g., age, weight, general health, of the subject.
  • the amount of an anti-FcRn antibody of the invention e.g., any one of N022-N024, N026, and N027, preferably N027 or N024 contained within a single dose may be an amount that effectively prevents, delays, or treats the disease without inducing significant toxicity.
  • a pharmaceutical composition of the invention may include a dosage of an anti-FcRn antibody of the invention ranging from 0.01 to 500 mg/kg (e.g., 0.01 , 0.1 , 0.2, 0.3, 0.4, 0.5, 1 , 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, or 500 mg/kg) and, in a more specific embodiment, about 1 to about 100 mg/kg and, in a more specific embodiment, about 1 to about 50 mg/kg.
  • the dosage may be adapted by the physician in accordance with conventional factors such as the extent of the disease and different parameters of the subject. Additionally, the dosage may be adapted by the physician in accordance with factors such as gestational age, preparation for birth, weight gain of woman, and/or length of pregnancy.
  • compositions and pharmaceutical compositions described herein are administered to a pregnant woman throughout pregnancy.
  • the compositions and pharmaceutical compositions described herein are administered to a pregnant woman for around 5-25 weeks during pregnancy (e.g., around 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, or 25 weeks).
  • administration of the compositions and pharmaceutical compositions ceases after around gestational age 34 (week 34) (E.g., after week 34, 35, 36, or 37).
  • IVIG is administered to the pregnant woman after cessation of administration of the compositions and
  • IVIG is administered between around 3-15 days (e.g., 3,
  • compositions and pharmaceutical compositions described herein are first administered after gestational age 12 (e.g. after 12, 13, 14, 15, 16, 17, 18, 19, 20,
  • gestational age 14 and 26 e.g., 14 and 25; 15 and 25; or 15 and 26, etc.
  • gestational age 12 and 36 e.g., 12 and 36; 12 and 35; 12 and 34; 13 and 36; 13 and 35; 13 and 34; 14 and 36; 14 and 35; 14 and 34; 15 and 36; 15 and 35; 15 and 34; 16 and 36; 16 and 35; or 16 and 34; etc.
  • the pharmaceutical compositions are administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective to result in an improvement or remediation of the symptoms.
  • the pharmaceutical compositions are administered in a variety of dosage forms, e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules).
  • dosage forms e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules).
  • therapeutic proteins are dosed at 1-100 mg/kg, e.g., 1-50 mg/kg.
  • compositions of the invention that contain an anti-FcRn antibody may be administered to a subject in need thereof, for example, one or more times (e.g., 1 -10 times or more) daily, weekly, monthly, biannually, annually, or as medically necessary. Dosages may be provided in either a single or multiple dosage regimens. The timing between administrations may decrease as the medical condition improves or increase as the health of the patient declines.
  • the blockade of human FcRn by anti-FcRn antibodies of the invention may be of therapeutic benefit in diseases that are driven by IgG autoantibodies.
  • the ability of FcRn blockade to induce overall IgG catabolism and removal of multiple species of autoantibodies without perturbing serum albumin, small circulating metabolites, or lipoproteins offers a method to expand the utility and accessibility of an autoantibody removal strategy to patients with autoantibody-driven autoimmune disease pathology.
  • the dominant mechanism of action of an anti-FcRn antibody of the invention may be to increase the catabolism of pathogenic autoantibodies in circulation and decrease autoantibody and immune complex deposition in affected tissues.
  • compositions and methods of the invention containing one or more anti-FcRn antibodies are useful to promote catabolism and clearance of pathogenic antibodies, e.g., IgG and IgG autoantibodies in a subject, to reduce the immune response, e.g., to block immune complex-based activation of the immune response in a subject, and to treat immunological conditions or diseases in a subject.
  • the pharmaceutical compositions and methods of the invention are useful to reduce or treat an immune complex-based activation of an acute or chronic immune response.
  • the acute immune response may be activated by a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura (ITP), autoimmune haemolytic anaemia (AIHA), immune neutropenia, dialated cardiomyopathy, and serum sickness.
  • a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia
  • the chronic immune response may be activated by a medical condition selected from the group consisting of chronic inflammatory demyelinating polyneuropathy (CIDP), systemic lupus, a chronic form of a disorder indicated for acute treatment, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, and antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis.
  • CIDP chronic inflammatory demyelinating polyneuropathy
  • ANCA antineutrophil cytoplasmic antibody
  • the pharmaceutical compositions and methods of the invention are useful to reduce or treat an immune response activated by an autoimmune disease.
  • the autoimmune disease may be selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcets disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves' disease, Hashimoto's thyroiditis, hypothyroidism
  • compositions and methods of the invention are useful to reduce or treat an immune response activated by systemic lupus erythematosus, antiphospholipid syndrome, pemphigus vulgaris/bullous pemphigoid, antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis, myasthenia gravis, or neuromyelitis optica.
  • ANCA antineutrophil cytoplasmic antibody
  • the pharmaceutical compositions and methods are useful to decrease the risk of or decrease the risk of developing anemia in the fetus. In some embodiments, the pharmaceutical compositions and methods are useful to decrease or obviate the need for IUT (intrauterine transfusion). In some embodiments, the pharmaceutical compositions and methods are useful to decrease or obviate the need for antenatal PP + IVIg, postnatal transfusion, IVIg, and/or phototherapy.
  • the pharmaceutical compositions and methods are useful to reduce or treat an immune response activated by an autoimmune disease.
  • the autoimmune disease may be selected from the group consisting of alopecia areata, ankylosing spondylitis, antiphospholipid syndrome (e.g., antiphospholipid antibody syndrome), Addison's disease, hemolytic anemia (e.g., warm autoimmune hemolytic anemia), autoimmune hepatitis, hepatitis, Behcets disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, epidermolysis bullosa; fibromyalg
  • the pharmaceutical compositions and methods are useful to reduce or treat an immune response in a fetus or neonate. In some embodiments, the pharmaceutical compositions and methods are useful to reduce or treat an immune response in a fetus or neonate activated by an autoimmune disease in the pregnant mother.
  • compositions and methods are useful to reduce or treat an immune response activated by systemic lupus erythematosus, antiphospholipid syndrome, pemphigus
  • compositions and methods are useful to reduce or treat an immune response in a fetus or neonate.
  • the pharmaceutical compositions and methods are useful to reduce or treat an immune response in a fetus or neonate.
  • compositions and methods are useful to reduce or treat an immune response activated by systemic lupus erythematosus, antiphospholipid syndrome, pemphigus vulgaris/bullous pemphigoid, antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis, myasthenia gravis, or neuromyelitis optica in the pregnant mother.
  • ANCA antineutrophil cytoplasmic antibody
  • compositions and methods are useful in methods of decreasing pathogenic antibody transport (e.g., pathogenic maternal IgG antibody transport) across the placenta of a pregnant subject, increasing pathogenic antibody catabolism in a pregnant subject, and treating an antibody-mediated enhancement of viral disease in a fetus or a neonate by administering to a pregnant subject an isolated antibody that binds to human FcRn.
  • pathogenic antibody transport e.g., pathogenic maternal IgG antibody transport
  • Diseases and disorders that may benefit from FcRn inhibition by the isolated anti-FcRn antibodies described herein include diseases and disorders in a fetus and/or neonate that are caused by the transfer of maternal pathogenic antibodies (e.g., maternal pathogenic IgG antibodies) across the placenta from a pregnant subject to the fetus and/or neonate.
  • maternal pathogenic antibodies e.g., maternal pathogenic IgG antibodies
  • the diseases and disorders that may benefit from FcRn inhibition by the isolated anti-FcRn antibodies described herein are fetal and neonatal alloimmune and/or autoimmune disorders.
  • Fetal and neonatal alloimmune disorders are disorders in a fetus and/or neonate that is caused by pathogenic antibodies in the pregnant subject.
  • the pathogenic antibodies in the pregnant subject may attack the antigens of the fetus (e.g., antigens the fetus inherited from the fetus’ father), causing the fetus or the neonate to have a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the antigens of the fetus e.g., antigens the fetus inherited from the fetus’ father
  • the fetus or the neonate may have a fetal and neonatal alloimmune and/or autoimmune disorder.
  • fetal and neonatal alloimmune and/or autoimmune disorders examples include, but are not limited to, fetal and neonatal alloimmune thrombocytopenia (FNAIT), hemolytic disease of the fetus and newborn (FIDFN), alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma. Behcet's disease, neonatal Graves’ disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • FNAIT fetal and neonatal alloimmune thrombocytopenia
  • FNAIT hemolytic disease of the fetus and newborn
  • FNFN hemolytic
  • the diseases and disorders that may benefit from FcRn inhibition by the isolated anti-FcRn antibodies described herein are viral diseases wherein antibodies facilitate viral entry into host cells, leading to increased or enhanced infectivity in the cells, e.g., antibody-mediated enhancement of viral disease.
  • an antibody may bind to a viral surface protein and the antibody/virus complex may bind to an FcRn on a cell surface through interaction between the antibody and the receptor. Subsequently, the antibody/virus complex may get internalized into the cell.
  • a virus may gain entry into the cells and/or tissues of a fetus through forming a complex with a maternal IgG antibody.
  • a maternal IgG antibody may bind to a viral surface protein and the IgG/virus complex may bind to an FcRn in the
  • the methods described herein may be used to treat an anti body- mediated enhancement of viral disease.
  • the viral diseases that are enhanced by pathogenic antibodies include, but are not limited to, viral diseases caused by an alpha virus infection, flavivirus infection, Zika virus infection, Chikungunya virus infection, Ross River virus infection, severe acute respiratory syndrome coronavirus infection, Middle East respiratory syndrome, avian influenza infection, influenza virus infection, human respiratory syncytial virus infection, Ebola virus infection, yellow fever virus infection, dengue virus infection, human immunodeficiency virus infection, respiratory syncytial virus infection, Hantavirus infection, Getah virus infection, Sindbis virus infection, Bunyamwera virus infection, West Nile virus infection, Japanese encephalitis virus B infection, rabbitpox virus infection, lactate dehydrogenase elevating virus infection, reovirus infection, rabies virus infection, foot-and-mouth disease virus infection, porcine reproductive and respiratory syndrome virus infection,
  • pathogenic antibodies include, but are not limited to, viral diseases caused by an alpha
  • the blockade of human FcRn by anti-FcRn antibodies may be of therapeutic benefit in diseases that are driven by pathogenic antibodies (e.g., pathogenic IgG antibodies).
  • pathogenic antibodies e.g., pathogenic IgG antibodies.
  • the ability of FcRn blockade to induce overall pathogenic antibody catabolism and removal of multiple species of pathogenic antibodies, small circulating metabolites, or lipoproteins offers a method to expand the utility and accessibility of a pathogenic antibody removal strategy to patients with pathogenic antibody-driven autoimmune disease pathology.
  • the dominant mechanism of action of an anti-FcRn antibody may be to increase the catabolism of pathogenic antibodies in circulation and decrease pathogenic antibody and immune complex deposition in affected tissues.
  • the anti-FcRn antibodies described herein may be administered to a pregnant subject who has or is at risk of having a medical condition that activates an immune response in the pregnant subject.
  • the pregnant subject may have had, in the past, a medical condition that activated an immune response in the pregnant subject.
  • the pregnant subject has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the anti-FcRn antibodies described herein may be administered to a pregnant subject if a pathogenic antibody associated with an immune disease is detected in a biological sample (e.g., a blood or urine sample) obtained from the pregnant subject.
  • a biological sample e.g., a blood or urine sample
  • the pathogenic antibody detected in the biological sample of the pregnant subject is known to bind to an antigen from the fetus in the pregnant subject (e.g., an antigen that the fetus inherited from the fetus’ father).
  • the anti-FcRn antibodies described herein may be administered to a subject who is planning to become pregnant and who has or is at risk of having a medical condition that activates an immune response in the pregnant subject, and/or who has had, in the past, a medical condition that activated an immune response in the pregnant subject.
  • a subject is planning to become pregnant and has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the anti-FcRn antibodies described herein may be administered to a subject who is planning to become pregnant and whose biological sample contains a pathogenic antibody associated with an immune disease. In some embodiments, the anti-FcRn antibodies described herein may be administered to a subject (e.g., a pregnant subject) to reduce or treat an immune complex-based activation of an acute or chronic immune response in the subject.
  • the acute immune response may be activated by a medical condition (e.g., pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulitis, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura, autoimmune haemolytic anaemia, immune neutropenia, dialated cardiomyopathy, serum sickness, chronic inflammatory demyelinating polyneuropathy, systemic lupus, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, or antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis).
  • a medical condition e.g., pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome,
  • the anti-FcRn antibodies described herein may be administered to a subject (e.g., a pregnant subject) to reduce or treat an immune response activated by an autoimmune disease.
  • the autoimmune disease may be, for example, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, warm autoimmune hemolytic anemia (wAIHA), anti-factor antibodies, heparin induced thrombocytopenia (HICT), sensitized transplant, autoimmune hepatitis, hepatitis, Behcet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis,
  • lymphoproliferative syndrome idiopathic pulmonary fibrosis, IgA nephropathy, insulin dependent diabetes, juvenile arthritis, lichen planus, lupus, Meniere's Disease, mixed connective tissue disease, multiple sclerosis, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, Raynaud's phenomenon, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, stiff-man syndrome, Takayasu arteritis, temporal arteritis, ulcerative colitis, uveitis, vitiligo, or Wegener's granulomatosis.
  • IgG heavy and light chain nucleic acid molecules were cloned in vector pCDNA 3.3 using osteonectin secretion signals.
  • HEK 293F cells were grown in Expi293 media at 37 °C with 8% C0 2 . Cells were transfected at a density of 3x10 6 /ml with 1 mg total DNA per liter. Enhancers were added on days 2 and 3 following manufacturer’s directions and the cells were cultured until day 5 or 6 before cell viability dropped to below 50% to 60%. The cells were then spun out by centrifugation and the spent media was sterile filtered and stored at 4 °C until antibody purification.
  • Antibodies were purified by a two-column procedure: POROS Protein A chromatography followed by POROS HS-50 cation exchange chromatography.
  • the former separated most of the host cell proteins from the expressed antibodies while the latter removed the heavy chain dimers, light chain dimers, and half antibodies, as well as higher molecular weight species.
  • the fractions from the HS-50 cation exchange column were pooled based on an SDS-PAGE gel analysis to maximize purity of the full length antibodies.
  • the collected fractions were put over a Sephadex G50 buffer exchange column equilibrated in PBS at pH 7.2.
  • the peak fractions were pooled and concentrated to greater than 10 mg/ml using 30 kDa spin concentrators and frozen at -30 °C in 2 mg and 5 mg aliquots.
  • the final protein samples were checked for purity by SDS-PAGE.
  • HBSP+ 0.15 M NaCI, 0.05% P20, pH 7.4
  • Sodium Phosphate Buffer 0.02 M Sodium Phosphate, 0.15 M NaCI, 0.05% P20, pH 6.0
  • a mouse anti-Human Fc mAb from GE Healthcare (BR100839) was diluted to 10 pg/ml in 10 mM acetate buffer pH 5.0 and approximately 5,700 response units (RU) was immobilized using standard amine coupling chemistry in the horizontal orientation onto a GLC sensor chip.
  • the anti-hFcRn mAbs to be tested were captured onto the surface in the vertical orientation, with the goal of immobilizing approximately 200 response units (RU) per interaction spot.
  • the rhFcRn was diluted in a five-point three-fold dilution series starting at 1.25 pg/ml, leaving one lane as buffer-only for a double reference.
  • the analyte was flowed across the sensor surface in the horizontal orientation at 100 pl/min for 240 s with a 3,600 s dissociation time. Regeneration was accomplished by injecting 3M MgCI 2 at 100 pl/min for 30 s in both the horizontal and vertical directions. These procedures were repeated for all ligands.
  • Table 3 shows that five anti-FcRn antibodies of the invention, N022, N022, N024, N026, and N027, all bind with high affinity to human FcRn at pH 7.4.
  • the equilibrium dissociation constant, K D , of the anti- FcRn antibodies of the invention ranged from 19.4 pM (N027) to 36.5 pM (N026) for binding to human FcRn at pH 7.4.
  • Table 3 also shows the rapid on-rates and slow off-rates of the five anti-FcRn antibodies. At pH 7.4, the on-rates were in the range of 0.93-1.42 X 10 6 1/Ms for binding to human FcRn. The off-rates were in the range of 2.31-4.44 X 10 6 1/s.
  • anti-FcRn antibodies of the invention to compete with IgG for binding to human or cynomolgus monkey FcRn was evaluated on human embryonic kidney (FIEK) 293 cells ectopically expressing cell surface, glycophosphatidylinositol (GPI)-linked FcRn.
  • FIEK human embryonic kidney
  • GPI glycophosphatidylinositol
  • Human and cynomolgus monkey FcRn alpha amino acid sequences exhibit 97.5% sequence identity.
  • Nine amino acid residues of 355 are different between human and cynomolgus monkey FcRn alpha, but none are in the epitope-mapped binding region.
  • the level of cell-bound IgG was determined using 66 nM of fluorescent probe-labeled, non-specific IgG.
  • the binding of IgG to cell surface FcRn was done at pH 6.0, which allows the Fc portion of IgG to interact with FcRn.
  • the amount of cell-bound IgG significantly decreased as the concentration of the anti-FcRn antibody (N022-N024, N026, or N027) increased.
  • the binding of IgG was inhibited in a concentration- and saturation-dependent manner by each of the five exemplary anti-FcRn antibodies of the invention, demonstrating the ability of the anti-FcRn antibodies, N022-N024, N026, and N027, to effectively compete with and inhibit binding of IgG to FcRn at pH 6.0.
  • the EC50 values of the antibodies ranged between 2 and 6 nM.
  • human FcRn transgenic mouse strain FcRn-/-hFcRn (32) Tg mice which lacks mouse FcRn but expresses human FcRn in a tissue distribution similar to the endogenous mouse and human FcRn, was used.
  • FcRn-/-hFcRn (32) Tg mice injected with 500 mg/kg human IgG on day 0 were administered a single dose of an anti-FcRn antibody at 10 mg/kg on days 1 and 4. As shown in FIG.
  • FcRn is a type I transmembrane protein with the IgG and albumin binding domains oriented to the luminal side of endosomal membranes or to the cell surface when transported to the plasma membrane.
  • the binding of anti-FcRn antibodies to cell surface, membrane-associated FcRn on HEK293 cells at pH 7.4 mimics binding in a physiologically-relevant environment and at the pH where only the Fab domain and not the Fc domain of the antibodies interact with FcRn.
  • the FcRn extracellular domain was displayed on the cell surface at high density through a C-terminal engineered GPI linkage.
  • the anti- FcRn antibodies of the invention were labeled with a fluorescent probe. The antibodies were allowed to bind for 30 minutes on ice. Cells were then washed at 4 °C and bound antibodies were detected using a fluorophore-labeled secondary antibody, e.g., a goat anti-human IgG F(ab) 2 .
  • the binding to human FcRn was concentration dependent and antibodies of the invention displayed EC50 values ranging from 4 to 7 nM.
  • Cellular binding affinities of the antibodies of the invention were also measured on endogenously expressed human FcRn.
  • Monocytes express the highest levels of FcRn and show the highest percent positivity for FcRn expression in mouse and human blood.
  • Monocytic cell line THP-1 was used to evaluate binding of anti-FcRn antibodies to endogenous human FcRn at pH 7.4. Since endogenous FcRn is primarily in intracellular endosomal vesicles in THP-1 cells, the cells were first permeablized with a mild detergent and fixed prior to incubation for 30 minutes at 4 °C with anti-FcRn antibodies in the presence of bovine serum to block non-specific Fc receptor binding.
  • This assay was able to distinguish antibodies with better binding to endogenous human FcRn.
  • the binding of anti-FcRn antibodies to THP-1 cells is concentration dependent. All antibodies of the invention, e.g., N022-N024, N026, and N027, showed better binding affinities than lgG1.
  • Antibody N027 displayed the highest binding affinity with an EC50 value of 3.0 nM.
  • anti-FcRn antibodies of the invention to compete with IgG for binding to human or cynomolgus monkey FcRn was evaluated on human embryonic kidney (HEK) 293 cells ectopically expressing cell surface, GPI-linked FcRn.
  • the level of cell-bound IgG was determined using fluorescent probe-labeled, non-specific IgG.
  • the binding of IgG to cell surface FcRn was done at pH 6.0, which allows the Fc portion of IgG to interact with FcRn.
  • the amount of cell-bound IgG significantly decreased as the concentration of the anti-FcRn antibody increased.
  • the binding of IgG was inhibited in a concentration- and saturation-dependent manner by each of the five exemplary anti-FcRn antibodies of the invention, e.g., N022-N024, N026, and N027, demonstrating the ability of the anti-FcRn antibodies to effectively compete with and inhibit binding of IgG to FcRn at pH 6.0.
  • the EC50 values of the antibodies ranged from 2 to 6 nM.
  • Epitope mapping by hydrogen-deuterium exchange of the antibodies of the invention indicated that the antibodies bind to an epitope on human FcRn located in and/or adjacent to the Fc-FcRn interaction interface, which suggests that the antibodies of the invention block IgG binding to FcRn by direction inhibition. Furthermore, the epitope-mapped binding site is distant from the albumin-binding site of FcRn.
  • human FcRn transgenic mouse strain FcRn-/-hFcRn (32) Tg mice which lack mouse FcRn but express human FcRn in a tissue distribution similar to that of the endogenous mouse and human FcRn, were used.
  • FcRn-/-hFcRn (32) Tg mice injected with human IgG on day 0 were administered a single dose of an anti-FcRn antibody at 10 mg/kg on days 1 and 4. As shown in Example 3 and FIG.
  • FACS fluorescence-activated cell sorting
  • Example 7 Selective induction of IgG catabolism and target occupancy in cynomolgus monkeys
  • N027 or isotype human lgG1 control antibody labeled with fluorophore was administered i.v. to Tg32 human FcRn transgenic, mouse FcRn knockout mice at 30 mg/kg. Levels of labeled antibody were measured in individual organs by quantitative ex vivo optical imaging.
  • FIG. 5 shows the biodistribution of N027 in various organs in mice.
  • Example 10 - Efficacy of N027 in mouse chronic idiopathic thrombocytopenia purpura (ITP)
  • Thrombocytopenia was induced in Tg32 human FcRn (hFCGRT) transgenic, mouse FcRn
  • FIG. 7 shows the effects of N027 on platelet levels in mice having thrombocytopenia.
  • the receptor occupancy by N027 was compared across different cell types such as primary human aortic endothelial cells (FIAECs), human umbilical vein endothelial cells (FIUVECs) cells and placental trophoblasts (FIVTs).
  • FIAECs primary human aortic endothelial cells
  • FIUVECs human umbilical vein endothelial cells
  • FIVTs placental trophoblasts
  • FIGS. 8A, 8B, and 8C show the FcRn occupancy across N027 concentrations for the FIAECs, FIUVECs and FIVTs, respectively.
  • the results as summarized in Table 4 show that human ECs (FIAECs, FIUVECs) as well as placental FIVTs exhibit similar concentration dependence receptor occupancy by N027.
  • Example 12 - N027 concentrations achieving 100% receptor occupancy result in increased intracellular IgG accumulation
  • FIAECs and FIUVECs Fluman endothelial cells were cultured in endothelial cell culture (EBM-2, Lonza) while human placental trophoblasts (FIVTs) were cultured in trophoblast media (ScienCell). Cell monolayers were then pulsed for 4-5 hours at 37 °C in 1 mL media containing either:
  • FIGS. 9A, 9B, and 9C show the intracellular IgG levels for the HAECs, HUVECs and HVTs, respectively, corresponding to various doses of N027.
  • N027 doses corresponding to >100% FcRn occupancy resulted in significantly higher IgG accumulation compared to isotype controls.
  • the results demonstrate that the effective N027 concentrations needed to achieve saturating levels of IgG accumulation is similar in these target cell types and ranges from 4.99 to 2.43 pg/mL as summarized in Table 5
  • confluent vascular endothelial cell (FIUVEC) monolayers were incubated with or without a saturating concentration of N027 (16.6 pg/ml) in EBM-2 media for the indicated times at 37 °C (FIG. 10).
  • FIUVEC confluent vascular endothelial cell
  • cells were washed and harvested with cold FlyQtase, followed by fixing and permeabilization. These cells were then incubated in permeabilization buffer + 10% human serum and VivoTag645-labeled N027 (10 pg/mL) for 30 minutes at 4 °C in the dark.
  • Example 14 Human vascular endothelial cells and placental trophoblasts exhibit similar FcRn turnover rates which are unaltered by N027
  • FIUVECs human vascular endothelial cells
  • FIVTs placental trophoblasts
  • FIGS. 1 1 A and 1 1 B show that FcRn turnover rates are similar between human vascular endothelial cells (FIUVECs) and placental trophoblasts (FIVTs). Furthermore, treatment with N027 did not change the FcRn turnover rates.
  • N027 was compared in human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs).
  • HVTs placental trophoblasts
  • Cells were grown on glass coverslips in EBM-2/TM media. Live cells were incubated in media containing DyLight594-N027 (2 pg/mL) for 1 hour at 37 °C. Cells were then washed and imaged live on fluorescence microscope in confocal mode with 60X dry objective using appropriate filters.
  • Representative single cell images show similar localization pattern of N027 bound to the endocytic pool of FcRn in both cell types (FIGS. 12A and 12B).
  • the circle in the center of the cell indicates the location of the nucleus.
  • Example 16 Effect of N027 treatment on dynamics of IgG trafficking: Intracellular IgG accumulation and co-localization with lysosomes
  • N027 treatment was compared across FcRn expressing target cell types such as human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs).
  • HVTs placental trophoblasts
  • EBM-2 media Lida, Waterville
  • TM1 media ScienCell
  • Confluent cell monolayers were then pulsed in 1 ml media containing either N027 (2 pg/ml) + VivoTag645-lgG (50 pg/mL) or isotype control IgG (2 pg/mL) + VivoTag645-lgG (50 pg/ml) for 20 hours at 37 °C.
  • N027 increases intracellular IgG and co-localization of IgG with lysosomes in primary human umbilical vein endothelial cells (HUVECs).
  • HUVECs primary human umbilical vein endothelial cells
  • Cells were grown on glass coverslips and incubated in media containing 10 pg/ml Alexa Fluor 594 Dextran (10,000 MW, anionic, fixable) for 2 hours at 37 °C.
  • Isotype+DyLight 488-IVIG pulsed set was chased in the presence of isotype control IgG (2 pg/mL) and the set without any IgG-treatments was chased in media only. Cells were washed, incubated in BD
  • Pregnant female cynomolgus monkeys were dosed weekly from Gestation Day 45 (GD45) to C- section at GD100 (mid-gestation) or GD140 (late gestation).
  • GD45 Gestation Day 45
  • GD100 mid-gestation
  • GD140 late gestation
  • a cohort of animals was also included in the study that were allowed to deliver their infants (birth day [BD1]). The design study is depicted in Table 8.
  • IgG concentrations were measured in maternal and neonatal blood samples using a standard validated total IgG ELISA (Table 9). Briefly, polystyrene plates (96-well) were coated with commercially available anti- human IgG antigen. The coated plate(s) were washed to remove unbound sample and then blocked using with blocking buffer followed by a wash to remove the residual blocking buffer. Serum samples were diluted and added to the anti-human IgG coated wells and incubated at room temperature for 60 ⁇ 5 minutes. Each well was washed before addition of secondary (detection) antibody conjugated to horseradish peroxidase (HRP) and incubated at room temperature for 60 ⁇ 5 minutes.
  • HRP horseradish peroxidase
  • Tetramethylbenzidine (TMB) substrate was subsequently added to each well and incubated at room temperature for 20 ⁇ 5 minutes on a plate shaker, before addition of 2N H2SO4 to stop the enzymatic reaction. The absorbance of each well was read at 450 nm using the SpectraMax® 190 microplate reader.
  • Any commercially available or proprietary pair of anti human IgG capture antibody and HRP conjugated anti-human IgG detection antibody that recognizes total IgG and is cross- reactive with cynomolgus monkey IgG can be used to measure total cynomolgus monkey IgG in an ELISA.
  • the IgG detection antibody can be, for example, intact IgG, polyclonal serum antibody, monoclonal antibody, or a Fab(2) fragment.
  • N027 administration resulted in dose-independent reductions in serum IgG levels in adult females beginning 72 hours postdose, and the greatest reductions in serum IgG concentrations were observed for both the 100 and 300 mg/kg dosed animals at the GD51-53: predose time point (FIG. 16).
  • the serum IgG values for Group 2 trended toward predose levels in a dose-dependent manner, beginning at the GD65-67: predose time point and continuing until the next dose administrations on GD93-95 and GD135- 137, after which, reductions of a similar magnitude were present within 72 hours of dosing.
  • Group 3 animals (300 mg/kg) remained at a nadir IgG value at all pre-dose timepoints (as referred to in Table 10) throughout the dosing period. No change in IgG from baseline was observed in animals treated with vehicle (Group 1).
  • N027 receptor occupancy was assessed on monocytes, granulocytes, B-lymphocytes, and T-lymphocytes using a flow cytometric (FACS) assay to measure the binding of fluorescent-labeled N027 to free/unbound FcRn in the presence and absence of saturating concentrations of N027.
  • the unsaturated samples demonstrated the percentages of free or unbound FcRn receptor present on each leukocyte subset at each predose and postdose time point.
  • the saturated samples were spiked with concentrations of unlabeled N027 that were determined to completely saturate any FcRn receptors that remained free/unbound at each postdose time point.
  • N027 receptor occupancy was not detected in the whole blood of fetuses on day GD100 and GD140, or in neonates on BD1 , in the context of the unsaturated sample analysis as described above.
  • Fluman placenta obtained from uncomplicated term pregnancies were utilized in an ex- vivo dual perfusion single placental lobule method to evaluate the transplacental transfer of N027. Briefly, each placenta was examined for tears, and two chorionic vessels (one artery and vein) supplying a single intact peripheral cotyledon were cannulated with 3F and 5F umbilical catheters, respectively. The cotyledon was trimmed and placed in the perfusion chamber with the maternal surface upward. The intervillous space on the maternal side was perfused by two catheters piercing the basal plate. The flow rate of the perfusate medium in the fetal and maternal circuits was 3.0 and 12 mL/min, respectively.
  • the maternal perfusate was equilibrated with a gas mixture made of 95% O and 5% CO , and the fetal perfusate with a mixture of 95% N 2 and 5% C0 2 . All experiments were carried out at a temperature of 37°C.
  • Each placental lobule was perfused for an initial control period of one hour to allow the tissue to stabilize to its new environment using an open-open configuration of the perfusion system.
  • Perfusion was terminated if one of the following occurred during the control period: a volume loss in the fetal circuit in an excess of 3 ml_/h, or a p0 2 difference between the fetal vein and the artery less than 60 mmHg, indicating inadequate perfusion overlap between the two circuits.
  • the control period was followed by an experimental period of four hours using a closed-closed configuration (i.e., re-circulation of the medium) of the perfusion system. The latter was initiated by replacing the medium of the maternal and fetal reservoirs and the addition of 3 mg/ml of BSA.
  • N027 in maternal and fetal samples were determined using a sensitive meso scale discovery (MSD) immunoassay with a lower limit of quantification of 5 ng/ml.
  • MSD sensitive meso scale discovery
  • This assay involved a sandwich format using an anti-idiotypic antibody pair; wherein the MSD plate was coated with an anti-idiotypic Ab followed by incubation with sample and revealed with the second biotinylated anti-idiotypic Ab followed by detection with MSD tagged streptavidin and addition of read buffer.
  • the concentration of antipyrine was determined using a FIPLC assay with UV detection at 260 nm after a liquid-liquid extraction.
  • the mean fetal transfer rate for antipyrine across fourteen experiments was 41 +2.8 %.
  • the mean fetal transfer rate for N027 across fourteen experiments was 0.0027+0.0021 % indicating very low levels of transfer. The results suggest that N027 could be used in methods of treating pregnant patients without causing fetal exposure.
  • the effect of M281 on the transfer of IgG was evaluated at concentrations selected to range across active serum concentrations expected at therapeutic doses ranging from 10 pg/ml, which is near the threshold for increased M281 clearance due to target- mediated disposition and related in M281 pharmacokinetics to the timeframe when the loss of full occupancy of FcRn receptors occurs; to 3000 pg/ml, concentration which is 2 to 3-fold above the Cmax at 60 mg/kg M281 , the highest dose evaluated in the first in human healthy volunteer study. Furthermore, this blockade of IgG transfer was also assessed using a positive control IVIg (polyclonal IgG mixture), which is a known competitive inhibitor of FcRn for IgG transfer.
  • Placental Perfusion Placentas from normal healthy term (38-40weeks) pregnancies were collected immediately following Cesarean-sectioned abdominal deliveries according to the approved study protocol. Placentas with any evidence of maternal infection, systemic disease, and drug or alcohol abuse during pregnancy were excluded from this study.
  • a large venous drain was connected to a peristaltic pump, which continuously removed the fluid from the chamber and either returned it to the maternal reservoir (closed circuit) or to a separate container (open circuit).
  • the flow rate of the perfusate medium in the fetal and maternal circuits was 3.0 and 12 mL/min, respectively.
  • the maternal perfusate was equilibrated with a gas mixture made of 95% 02, 5% C02, and the fetal perfusate with a mixture of 95% N2, 5% C02. All experiments were carried out at a temperature of 37 °C.
  • Each placental lobule was perfused for an initial control period of one hour to allow the tissue to stabilize to its new environment using open-open configuration of perfusion system. Perfusion was terminated if one of the following quality criteria was not met during the control period: i) volume loss in fetal circuit in excess of 3 mL/h; or ii) O pressure difference between fetal vein and artery less than 60 mmHg, indicating inadequate perfusion overlap between the two circuits.
  • test substance was co-transfused with a positive control, antipyrine (AP) at 100 pg/ml.
  • AP antipyrine
  • the perfused area was dissected from the adjoining placental tissue, weighed and pieces of perfused lobule were placed in 4% PFA for IHC analysis.
  • Humira® concentrations in all the maternal and fetal sample aliquots were determined using the sandwich ELISA with a lower limit of quantitation (LLOQ) of ⁇ 1 ng/ml.
  • LLOQ lower limit of quantitation
  • the transfer of Humira® from maternal to fetal reservoir was determined by the fetal transfer rate (FTR) which was calculated as below:
  • Antipyrine is a small molecule (188 Da), non-ionizable at pH 7.4 (pKa 1.4) and consequently transfers freely across the placenta via passive diffusion. Furthermore, AP is preferentially distributed into the aqueous maternal and fetal circuits with minimal retention in the tissue due to its low octanol/water partition coefficient, 0.33, as well as its minimal binding to plasma proteins and serum albumin. It has been extensively used in perfusion models as an internal permeability positive control to account for interplacental variations across different experiments.
  • Antipyrine concentrations were measured in samples using a modified HPLC method as described in previous reports (M0rck T. J. , Sorda G., Bechi N., Rasmussen B. S., Nielsen J. B., letta F., Rytting E., Mathiesen L, Paulesu L, Knudsen L. E. Placental transport and in vitro effects of Bisphenol A. Reproductive Toxicol. 2010; 30: 131-137).
  • the transfer of antipyrine from maternal to fetal reservoir was determined by the fetal transfer rate (FTR) which was calculated as below:
  • FTR fetal to maternal
  • the FTM ratio was ideally expected to be greater than 0.75 around 60-120 min; thus confirming placental integrity.
  • the protein was precipitated by 200 pi ice-cold acetonitrile containing 10 mI/ml of internal standard phenacetin to each 200 pi sample. The samples were centrifuged for 25 min at 8000 rpm, and the supernatants were analyzed by HPLC.
  • Antipyrine and phenacetin were analyzed using an Agilent 1200 HPLC system equipped with a UV detector.
  • the stationary phase used was a reverse phase C18 based column (Waters Atlantis T3, Atlantis T3 Column, 100A, 3 pm, 3 mm X 150 mm).
  • the column was also equipped with a guard cartridge (Waters T3, 3 pm, 2.1 mm X 150 mm) which was changed prior to start of each samples set.
  • the column and sample temperatures were maintained at 25 °C and 4 °C respectively.
  • the samples were run with a linear gradient ranging from 25-95% Methanol-Water over 14 min at a flow rate of 0.3 mL/min; the injection volume was 10 pL and detection was carried out using absorbance at 260 nm.
  • Placental transfer of Humira® was studied at a fixed concentration of 270 pg/ml.
  • a total of 8 experiments which maintained the placental integrity over experiment duration and met the quality criteria for successful perfusions such as antipyrine FTM ratio above 0.75 and volume loss from fetal reservoir no more than 3ml/h; are reported in Table 12. Oxygen transfer levels and consumption were also monitored for these experiments as markers for perfusion overlap and tissue viability, respectively.
  • Placental transfer of antipyrine over the course of these experiments is shown in FIG. 22 and the fetal to maternal (FTM) concentration ratio was calculated for each experiment at each time point as well as terminal endpoint. All experiments were observed to attain equilibrium (FTM ratio of 0.9-1 .0) within 60-180 min; and the mean ⁇ SD fetal to maternal FTM ratio at the terminal end point over 8 experiments was calculated to be 1 .03 ⁇ 0.1 1 ; indicating appropriate placental integrity over experiment duration. The maternal to fetal transfer levels of antipyrine were observed to >35% in all experiments, indicating a high degree of perfusion overlap for the reported experiments.
  • FTM fetal to maternal
  • Placental transfer of antipyrine over the course of these experiments is shown in FIG. 24 and the fetal to maternal (FTM) transfer ratio was calculated for each experiment at each of the time points as well as the terminal end point.
  • the mean ⁇ SD FTM ratio at the terminal end point over 8 experiments with antipyrine was calculated to be 1.1 ⁇ 0.11 (equilibrium attained in maternal and fetal circuits) indicating appropriate placental integrity over experiment duration.
  • the maternal to fetal transfer levels of antipyrine were observed to >35%, indicating a high degree of perfusion overlap for the reported experiments.
  • Placental transfer of Humira® in the presence of M281 over nine experiments is shown in FIG. 25.
  • the fetal transfer rate of Humira® over all 9 experiments reported in Table 13 was calculated to average around 0.07 ⁇ 0.01 % while the average terminal fetal concentrations ranged between 0.12 ⁇ 0.02 pg/mL.
  • Placental transfer of antipyrine over the course of these experiments is shown in FIG. 26 and the FTR was calculated for each experiment at the terminal end point. It is to be noted that PP38 was terminated at 5.5 hrs and hence the FTR was calculated after 5.5 hours as compared to 6h for the other experiments.
  • the mean ⁇ SD fetal to maternal (FTM) concentration ratio at the terminal end point over 5 experiments was calculated to be 1 .04 ⁇ 0.04 (equilibrium attained in maternal and fetal circuits) indicating appropriate placental integrity over experiment duration.
  • the maternal to fetal transfer levels of antipyrine were observed to >35%, indicating a high degree of perfusion overlap for the reported experiments.
  • Placental transfer of antipyrine for the experiments is shown in FIG. 28 and the FTM was calculated for each experiment at the all the individual time points as well as at terminal end point.
  • the mean ⁇ SD FTM for antipyrine over 4 experiments shown in Table 15 was calculated to be 1 .04 ⁇ 0.03 (equilibrium attained in maternal and fetal circuits) indicating appropriate placental integrity over experiment duration.
  • the maternal to fetal transfer levels of antipyrine were observed to be >35%, indicating a high degree of perfusion overlap for the reported experiments.
  • LME linear mixed effects
  • M281 (N027) was associated with a reduction in serum albumin levels in subjects. For example, a reduction to a maximum of about 20-25% below baseline was observed with a single 60 mg/kg dose and when multiple weekly15 and 30 mg/kg doses were administered.
  • the hypoalbuminemia was asymptomatic. It was not associated with proteinuria, edema or other adverse events.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Endocrinology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
PCT/US2018/065568 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof Ceased WO2019118791A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
KR1020257042733A KR20260008175A (ko) 2017-12-13 2018-12-13 FcRn 항체 및 이의 사용 방법
AU2018386193A AU2018386193B2 (en) 2017-12-13 2018-12-13 FcRn antibodies and methods of use thereof
JP2020532551A JP7420720B2 (ja) 2017-12-13 2018-12-13 FcRn抗体およびその使用方法
NZ765250A NZ765250A (en) 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof
EP18836751.0A EP3723802A1 (en) 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof
BR112020011310-7A BR112020011310A2 (pt) 2017-12-13 2018-12-13 anticorpos contra fcrn e seus métodos de uso
KR1020207019955A KR102904658B1 (ko) 2017-12-13 2018-12-13 FcRn 항체 및 이의 사용 방법
US16/771,147 US11773168B2 (en) 2017-12-13 2018-12-13 FcRn antibodies and methods of use thereof
SG11202005021PA SG11202005021PA (en) 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof
CN201880089334.7A CN111712259A (zh) 2017-12-13 2018-12-13 Fcrn抗体及其使用方法
CA3085751A CA3085751A1 (en) 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof
IL275070A IL275070A (en) 2017-12-13 2020-06-02 FCRN antibodies and methods of using them
US18/452,346 US20240158509A1 (en) 2017-12-13 2023-08-18 Fcrn antibodies and methods of use thereof
JP2023177190A JP7690538B2 (ja) 2017-12-13 2023-10-13 FcRn抗体およびその使用方法
JP2025089576A JP2025143252A (ja) 2017-12-13 2025-05-29 FcRn抗体およびその使用方法

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762598402P 2017-12-13 2017-12-13
US62/598,402 2017-12-13
US201862701354P 2018-07-20 2018-07-20
US62/701,354 2018-07-20

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/771,147 A-371-Of-International US11773168B2 (en) 2017-12-13 2018-12-13 FcRn antibodies and methods of use thereof
US18/452,346 Continuation US20240158509A1 (en) 2017-12-13 2023-08-18 Fcrn antibodies and methods of use thereof

Publications (1)

Publication Number Publication Date
WO2019118791A1 true WO2019118791A1 (en) 2019-06-20

Family

ID=65041911

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/065568 Ceased WO2019118791A1 (en) 2017-12-13 2018-12-13 Fcrn antibodies and methods of use thereof

Country Status (12)

Country Link
US (2) US11773168B2 (https=)
EP (1) EP3723802A1 (https=)
JP (3) JP7420720B2 (https=)
KR (2) KR102904658B1 (https=)
CN (1) CN111712259A (https=)
AU (1) AU2018386193B2 (https=)
BR (1) BR112020011310A2 (https=)
CA (1) CA3085751A1 (https=)
IL (1) IL275070A (https=)
NZ (1) NZ765250A (https=)
SG (1) SG11202005021PA (https=)
WO (1) WO2019118791A1 (https=)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021022249A1 (en) * 2019-08-01 2021-02-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
WO2021140202A1 (en) 2020-01-08 2021-07-15 argenx BV Methods for treating pemphigus disorders
WO2021257668A1 (en) * 2020-06-17 2021-12-23 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of gene therapy patients
WO2023135321A1 (en) * 2022-01-17 2023-07-20 argenx BV Methods for treating patients with an autoantibody-mediated disease
US11732047B2 (en) 2015-01-30 2023-08-22 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
US11773168B2 (en) 2017-12-13 2023-10-03 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
JP2023548858A (ja) * 2020-11-06 2023-11-21 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体及びその使用方法
WO2025008537A1 (en) 2023-07-05 2025-01-09 Ablynx Nv Improved fcrn antagonists for treatment of igg-related diseases and disorders
US12202900B2 (en) 2018-06-08 2025-01-21 argenx BV Compositions and methods for treating immune thrombocytopenia
US12240875B2 (en) 2017-12-08 2025-03-04 argenx BV Use of FCRN antagonists for treatment of generalized myasthenia gravis
WO2025057086A2 (en) 2023-09-11 2025-03-20 Momenta Pharmaceuticals, Inc. Pharmaceutical compositions of fcrn antibodies
US12344678B2 (en) 2022-06-15 2025-07-01 argenx BV FcRn/HSA binding molecules and methods of use
WO2025186787A1 (en) * 2024-03-08 2025-09-12 Momenta Pharmaceuticals, Inc. Compositions and methods for treating fetal and neonatal alloimmune thrombocytopenia
US12528867B2 (en) 2018-07-20 2026-01-20 Momenta Pharmaceuticals, Inc. FCRN antibody compositions

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20240182598A1 (en) * 2021-04-12 2024-06-06 Momenta Pharmaceuticals, Inc. Compositions and methods for treating pediatric myasthenia gravis
CN116234827A (zh) * 2021-09-03 2023-06-06 舒泰神(北京)生物制药股份有限公司 特异性识别FcRn的抗体及其应用
CN114129730A (zh) * 2021-09-16 2022-03-04 宁夏大学 FcRn抑制剂在制备降低炎症反应和/或防治结核病的试剂或药物中的应用
CN121909214A (zh) 2023-07-31 2026-04-21 玫帝托克斯股份有限公司 一种抗体及包含该抗体的用于治疗免疫疾病的药物组合物

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012167039A1 (en) * 2011-06-02 2012-12-06 Dyax Corp. Fc RECEPTOR BINDING PROTEINS
WO2016123521A2 (en) * 2015-01-30 2016-08-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
WO2016183352A1 (en) * 2015-05-12 2016-11-17 Syntimmune, Inc. Humanized affinity matured anti-fcrn antibodies
WO2018023136A1 (en) * 2016-07-29 2018-02-01 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof

Family Cites Families (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101721362B (zh) 2002-02-14 2018-07-03 中外制药株式会社 包含抗体的溶液制剂
CA2534973A1 (en) 2003-08-08 2005-02-17 The Research Foundation Of State University Of New York Anti-fcrn antibodies for treatment of auto/allo immune conditions
US7662928B2 (en) 2003-08-08 2010-02-16 The Research Foundation Of State University Of New York Anti-FcRn antibodies for treatment of auto/allo immune conditions
CN101124245A (zh) 2003-11-12 2008-02-13 比奥根艾迪克Ma公司 新生儿Fc受体(FcRn)-结合多肽变体、二聚体Fc结合蛋白及其相关方法
ES2569409T3 (es) 2005-03-08 2016-05-10 Pfizer Products Inc. Composiciones de anticuerpo anti-CTLA-4
CA2637929A1 (en) 2006-01-25 2007-08-02 The Research Foundation Of State University Of New York Anti-fcrn antibodies for treatement of auto/allo immune conditions
US20110059101A9 (en) 2006-03-13 2011-03-10 Ablynx N.V. Amino Acid Sequences Directed Against Il-6 And Polypetides Comprising The Same For The Treatment Of Diseases And Disorders Associated With Il-6 Mediated Signalling
WO2009131702A2 (en) 2008-04-25 2009-10-29 Dyax Corp. Antibodies against fcrn and use thereof
CN102549016B (zh) 2009-06-30 2015-05-06 研究发展基金会 免疫球蛋白fc多肽
ES2765874T3 (es) * 2011-05-25 2020-06-11 Innate Pharma Sa Anticuerpos anti-KIR para el tratamiento de trastornos inflamatorios
GB201208370D0 (en) 2012-05-14 2012-06-27 Ucb Pharma Sa Antibodies
US20130323242A1 (en) 2012-06-01 2013-12-05 Ophthotech Corp. Compositions comprising an anti-pdgf aptamer and a vegf antagonist
US9844594B2 (en) 2012-12-18 2017-12-19 Merck Sharp & Dohme Corp. Liquid formulations for an anti-TNF α antibody
ES2802274T3 (es) 2013-05-02 2021-01-18 Momenta Pharmaceuticals Inc Glicoproteínas sialiladas
KR101815265B1 (ko) 2013-06-20 2018-01-04 한올바이오파마주식회사 FcRn 특이적 인간 항체 및 이를 포함하는 자가면역 질환 치료용 조성물
PL3137504T3 (pl) 2014-04-30 2023-10-16 Hanall Biopharma Co., Ltd. Przeciwciało wiążące się z FcRn do leczenia chorób autoimmunologicznych
JP6913527B2 (ja) 2017-06-22 2021-08-04 株式会社小松製作所 油圧ポンプおよびモータ
CA3081144A1 (en) 2017-12-08 2019-06-13 Argenx Bvba Use of fcrn antagonists for treatment of generalized myasthenia gravis
KR102904658B1 (ko) 2017-12-13 2025-12-29 모멘타 파머슈티컬스 인코포레이티드 FcRn 항체 및 이의 사용 방법
WO2019160979A1 (en) 2018-02-13 2019-08-22 The Brigham And Women's Hospital, Inc. Therapeutic fcrn-based bispecific monoclonal antibodies
WO2020023310A1 (en) 2018-07-20 2020-01-30 Williams Eva Compositions of fcrn antibodies and methods of use thereof
CN113518783A (zh) 2018-07-20 2021-10-19 动量制药公司 FcRn抗体组合物
CN113646051A (zh) 2018-10-16 2021-11-12 Ucb生物制药有限责任公司 重症肌无力的治疗方法
EP4007605A4 (en) 2019-08-01 2023-08-16 Momenta Pharmaceuticals, Inc. ANTI-FCRN ANTIBODIES AND METHODS OF USE THEREOF
IL302516A (en) 2020-11-06 2023-07-01 Janssen Biotech Inc FCRN antibodies and methods of using them

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012167039A1 (en) * 2011-06-02 2012-12-06 Dyax Corp. Fc RECEPTOR BINDING PROTEINS
WO2016123521A2 (en) * 2015-01-30 2016-08-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
WO2016183352A1 (en) * 2015-05-12 2016-11-17 Syntimmune, Inc. Humanized affinity matured anti-fcrn antibodies
WO2018023136A1 (en) * 2016-07-29 2018-02-01 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof

Non-Patent Citations (18)

* Cited by examiner, † Cited by third party
Title
"Process Scale Purification of Antibodies", 2009, JOHN WILEY & SONS, INC.
"Recombinant Gene Expression: Reviews and Protocols (Methods in Molecular Biology)", 20 July 2004, HUMANA PRESS
"Therapeutic Peptides and Proteins: Formulation, Processing and Delivery Systems", 2006, CRC PRESS
"Therapeutic Proteins: Methods and Protocols (Methods in Molecular Biology)", 28 June 2012, HUMANA PRESS
BJ KOBRIN ET AL: "A V region mutation in a phosphocholine-binding monoclonal antibody results in loss of antigen binding", THE JOURNAL OF IMMUNOLOGY, 15 March 1991 (1991-03-15), UNITED STATES, pages 2017, XP055277424, Retrieved from the Internet <URL:http://www.jimmunol.org/content/146/6/2017.full.pdf> *
CASIPIT C L ET AL: "IMPROVING THE BINDING AFFINITY OF AN ANTIBODY USING MOLECULAR MODELING AND SITE-DIRECTED MUTAGENESIS", PROTEIN SCIENCE, WILEY, US, vol. 7, 1 August 1998 (1998-08-01), pages 1671 - 1680, XP001007633, ISSN: 0961-8368 *
CHIEN N C ET AL: "Significant structural and functional change of an antigen-binding site by a distant amino acid substitution: Proposal of a structural mechanism", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, NATIONAL ACADEMY OF SCIENCES, US, vol. 86, no. 14, 1 January 1989 (1989-01-01), pages 5532 - 5536, XP009187738, ISSN: 0027-8424, DOI: 10.1073/PNAS.86.14.5532 *
HIROYUKI KOBAYASHI ET AL: "Tryptophan H33 plays an important role in pyrimidine (6-4) pyrimidone photoproduct binding by a high-affinity antibody A variety of techniques have been used to examine the", PROTEIN ENGINEERING, 1 January 1999 (1999-01-01), pages 879 - 884, XP055364172, Retrieved from the Internet <URL:https://academic.oup.com/peds/article-pdf/12/10/879/9908089/120879.pdf> *
JOEL F. SCHILDBACH ET AL: "Modulation of antibody affinity by a non-contact residue", PROTEIN SCIENCE, vol. 2, no. 2, 1 February 1993 (1993-02-01), pages 206 - 214, XP055103868, ISSN: 0961-8368, DOI: 10.1002/pro.5560020209 *
JUNGHANS ET AL., PROC NATL ACAD SCI USA, vol. 93, 1996, pages 5512
KABAT: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
LI CONGLEI ET AL: "The maternal immune response to fetal platelet GPIb alpha causes frequent miscarriage in mice that can be prevented by intravenous IgG and anti-FcRn therapies", JOURNAL OF CLINICAL INVESTIGATION, vol. 121, no. 11, November 2011 (2011-11-01), pages 4537 - 4547, XP002790138 *
LING LEONA ET AL: "32: M281, an anti-FcRn antibody, inhibits IgG transfer in a human ex-vivo placental perfusion model", AMERICAN JOURNAL OF OBSTETRICS & GYNECOLOGY, vol. 220, no. 1, January 2019 (2019-01-01), XP085565572, ISSN: 0002-9378, DOI: 10.1016/J.AJOG.2018.11.036 *
MØRCK T. J.; SORDA G.; BECHI N.; RASMUSSEN B. S.; NIELSEN J. B.; LETTA F.; RYTTING E.; MATHIESEN L.; PAULESU L; KNUDSEN L. E.: "Placental transport and in vitro effects of Bisphenol A", REPRODUCTIVE TOXICOL, vol. 30, 2010, pages 131 - 137, XP027107274
NANOVSKAYA T; DESHMUKH S; BROOKS M; AHMED MS: "Transplacental transfer and metabolism of buprenorphine", J PHARMACOL EXP THER, vol. 300, no. 1, 2002, pages 26 - 33
PANKA D J ET AL: "Defining the structural correlates responsible for loss of arsonate affinity in an Id<CR> antibody isolated from an autoimmune mouse", MOLECULAR IMMUNOLOGY, PERGAMON, GB, vol. 30, no. 11, 1 August 1993 (1993-08-01), pages 1013 - 1020, XP023969623, ISSN: 0161-5890, [retrieved on 19930801], DOI: 10.1016/0161-5890(93)90126-V *
RUDIKOFF S ET AL: "Single amino acid substitution altering antigen-binding specificity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, NATIONAL ACADEMY OF SCIENCES, US, vol. 79, 1 March 1982 (1982-03-01), pages 1979 - 1983, XP007901436, ISSN: 0027-8424, DOI: 10.1073/PNAS.79.6.1979 *
WINKLER K ET AL: "Changing the antigen binding specificity by single point mutations of an anti-p24 (HIV-1) antibody", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 165, no. 8, 15 October 2000 (2000-10-15), pages 4505 - 4514, XP002579393, ISSN: 0022-1767 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732047B2 (en) 2015-01-30 2023-08-22 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
US12240875B2 (en) 2017-12-08 2025-03-04 argenx BV Use of FCRN antagonists for treatment of generalized myasthenia gravis
US11773168B2 (en) 2017-12-13 2023-10-03 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
US12202900B2 (en) 2018-06-08 2025-01-21 argenx BV Compositions and methods for treating immune thrombocytopenia
US12528867B2 (en) 2018-07-20 2026-01-20 Momenta Pharmaceuticals, Inc. FCRN antibody compositions
WO2021022249A1 (en) * 2019-08-01 2021-02-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
JP2022542430A (ja) * 2019-08-01 2022-10-03 ヤンセン バイオテツク,インコーポレーテツド Fcrn抗体およびその使用の方法
JP2025138661A (ja) * 2019-08-01 2025-09-25 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体およびその使用の方法
EP4454711A2 (en) 2020-01-08 2024-10-30 argenx BV Methods for treating pemphigus disorders
US12403175B2 (en) 2020-01-08 2025-09-02 argenx BV Methods for treating pemphigus disorders
WO2021140202A1 (en) 2020-01-08 2021-07-15 argenx BV Methods for treating pemphigus disorders
WO2021257668A1 (en) * 2020-06-17 2021-12-23 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of gene therapy patients
JP2023548858A (ja) * 2020-11-06 2023-11-21 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体及びその使用方法
WO2023135321A1 (en) * 2022-01-17 2023-07-20 argenx BV Methods for treating patients with an autoantibody-mediated disease
US12344678B2 (en) 2022-06-15 2025-07-01 argenx BV FcRn/HSA binding molecules and methods of use
US12565538B2 (en) 2022-06-15 2026-03-03 argenx BV FCRN/antigen-binding molecules and methods of use
WO2025008537A1 (en) 2023-07-05 2025-01-09 Ablynx Nv Improved fcrn antagonists for treatment of igg-related diseases and disorders
WO2025057086A2 (en) 2023-09-11 2025-03-20 Momenta Pharmaceuticals, Inc. Pharmaceutical compositions of fcrn antibodies
WO2025186787A1 (en) * 2024-03-08 2025-09-12 Momenta Pharmaceuticals, Inc. Compositions and methods for treating fetal and neonatal alloimmune thrombocytopenia

Also Published As

Publication number Publication date
KR102904658B1 (ko) 2025-12-29
AU2018386193A8 (en) 2020-07-02
CA3085751A1 (en) 2019-06-20
JP2021506786A (ja) 2021-02-22
CN111712259A (zh) 2020-09-25
JP2024016042A (ja) 2024-02-06
US11773168B2 (en) 2023-10-03
SG11202005021PA (en) 2020-07-29
JP2025143252A (ja) 2025-10-01
US20220064290A1 (en) 2022-03-03
AU2018386193B2 (en) 2025-04-24
JP7420720B2 (ja) 2024-01-23
US20240158509A1 (en) 2024-05-16
KR20200098604A (ko) 2020-08-20
EP3723802A1 (en) 2020-10-21
AU2018386193A1 (en) 2020-06-25
JP7690538B2 (ja) 2025-06-10
KR20260008175A (ko) 2026-01-15
IL275070A (en) 2020-07-30
NZ765250A (en) 2026-02-27
BR112020011310A2 (pt) 2020-11-17

Similar Documents

Publication Publication Date Title
US20240158509A1 (en) Fcrn antibodies and methods of use thereof
US20230049725A1 (en) FcRn Antibodies and Methods of Use Thereof
CN107567460B (zh) Fcrn抗体及其使用方法
HK40104376A (en) Fcrn antibodies and methods of use thereof
CA2972822C (en) Fcrn antibodies and methods of use thereof
HK40002836B (en) Fcrn antibodies and methods of use thereof
HK40002836A (en) Fcrn antibodies and methods of use thereof
BR122025025099A2 (pt) Anticorpos contra fcrn, usos dos mesmos e composições
HK1247218A1 (en) Fcrn antibodies and methods of use thereof
HK1247218B (en) Fcrn antibodies and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18836751

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3085751

Country of ref document: CA

Ref document number: 2020532551

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018386193

Country of ref document: AU

Date of ref document: 20181213

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207019955

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018836751

Country of ref document: EP

Effective date: 20200713

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020011310

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112020011310

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200605