WO2019071206A1 - METHODS OF DETECTING TRANSTHYRETIN - Google Patents
METHODS OF DETECTING TRANSTHYRETIN Download PDFInfo
- Publication number
- WO2019071206A1 WO2019071206A1 PCT/US2018/054723 US2018054723W WO2019071206A1 WO 2019071206 A1 WO2019071206 A1 WO 2019071206A1 US 2018054723 W US2018054723 W US 2018054723W WO 2019071206 A1 WO2019071206 A1 WO 2019071206A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ttr
- antibody
- misfolded
- reporter
- reporter antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/56—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
- A61K31/575—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of three or more carbon atoms, e.g. cholane, cholestane, ergosterol, sitosterol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
- A61K31/192—Carboxylic acids, e.g. valproic acid having aromatic groups, e.g. sulindac, 2-aryl-propionic acids, ethacrynic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/42—Oxazoles
- A61K31/423—Oxazoles condensed with carbocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/60—Salicylic acid; Derivatives thereof
- A61K31/603—Salicylic acid; Derivatives thereof having further aromatic rings, e.g. diflunisal
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/65—Tetracyclines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/711—Natural deoxyribonucleic acids, i.e. containing only 2'-deoxyriboses attached to adenine, guanine, cytosine or thymine and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/0004—Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/62—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
- G01N21/66—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light electrically excited, e.g. electroluminescence
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/75—Systems in which material is subjected to a chemical reaction, the progress or the result of the reaction being investigated
- G01N21/76—Chemiluminescence; Bioluminescence
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54306—Solid-phase reaction mechanisms
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54366—Apparatus specially adapted for solid-phase testing
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/566—Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4728—Details alpha-Glycoproteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2458/00—Labels used in chemical analysis of biological material
- G01N2458/30—Electrochemically active labels
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/32—Cardiovascular disorders
- G01N2800/325—Heart failure or cardiac arrest, e.g. cardiomyopathy, congestive heart failure
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- Transthyretin is one of the many proteins that are known to misfold and aggregate (e.g., undergo amyloidogenesis).
- Transthyretin-mediated amyloidosis encompasses two forms of disease: familial disease arising from misfolding of a mutated or variant TTR, and a sporadic, non-genetic disease caused by misfolding and aggregation of wild-type TTR.
- familial disease arising from misfolding of a mutated or variant TTR
- sporadic, non-genetic disease caused by misfolding and aggregation of wild-type TTR.
- the process of TTR amyloidogenesis can cause pathology in the nervous system and/or heart, as well as in other tissues.
- the invention provides a method of detecting misfolded transthyretin (TTR) in a biological sample, the method comprising: (a) contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 89-97 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and (b) detecting the reporter antibody that forms a sandwich complex in step (a), if any, to indicate presence or absence of the misfolded TTR.
- TTR transthyretin
- the biological sample is from a hereditary ATTR patient.
- the biological sample is from a hereditary ATTR patient carrying a mutation selected from the group consisting of V30M, Yl 14C, G47R, S50I, T49S, F33V, A45T, E89K, E89Q, and V122I.
- the mutation is selected from the group consisting of V30M, Yl 14C, and S50I.
- the mutation is V30M.
- the mutation is Yl 14C.
- the mutation is S50I.
- the mutation is E89K.
- the mutation is E89Q.
- the capture antibody is 9D5.
- the capture antibody is 9D5 and the reporter antibody is a polyclonal anti-TTR antibody.
- the reporter antibody is 18C5, 8C3, 7G7, AD7F6, RT24, NI-301.35G11, MFD101, MDF102, MFD103, MFD105, MFD107, MFD108, MFD109, MFD111, MFD114, or a chimeric version or humanized version thereof, or a polyclonal anti-TTR antibody.
- the capture antibody is 9D5 and the reporter antibody is 18C5, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is 8C3, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is 7G7, or a chimeric version or humanized version thereof.
- the capture antibody is 9D5 and the reporter antibody is AD7F6, or a chimeric version or humanized version thereof.
- the capture antibody is 9D5 and the reporter antibody is RT24, or a chimeric version or humanized version thereof.
- the capture antibody is 9D5 and the reporter antibody is NI-301.35G11, or a chimeric version or humanized version thereof.
- the capture antibody is 9D5 and the reporter antibody is MFDIOI, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MDF102, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is
- the capture antibody is 9D5 and the reporter antibody is MFD 105, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MFD 107, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MFD 108, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MFD 109, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MFD111, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 9D5 and the reporter antibody is MFDl 14, or a chimeric version or humanized version thereof.
- the reporter antibody is an antibody that binds within residues 101-109, 118-122, 115-124, 53-63, 54-61, 36-49, 49-61, 109-121, 30-66, 70-127, 80-127, 90- 127, 100-127, 110-127, or 115-127 of TTR.
- Some such methods detect misfolded TTR including an E89K substitution. Some such methods detect misfolded TTR including an E89Q substitution.
- the biological sample is a first aliquot of a collected sample and the method further comprises repeating step (a) and (b) on a second aliquot of the collected sample further comprising a test antibody that competes with the capture antibody for binding to TTR, wherein reduced reporter antibody forming the sandwich complex on repeating the steps provides an indication of the test antibody's ability to bind to misfolded TTR.
- the test antibody is 14G8 or a chimeric or humanized form thereof
- the capture antibody is 9D5
- the reporter antibody is a polyclonal anti-TTR antibody.
- the test antibody is a humanized form of 14G8.
- the invention provides a method of determining in vivo target engagement of a test antibody administered to a subject, which target is an epitope within residues 89-97 of misfolded transthyretin (mis-TTR) by detecting the mis-TTR remaining in a biological sample from the subject treated with the test antibody, the method comprising: (a) contacting the biological sample with a capture antibody that specifically binds to an epitope within residues 89-97 and a reporter antibody that specifically binds to a different epitope within TTR from that of the capture antibody; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and (b) detecting the reporter antibody forming a sandwich complex in step (a), if any, to indicate presence or absence of the misfolded TTR.
- mis-TTR misfolded transthyretin
- the biological sample is from a hereditary ATTR patient.
- the biological sample is from a hereditary ATTR patient carrying a mutation selected from the group consisting of V30M, Yl 14C, G47R, S50I, T49S, F33V, A45T, E89K, E89Q, and V122I.
- the mutation is selected from the group consisting of V30M, Yl 14C, and S50I.
- the mutation is V30M.
- the mutation is Yl 14C.
- the mutation is S50I.
- the mutation is E89K.
- the mutation is E89Q.
- a reduction of detection of misfolded TTR in the treated subject relative to the detection of misfolded TTR in a biological sample from an untreated subject correlates with positive target engagement and treating the subject with the same or a lesser amount of the test antibody.
- the treated subject and the untreated subject are the same individual.
- the capture antibody is 9D5 and the reporter antibody is 9D5, wherein the capture antibody and the reporter antibody have different labels.
- the capture antibody is 9D5 and the reporter antibody is 14G8.
- the capture antibody is 9D5 and the reporter antibody is 5A1.
- the capture antibody is 9D5 and the reporter antibody is 6C1.
- the reporter antibody competes for binding with the capture antibody for binding multimeric misfolded transthyretin.
- the reporter antibody has an electrochemiluminescent label and is detected by electrochemiluminescence.
- the capture antibody has a biotin label.
- the methods are performed qualitatively. In an embodiment, the methods are performed quantitatively to indicate an absolute or relative amount of the misfolded TTR.
- the capture antibody is bound to a solid phase before the contacting step.
- the capture antibody is attached to the solid phase via a linker.
- the solid phase comprises at least one electrode.
- Some such methods further comprise comparing a signal from the reporter antibody with a signal from the reporter antibody in a control sample containing a known amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- Some such methods further comprise comparing a signal from the reporter antibody from a calibration curve of signal versus amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- a signal from the reporter antibody is proportional to the amount of misfolded TTR in the sample.
- the sample is a sample from a human.
- the sample is a body fluid.
- the sample is plasma of a human.
- the presence of misfolded TTR is used to diagnose a subject from whom the sample was obtained with a transthyretin-mediated amyloidosis.
- the transthyretin-mediated amyloidosis is a familial transthyretin amyloidosis or a sporadic wild- type transthyretin amyloidosis.
- the subject has been identified as at risk of a familial transthyretin amyloidosis based on genetic testing.
- the subject does not show symptoms of a familial transthyretin amyloidosis. In an embodiment, the subject does not have polyneuropathy or cardiomyopathy.
- the familial transthyretin amyloidosis is familial amyloid cardiomyopathy (FAC), familial amyloid polyneuropathy (FAP), or central nervous system selective amyloidosis (CNSA).
- the biological sample is from a patient receiving treatment for a transthyretin-mediated amyloidosis.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising comparing the amount of misfolded TTR detected in the subject previously treated for transthyretin mediated amyloidosis with the amount of misfolded TTR detected in the subject prior to treatment or during an earlier stage of treatment; and (a) increasing the dose or frequency of administration of the prior treatment if the amount of misfolded TTR is the same or greater than that previously detected; or (b) decreasing the dose or frequency of administration of the prior treatment or discontinuing the prior treatment if the amount of misfolded TTR is less than that previously detected.
- the misfolded TTR is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 89-97 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- the prior treatment is by intravenous administration of an anti- TTR antibody and if the amount of misfolded TTR is less than that previously detected, the prior treatment is discontinued and replaced with treatment with a TTR stabilizer, antisense oligonucleotide based therapy, RNA interference therapy or combination therapy with doxycycline and tauroursodeoxycholic acid.
- the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal. In some such methods, the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen.
- the RNAi based therapeutic is patisiran or revusiran.
- the anti-TTR antibody is 14G8.
- the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal.
- the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen.
- the RNAi based therapeutic is patisiran or revusiran.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising (a) comparing the amount of reporter antibody binding in a sample from a subject before initiating treatment for transthyretin mediated amyloidosis with the amount of reporter antibody binding detected in the subject after initiating treatment; and (b) increasing the dose or frequency of administration of the treatment if the amount of reporter antibody binding is the same or greater than that previously detected; or (c) decreasing the dose or frequency of administration of the treatment or discontinuing the treatment if the amount of reporter antibody binding is less than that previously detected.
- the reporter antibody binding is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 89-97 of TTR and a reporter antibody that specifically binds to a different epitope of TTR;
- step (a) wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- a transthyretin-mediated amyloidosis is distinguished from amyloid light-chain (AL) amyloidosis.
- the sample is from a transgenic mouse with a transgene expressing human TTR.
- the invention provides a method of determining a ratio of the level of total multimeric misfolded transthyretin (TTR) to the level of total misfolded TTR in a biological sample; the method comprising:
- the invention provides a method of detecting misfolded transthyretin (TTR) in a biological sample, the method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- the capture antibody is 18C5.
- the capture antibody is 18C5 and the reporter antibody is a polyclonal anti-TTR antibody.
- the reporter antibody is 9D5, 14G8, 5A1, 6C1, 8C3, 7G7, AD7F6, RT24, NI- 301.35G11, MFD101, MDF102, MFD103, MFD105, MFD107, MFD108, MFD109, MFD111, MFD 114, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 9D5, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 14G8, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 5A1, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 6C1, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 8C3, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 7G7, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is AD7F6, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is RT24, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is NI-301.35G11, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is
- the capture antibody is 18C5 and the reporter antibody is MDF102, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD103, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 105, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 107, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 108, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is MFD 109, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD111, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD114, or a chimeric version or humanized version thereof.
- the reporter antibody is an antibody that binds within residues 89- 97, 118-122, 115-124, 53-63, 54-61, 36-49, 49-61, 109-121, 30-66, 70-127, 80-127, 90-127, 100- 127, 110-127, or 115-127 of TTR.
- the invention provides a method of detecting multimeric misfolded transthyretin (TTR) in a biological sample, the method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 and a reporter antibody that specifically binds to an epitope within residues 101-109 of TTR; wherein if multimeric misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the multimeric misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the multimeric misfolded TTR in step (a), if any, to indicate presence or absence of the multimeric misfolded TTR.
- TTR multimeric misfolded transthyretin
- the capture antibody is 18C5 and the reporter antibody is 18C5, wherein the capture antibody and the reporter antibody have different labels.
- the reporter antibody competes for binding with the capture antibody for binding multimeric misfolded transthyretin.
- the reporter antibody has an electrochemiluminescent label and is detected by electrochemiluminescence.
- the capture antibody has a biotin label.
- the methods are performed qualitatively. In an embodiment, the methods are performed quantitatively to indicate an absolute or relative amount of the misfolded TTR.
- the capture antibody is bound to a solid phase before the contacting step.
- the capture antibody is attached to the solid phase via a linker.
- the solid phase comprises at least one electrode.
- Some such methods further comprise comparing a signal from the reporter antibody with a signal from the reporter antibody in a control sample containing a known amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- Some such methods further comprise comparing a signal from the reporter antibody from a calibration curve of signal versus amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- a signal from the reporter antibody is proportional to the amount of misfolded TTR in the sample.
- the sample is from a human.
- the sample is a body fluid.
- the sample is plasma of a human.
- the presence of misfolded TTR is used to diagnose a subject from whom the sample was obtained with a transthyretin-mediated amyloidosis.
- the transthyretin-mediated amyloidosis is a familial transthyretin amyloidosis or a sporadic wild- type transthyretin amyloidosis.
- the subject has been identified as at risk of a familial transthyretin amyloidosis based on genetic testing.
- the subject does not show symptoms of a familial transthyretin amyloidosis. In an embodiment, the subject does not have polyneuropathy or cardiomyopathy.
- the familial transthyretin amyloidosis is familial amyloid
- FAC familial amyloid polyneuropathy
- CNSA central nervous system selective amyloidosis
- the biological sample is from a patient receiving treatment for a transthyretin-mediated amyloidosis.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising comparing the amount of misfolded TTR in a sample from a subject previously treated for transthyretin mediated amyloidosis with the amount of misfolded TTR detected in the subject prior to treatment or during an earlier stage of treatment; and increasing the dose or frequency of administration of the prior treatment if the amount of misfolded TTR is the same or greater than that previously detected; or decreasing the dose or frequency of administration of the prior treatment or discontinuing the prior treatment if the amount of misfolded TTR is less than that previously detected.
- the misfolded TTR is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- the prior treatment is by intravenous administration of an anti- TTR antibody and if the amount of misfolded TTR is less than that previously detected, the prior treatment is discontinued and replaced with treatment with a TTR stabilizer, antisense oligonucleotide based therapy, RNA interference therapy or combination therapy with doxycycline and tauroursodeoxycholic acid.
- the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal.
- the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen.
- the RNAi based therapeutic is patisiran or revusiran.
- the anti-TTR antibody is 14G8. In some such methods, the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal. In some such methods, the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen. In some such methods, the RNAi based therapeutic is patisiran or revusiran.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising (a) comparing the amount of reporter antibody binding in a sample from a subject before initiating treatment for transthyretin mediated amyloidosis with the amount of reporter antibody binding detected in the subject after initiating treatment; and (b)increasing the dose or frequency of administration of the treatment if the amount of reporter antibody binding is the same or greater than that previously detected; or (c) decreasing the dose or frequency of administration of the treatment or discontinuing the treatment if the amount of reporter antibody binding is less than that previously detected.
- the reporter antibody binding is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- a transthyretin-mediated amyloidosis is distinguished from amyloid light-chain (AL) amyloidosis.
- the sample is from a transgenic mouse with a transgene expressing human TTR.
- the invention provides a method of determining a ratio of the level of total multimeric misfolded transthyretin (TTR) to the level of total misfolded TTR in a biological sample; the method comprising:
- step (ii) detecting the reporter antibody bound to the misfolded TTR in step (i), if any, to indicate presence or absence of the misfolded TTR;
- step (ii) detecting the reporter antibody bound to the multimeric misfolded TTR in step (a), if any, to indicate presence or absence of the multimeric misfolded TTR.
- the invention provides a method of detecting misfolded transthyretin (TTR) in a biological sample, the method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- TTR transthyretin
- the biological sample is from a hereditary ATTR patient.
- the biological sample is from a hereditary ATTR patient carrying a mutation selected from the group consisting of V30M, Yl 14C, and S50I.
- the mutation is V30M.
- the mutation is Yl 14C.
- the mutation is S50I.
- the capture antibody is 18C5.
- the capture antibody is 18C5 and the reporter antibody is a polyclonal anti-TTR antibody.
- the reporter antibody is 9D5, 14G8, 5A1, 6C1, 8C3, 7G7, AD7F6, RT24, NI- 301.35G11, MFD101, MDF102, MFD103, MFD105, MFD107, MFD108, MFD109, MFD111, MFD 114, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 9D5, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 14G8, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 5A1, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 6C1, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 8C3, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is 7G7, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is AD7F6, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is RT24, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is NI-301.35G11, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is
- the capture antibody is 18C5 and the reporter antibody is MDF102, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD103, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 105, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 107, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFD 108, or a chimeric version or humanized version thereof.
- the capture antibody is 18C5 and the reporter antibody is MFD 109, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFDl 11, or a chimeric version or humanized version thereof. In some such methods, the capture antibody is 18C5 and the reporter antibody is MFDl 14, or a chimeric version or humanized version thereof.
- the reporter antibody is an antibody that binds within residues 89- 97, 118-122, 115-124, 53-63, 54-61, 36-49, 49-61, 109-121, 30-66, 70-127, 80-127, 90-127, 100- 127, 110-127, or 115-127 of TTR.
- the invention provides a method of determining in vivo target engagement of a test antibody administered to a subject, which target is an epitope within residues 101-109 of misfolded transthyretin (mis-TTR) by detecting the mis-TTR remaining in a biological sample from the subject treated with the test antibody, the method comprising: (a) contacting the biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 and a reporter antibody that specifically binds to a different epitope within TTR from that of the capture antibody; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and (b) detecting the reporter antibody forming a sandwich complex in step (a), if any, to indicate presence or absence of the misfolded TTR.
- mis-TTR misfolded transthyretin
- the biological sample is from a hereditary ATTR patient.
- the biological sample is from a hereditary ATTR patient carrying a mutation selected from the group consisting of V30M, Yl 14C, and S50I.
- the mutation is V30M.
- the mutation is Yl 14C.
- the mutation is S50I.
- the capture antibody is 18C5, wherein the capture antibody and the reporter antibody have different labels.
- the reporter antibody competes for binding with the capture antibody for binding multimeric misfolded transthyretin.
- the reporter antibody has an electrochemiluminescent label and is detected by electrochemiluminescence.
- the capture antibody has a biotin label.
- the methods are performed qualitatively. In an embodiment, the methods are performed quantitatively to indicate an absolute or relative amount of the misfolded TTR.
- the capture antibody is bound to a solid phase before the contacting step.
- the capture antibody is attached to the solid phase via a linker.
- the solid phase comprises at least one electrode.
- Some such methods further comprise comparing a signal from the reporter antibody with a signal from the reporter antibody in a control sample containing a known amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- Some such methods further comprise comparing a signal from the reporter antibody from a calibration curve of signal versus amount of misfolded TTR to determine the amount of misfolded TTR in the sample.
- a signal from the reporter antibody is proportional to the amount of misfolded TTR in the sample.
- the sample is from a human.
- the sample is a body fluid.
- the sample is plasma of a human.
- the presence of misfolded TTR is used to diagnose a subject from whom the sample was obtained with a transthyretin-mediated amyloidosis.
- the transthyretin-mediated amyloidosis is a familial transthyretin amyloidosis or a sporadic wild- type transthyretin amyloidosis.
- the subject has been identified as at risk of a familial transthyretin amyloidosis based on genetic testing.
- the subject does not show symptoms of a familial transthyretin amyloidosis. In an embodiment, the subject does not have polyneuropathy or cardiomyopathy.
- the familial transthyretin amyloidosis is familial amyloid
- FAC familial amyloid polyneuropathy
- CNSA central nervous system selective amyloidosis
- the biological sample is from a patient receiving treatment for a transthyretin-mediated amyloidosis.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising comparing the amount of misfolded TTR in a sample from a subject previously treated for transthyretin mediated amyloidosis with the amount of misfolded TTR detected in the subject prior to treatment or during an earlier stage of treatment; and increasing the dose or frequency of administration of the prior treatment if the amount of misfolded TTR is the same or greater than that previously detected; or decreasing the dose or frequency of administration of the prior treatment or discontinuing the prior treatment if the amount of misfolded TTR is less than that previously detected.
- the misfolded TTR is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- the prior treatment is by intravenous administration of an anti- TTR antibody and if the amount of misfolded TTR is less than that previously detected, the prior treatment is discontinued and replaced with treatment with a TTR stabilizer, antisense oligonucleotide based therapy, RNA interference therapy or combination therapy with doxycycline and tauroursodeoxycholic acid.
- the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal.
- the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen.
- the RNAi based therapeutic is patisiran or revusiran.
- the anti-TTR antibody is 14G8. In some such methods, the subject no longer receives treatment with the anti-TTR antibody.
- the TTR tetramer stabilizer is tafamidis or diflunisal. In some such methods, the TTR tetramer stabilizer is diflunisal.
- the antisense oligonucleotide based therapeutic is inotersen. In some such methods, the RNAi based therapeutic is patisiran or revusiran.
- the invention provides a method of adjusting treatment of a subject with a transthyretin-mediated amyloidosis, comprising comparing the amount of reporter antibody binding detected by the method of claim 46 in a sample from a subject before initiating treatment for transthyretin mediated amyloidosis with the amount of reporter antibody binding detected in the subject after initiating treatment; and increasing the dose or frequency of administration of the treatment if the amount of reporter antibody binding is the same or greater than that previously detected; or decreasing the dose or frequency of administration of the treatment or discontinuing the treatment if the amount of reporter antibody binding is less than that previously detected.
- the misfolded TTR is detected by a method comprising contacting a biological sample with a capture antibody that specifically binds to an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and detecting the reporter antibody that binds to the misfolded TTR in step (a), if any, to indicate presence or absence of the misfolded TTR.
- a transthyretin-mediated amyloidosis is distinguished from amyloid light-chain (AL) amyloidosis.
- the sample is from a transgenic mouse with a transgene expressing human TTR.
- the invention provides a method of determining a ratio of the level of total multimeric misfolded transthyretin (TTR) to the level of total misfolded TTR in a biological sample; the method comprising:
- step (ii) detecting the reporter antibody bound to the misfolded TTR in step (i), if any, to indicate presence or absence of the misfolded TTR;
- step (ii) detecting the reporter antibody bound to the multimeric misfolded TTR in step (a), if any, to indicate presence or absence of the multimeric misfolded TTR.
- FIG. 1 depicts the results of a sandwich immunoassay employing the Meso Scale
- MSD Multimedia Substyrepentylcholine Discovery
- TTR transthyretin-mediated amyloidosis
- STD electrochemiluminescence platform showing that 9D5 detects elevated misfolded TTR in plasma samples from transthyretin-mediated amyloidosis (ATTR) patients that had not undergone a liver transplant, in an assay using a polyclonal anti-TTR reporter antibody.
- FIG. 2 depicts results of an ex vivo target engagement assay, using a 9D5 capture antibody and a polyclonal anti-TTR reporter antibody, showing that ml4G8 reduces levels of free misfolded TTR when spiked into patient plasma.
- FIG. 3 depicts the results of a sandwich immunoassay employing the Meso Scale
- MSD Multimedia Substyboditivossay
- FIG. 4 depicts results of a Western blot experiment showing that 18C5 has strong reactivity toward denatured TTR monomer, minor reactivity toward denatured dimer, and very weak reactivity toward native TTR species.
- FIG. 5 depicts results of a Western blot experiment showing that a commercial TTR antibody could not distinguish between native versus denatured TTR and showed very strong reactivity toward monomeric as well as dimeric native and denatured TTR
- FIG. 6 depicts the results of a sandwich immunoassay employing the Meso Scale
- MSD MSD electrochemiluminescence platform showing that 18C5 detects elevated misfolded TTR in plasma samples from transthyretin-mediated amyloidosis (ATTR) patients that had not undergone a liver transplant.
- FIG. 7 depicts the results of a sandwich immunoassay employing the Meso Scale
- MSD Multimeric misfolded TTR in plasma samples from transthyretin-mediated amyloidosis (ATTR) patients that had not undergone a liver transplant.
- FIG. 8 depicts the results of a Western blot experiment showing that 9D5 detects elevated levels of mis-TTR (misfolded TTR monomers and oligomers) in plasma from hereditary ATTR patients.
- mis-TTR mis-TTR monomers and oligomers
- FIG. 9 depicts a diagram of a pharmacodynamic assay to measure binding of a mis-TTR mAb (ml4G8) to plasma mis-TTR (target engagement).
- FIG. 10 depicts the results of a sandwich immunoassay employing the Meso Scale Discovery (MSD) electrochemiluminescence platform showing that 9D5 detects elevated misfolded TTR in plasma samples from transthyretin-mediated amyloidosis (ATTR) patients that had not undergone a liver transplant, in an assay using a polyclonal anti-TTR reporter antibody.
- MSD Meso Scale Discovery
- FIG. 11 depicts an alignment of heavy chain variable regions of the mouse 18C5 antibody (SEQ ID NO: 81), human germline sequence IGHV3-48*01 (SEQ ID NO:84), human acceptor 5VZY-VH_huFrwk (Crenefab-VH) (SEQ ID NO:83), and humanized versions of the 18C5 antibody (hul8C5_VH-vl and hul8C5_VH-v2, SEQ ID NOs: 84 and 85, respectively).
- CDRs defined according to Kabat/Chothia Composite are bolded in the mouse 18C5 heavy chain variable region sequence.
- FIG. 12 depicts an alignment of light chain variable regions of the mouse 18C5 antibody (SEQ ID NO:87), human germline sequence IGKV2-30*02 (SEQ ID NO:90), human acceptor 5VZY-VL_huFrwk (Crenefab-VL) (SEQ ID NO:89), and humanized versions of the 18C5 antibody (hul8C5-VL-vl and hul8C5-VL-v2, SEQ ID NOs: 91 and 92, respectively).
- CDRs defined according to Kabat/Chothia Composite are bolded in the mouse 18C5 light chain variable region sequence.
- SEQ ID NO: 1 sets forth the amino acid sequence of a heavy chain variable region of the mouse 18C5 antibody with signal peptide.
- SEQ ID NO:2 sets forth a nucleic acid sequence encoding a heavy chain variable region of the mouse 18C5 antibody with signal peptide.
- SEQ ID NO:3 sets forth the amino acid sequence of a light chain variable region of the mouse 18C5 antibody with signal peptide.
- SEQ ID NO:4 sets forth a nucleic acid sequence encoding a light chain variable region of the mouse 18C5 antibody with signal peptide.
- SEQ ID NO:5 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR-Hl of the mouse 18C5 antibody.
- SEQ ID NO:6 sets forth a nucleic acid sequence encoding a Kabat/Chothia Composite composite CDR-Hl of the mouse 18C5 antibody.
- SEQ ID NO:7 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR-H2 of the mouse 18C5 antibody.
- SEQ ID NO:8 sets forth a nucleic acid sequence encoding a Kabat/Chothia Composite CDR-H2 of the mouse 18C5 antibody.
- SEQ ID NO:9 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR-H3 of the mouse 18C5 antibody.
- SEQ ID NO: 10 sets forth a nucleic acid sequence encoding a Kabat/Chothia Composite CDR-H3 of the mouse 18C5 antibody.
- SEQ ID NO: 11 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR- Ll of the mouse 18C5 antibody.
- SEQ ID NO: 12 sets forth a nucleic acid sequence encoding a Kabat/Chothia Composite CDR-L1 of the mouse 18C5 antibody.
- SEQ ID NO: 13 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR- L2 of the mouse 18C5 antibody.
- SEQ ID NO: 14 sets forth a nucleic acid sequence encoding a Kabat/Chothia Composite CDR-L2 of the mouse 18C5 antibody.
- SEQ ID NO: 15 sets forth the amino acid sequence of a Kabat/Chothia Composite CDR- L3 of the mouse 18C5 antibody.
- SEQ ID NO: 16 sets forth a nucleic acid sequence encoding the a Kabat/Chothia Composite CDR-L3 of the mouse 18C5 antibody.
- SEQ ID NO: 17 sets forth the amino acid sequence of a chimeric 18C5 heavy chain constant region (human IgGl).
- SEQ ID NO: 18 sets forth a nucleic acid sequence encoding the amino acid sequence of a chimeric 18C5 heavy chain constant region (human IgGl).
- SEQ ID NO: 19 sets forth the amino acid sequence of a chimeric 18C5 light chain constant region (human kappa).
- SEQ ID NO:20 sets forth a nucleic acid sequence encoding the amino acid sequence of a chimeric 18C5 light chain constant region (human kappa).
- SEQ ID NO:21 sets forth the amino acid sequence of an exemplary IgGl heavy chain constant region.
- SEQ ID NO:22 sets forth the amino acid sequence of an exemplary IgGl Glm3 heavy chain constant region.
- SEQ ID NO:23 sets forth the amino acid sequence of an exemplary IgGl Glm3 heavy chain constant region.
- SEQ ID NO:24 sets forth the amino acid sequence of an exemplary light chain constant region with N-terminal Arginine.
- SEQ ID NO:25 sets forth the amino acid sequence of an exemplary light chain constant region without N-terminal Arginine.
- SEQ ID NO:26 sets forth the amino acid sequence of human transthyretin set forth in accession number P02766.1 (UniProt).
- SEQ ID NO:27 sets forth the amino acid sequence of human transthyretin set forth in accession number AAB35639.1 (GenBank).
- SEQ ID NO:28 sets forth the amino acid sequence of human transthyretin set forth in accession number AAB35640.1 (GenBank).
- SEQ ID NO:29 sets forth the amino acid sequence of human transthyretin set forth in accession number and ABI63351.1 (GenBank).
- SEQ ID NO:30 sets forth the amino acid sequence of residues 101-109 of human transthyretin.
- SEQ ID NO:31 sets forth the amino acid sequence of residues 87-127 of human transthyretin.
- SEQ ID NO:32 sets forth a nucleic acid sequence encoding an exemplary IgGl Glm3 heavy chain constant region.
- SEQ ID NO:33 sets forth a nucleic acid sequence encoding an exemplary light chain constant region with C-terminal Arginine.
- SEQ ID NO:34 sets forth a nucleic acid sequence encoding an exemplary light chain constant region without C-terminal Arginine.
- SEQ ID NO:35 sets forth the amino acid sequence of a heavy chain constant region signal peptide.
- SEQ ID NO:36 sets forth a nucleic acid sequence encoding a heavy chain constant region signal peptide.
- SEQ ID NO:37 sets forth the amino acid sequence of a light chain constant region signal peptide.
- SEQ ID NO:38 sets forth a nucleic acid sequence encoding a light chain constant region signal peptide.
- SEQ ID NO: 39 sets forth the amino acid sequence of a Kabat CDR-Hl of antibody 14G8.
- SEQ ID NO: 40 sets forth the amino acid sequence of a Kabat CDR-H2 of antibody 14G8.
- SEQ ID NO: 41 sets forth the amino acid sequence of a Kabat CDR-H3 of antibody 14G8.
- SEQ ID NO: 42 sets forth the amino acid sequence of a Kabat CDR-L1 of antibody 14G8.
- SEQ ID NO: 43 sets forth the amino acid sequence of a Kabat CDR-L2 of antibody 14G8.
- SEQ ID NO: 44 sets forth the amino acid sequence of a Kabat CDR-L3 of antibody 14G8.
- SEQ ID NO: 45 sets forth the amino acid sequence of an epitope of antibody 5A1.
- SEQ ID NO: 46 sets forth the amino acid sequence of a Kabat CDR-Hl of antibody 5A1.
- SEQ ID NO: 47 sets forth the amino acid sequence of a Kabat CDR-H2 of antibody 5A1.
- SEQ ID NO: 48 sets forth the amino acid sequence of a Kabat CDR-H3 of antibody 5A1.
- SEQ ID NO: 49 sets forth the amino acid sequence of a Kabat CDR-L1 of antibody 5A1.
- SEQ ID NO: 50 sets forth the amino acid sequence of a Kabat CDR-L2 of antibody 5A1.
- SEQ ID NO: 51 sets forth the amino acid sequence of a Kabat CDR-L3 of antibody 5A1.
- SEQ ID NO: 52 sets forth the amino acid sequence of a Kabat CDR-Hl of antibody 6C1.
- SEQ ID NO: 53 sets forth the amino acid sequence of a Kabat CDR-H2 of antibody 6C1.
- SEQ ID NO: 54 sets forth the amino acid sequence of a Kabat CDR-H3 of antibody 6C1.
- SEQ ID NO: 55 sets forth the amino acid sequence of a Kabat CDR-L1 of antibody 6C1.
- SEQ ID NO: 56 sets forth the amino acid sequence of a Kabat CDR-L2 of antibody 6C1.
- SEQ ID NO: 57 sets forth the amino acid sequence of a Kabat CDR-L3 of antibody 6C1.
- SEQ ID NO: 58 sets forth the amino acid sequence of a VH region of antibody AD7F6.
- SEQ ID NO: 59 sets forth the amino acid sequence of a VL region of antibody AD7F6.
- SEQ ID NO: 60 sets forth the amino acid sequence of a CDR-Hl of antibody RT24.
- SEQ ID NO: 61 sets forth the amino acid sequence of a CDR-H2 of antibody RT24.
- SEQ ID NO: 62 sets forth the amino acid sequence of a CDR-H3 of antibody RT24.
- SEQ ID NO:63 sets forth the amino acid sequence of a CDR-L1 of antibody RT24.
- SEQ ID NO: 64 sets forth the amino acid sequence of a CDR-L2 of antibody RT24.
- SEQ ID NO: 65 sets forth the amino acid sequence of a CDR-L3 of antibody RT24.
- SEQ ID NO: 66 sets forth the amino acid sequence of a CDR-Hl of antibody NI- 301.35G11.
- SEQ ID NO:67 sets forth the amino acid sequence of a CDR-H2 of antibody NI- 301.35G11.
- SEQ ID NO: 68 sets forth the amino acid sequence of a CDR-H3 of antibody NI- 301.35G11.
- SEQ ID NO: 69 sets forth the amino acid sequence of a CDR-L1 of antibody NI- 301.35G11.
- SEQ ID NO: 70 sets forth the amino acid sequence of a CDR-L2 of antibody NI- 301.35G11.
- SEQ ID NO: 71 sets forth the amino acid sequence of a CDR-L3 of antibody NI- 301.35G11.
- SEQ ID NO: 72 sets forth the amino acid sequence of an epitope of antibodies MFDIOI, MDF102, MFD 103, MFD 105.
- SEQ ID NO: 73 sets forth the amino acid sequence of an epitope of antibodies MFD107, MFD 108, MFD 109, MFD 111.
- SEQ ID NO: 74 sets forth the amino acid sequence of an epitope of antibody MFDl 14.
- SEQ ID NO: 75 sets forth the amino acid sequence of a Kabat CDR-H1 of antibody 9D5.
- SEQ ID NO: 76 sets forth the amino acid sequence of a Kabat CDR-H2 of antibody 9D5.
- SEQ ID NO: 77 sets forth the amino acid sequence of a Kabat CDR-H3 of antibody 9D5.
- SEQ ID NO: 78 sets forth the amino acid sequence of a Kabat CDR-L1 of antibody 9D5.
- SEQ ID NO: 79 sets forth the amino acid sequence of a Kabat CDR-L2 of antibody 9D5.
- SEQ ID NO: 80 sets forth the amino acid sequence of a Kabat CDR-L3 of antibody 9D5.
- SEQ ID NO:81 sets forth the amino acid sequence of a mature heavy chain variable region of the mouse 18C5 antibody.
- SEQ ID NO: 82 sets forth the amino acid sequence of a heavy chain variable region of the murine anti-pyroglutamate-Abeta antibody Fab c#17, GenBank Acc. No. 1212215935.
- SEQ ID NO: 83 sets forth the amino acid sequence of a heavy chain variable region of humanized Crenezumab Fab (CreneFab) PDB: 5VZY, GenBank Acc. No. 1229749875.
- SEQ ID NO: 84 sets forth the amino acid sequence of a heavy chain variable region of the human germline sequence IGHV3-48*01, GenBank Acc. No. 1FN550289.1.
- SEQ ID NO: 85 sets forth the amino acid sequence of a heavy chain variable region of the humanized 18C5 antibody hul8C5-VH_l .
- SEQ ID NO: 86 sets forth the amino acid sequence of a heavy chain variable region of the humanized 18C5 antibody hul8C5-VH_2.
- SEQ ID NO:87 sets forth the amino acid sequence of a mature light chain variable region of the mouse 18C5 antibody.
- SEQ ID NO: 88 sets forth the amino acid sequence of a light chain variable region of the murine anti-pyroglutamate-Abeta antibody Fab c#17, GenBank Acc. No. 1212215934.
- SEQ ID NO: 89 sets forth the amino acid sequence of a light chain variable region of humanized Crenezumab Fab (CreneFab) PDB: 5VZY, GenBank Acc. No. 1229749876.
- SEQ ID NO: 90 sets forth the amino acid sequence of a light chain variable region of the human germline sequence IGKV2-30*2, GenBank Acc. No. CAA77315.
- SEQ ID NO: 91 sets forth the amino acid sequence of a light chain variable region of the humanized 18C5 antibody hul8C5-VL_l .
- SEQ ID NO: 92 sets forth the amino acid sequence of a light chain variable region of the humanized 18C5 antibody hul8C5-VL_2.
- SEQ ID NO: 93 sets forth the amino acid sequence of Kabat CDR-Hl of the mouse 18C5 antibody.
- SEQ ID NO: 94 sets forth the amino acid sequence of Chothia CDR-Hl of the mouse 18C5 antibody.
- SEQ ID NO: 95 sets forth the amino acid sequence of Contact CDR-H1 of the mouse 18C5 antibody.
- SEQ ID NO: 96 sets forth the amino acid sequence of Chothia CDR-H2 of the mouse 18C5 antibody.
- SEQ ID NO: 97 sets forth the amino acid sequence of AbM CDR-H2 of the mouse 18C5 antibody.
- SEQ ID NO: 98 sets forth the amino acid sequence of Contact CDR-H2 of the mouse 18C5 antibody.
- SEQ ID NO: 99 sets forth the amino acid sequence of Contact CDR-H3 of the mouse 18C5 antibody.
- SEQ ID NO: 100 sets forth the amino acid sequence of Contact CDR-L1 of the mouse 18C5 antibody.
- SEQ ID NO: 101 sets forth the amino acid sequence of Contact CDR-L2 of the mouse 18C5 antibody.
- SEQ ID NO: 102 sets forth the amino acid sequence of Contact CDR-L3 of the mouse 18C5 antibody.
- SEQ ID NO: 103 sets forth the amino acid sequence of a heavy chain variable region of the mouse 9D5 antibody.
- SEQ ID NO: 104 sets forth the amino acid sequence of a light chain variable region of the mouse 9D5 antibody.
- Monoclonal antibodies or other biological entities are typically provided in isolated form. This means that an antibody or other biologically entity is typically at least 50% w/w pure of interfering proteins and other contaminants arising from its production or purification but does not exclude the possibility that the monoclonal antibody is combined with an excess of pharmaceutically acceptable carrier(s) or other vehicle intended to facilitate its use. Sometimes monoclonal antibodies are at least 60%, 70%, 80%, 90%, 95% or 99% w/w pure of interfering proteins and contaminants from production or purification. Often an isolated monoclonal antibody or other biological entity is the predominant macromolecular species remaining after its purification.
- Specific binding of an antibody to its target antigen means an affinity of at least 10 6 , 10 7 , 10 8 , 10 9 , or 10 10 M "1 . Specific binding is detectably higher in magnitude and distinguishable from non-specific binding occurring to at least one unrelated target. Specific binding can be the result of formation of bonds between particular functional groups or particular spatial fit (e.g., lock and key type) whereas nonspecific binding is usually the result of van der Waals forces. Specific binding does not however necessarily imply that an antibody binds one and only one target.
- the basic antibody structural unit is a tetramer of subunits.
- Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. This variable region is initially expressed linked to a cleavable signal peptide.
- the variable region without the signal peptide is sometimes referred to as a mature variable region.
- a light chain mature variable region means a light chain variable region without the light chain signal peptide.
- the carboxy -terminal portion of each chain defines a constant region primarily responsible for effector function.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 or more amino acids. See generally, Fundamental Immunology, Paul, W., ed., 2nd ed. Raven Press, N.Y., 1989, Ch. 7 (incorporated by reference in its entirety for all purposes).
- An immunoglobulin light or heavy chain variable region (also referred to herein as a "light chain variable domain” (“VL domain”) or “heavy chain variable domain” (“VH domain”), respectively) consists of a "framework” region interrupted by three “complementarity determining regions” or “CDRs.”
- the framework regions serve to align the CDRs for specific binding to an epitope of an antigen.
- the CDRs include the amino acid residues of an antibody that are primarily responsible for antigen binding. From amino-terminus to carboxyl-terminus, both VL and VH domains comprise the following framework (FR) and CDR regions: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- CDRs 1, 2, and 3 of a VL domain are also referred to herein, respectively, as CDR-L1, CDR-L2, and CDR-L3;
- CDRs 1, 2, and 3 of a VH domain are also referred to herein, respectively, as CDR-H1, CDR-H2, and CDR-H3.
- an antibody comprising CDRs defined by Kabat includes among other possibilities, an antibody in which the CDRs contain Kabat CDR residues and no other CDR residues, and an antibody in which CDR HI is a composite Chothia-Kabat CDR HI and other CDRs contain Kabat CDR residues and no additional CDR residues based on other definitions.
- H35B are present, it ends at H34.
- antibody includes intact antibodies and binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab', F(ab') 2 , F(ab)c, Dabs, nanobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
- antibody also includes a bispecific antibody and/or a humanized antibody. A bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites ⁇ see, e.g., Songsivilai and Lachmann, Clin. Exp.
- the two different heavy /light chain pairs include a humanized 9D5 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 9D5.
- the two different heavy /light chain pairs include a humanized 18C5 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 18C5.
- one heavy chain/light chain pair is a humanized 9D5 antibody or a humanized 18C5 antibody as further disclosed below and the other heavy chain/light chain pair is from an antibody that binds to a receptor expressed on the blood brain barrier, such as an insulin receptor, an insulin-like growth factor (IGF) receptor, a leptin receptor, or a lipoprotein receptor, or a transferrin receptor (Friden et al., Proc. Natl. Acad. Sci. USA 88:4771-4775, 1991; Friden et al., Science 259:373-377, 1993).
- a bispecific antibody can be transferred cross the blood brain barrier by receptor-mediated transcytosis.
- Brain uptake of the bispecific antibody can be further enhanced by engineering the bispecific antibody to reduce its affinity to the blood brain barrier receptor. Reduced affinity for the receptor resulted in a broader distribution in the brain (see, e.g., Atwal et al., Sci. Trans. Med. 3, 84ra43, 2011; Yu et al., Sci. Trans. Med. 3, 84ra44, 2011).
- Exemplary bispecific antibodies can also be: (1) a dual-variable-domain antibody (DVD- Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-IgTM) Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so- called “dock and lock” molecule, based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to
- epitope refers to a site on an antigen to which an antibody binds.
- An epitope can be formed from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of one or more proteins. Epitopes formed from contiguous amino acids (also known as linear epitopes) are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding (also known as conformational epitopes) are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
- epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed. (1996).
- the epitope can be linear, such as an epitope of, for example, 2-5, 3-5, 3-9, or 5-9 contiguous amino acids from SEQ ID NO:26, including for example, two or more contiguous amino acids within residues 89-97 of the mature region of SEQ ID NO:26.
- the epitope can also be a conformational epitope including, for example, two or more non-contiguous segments of amino acids within residues 89-97 of the mature region of SEQ ID NO:26. If an antibody is said to bind to an epitope within amino acid residues 89-97 of transthyretin (TTR) (the mature region of SEQ ID NO:26), for example, what is meant is that the epitope is within the recited range of amino acids including those defining the outer-limits of the range. It does not necessarily mean that every amino acid within the range constitutes part of the epitope.
- TTR transthyretin
- an epitope within amino acid residues 89-97 of TTR may consist of amino acids 89-97, 89-96, 90-97, 89-95, 90-96, 91-97, 89-94, 90-95, 91-96, 92-97, 89-93, 90-94, 91-95, 92-96, 93-97, 89-92, 90-93, 91-94, 92-95, 93-96, 94-97, 89-91, 90-92, 91-93, 92-94, 93- 95, 94-96, 95-97 of SEQ ID NO:26, among other linear segments of SEQ ID NO:45, or in the case of conformational epitopes, non-contiguous segments of amino acids of SEQ ID NO:45.
- Epitopes can include E89K and E89Q substitutions, E being the wildtype residue).
- the epitope can be linear, such as an epitope of, for example, 2-5, 3-5, 3-9, or 5-9 contiguous amino acids from SEQ ID NO:26, including for example, two or more contiguous amino acids within residues 101-109 of the mature region of SEQ ID NO:26.
- the epitope can also be a conformational epitope including, for example, two or more non-contiguous segments of amino acids within residues 101-109 of the mature region of SEQ ID NO:26.
- an antibody is said to bind to an epitope within amino acid residues 101-109 of transthyretin (TTR) (the mature region of SEQ ID NO:26), for example, what is meant is that the epitope is within the recited range of amino acids including those defining the outer-limits of the range. It does not necessarily mean that every amino acid within the range constitutes part of the epitope.
- TTR transthyretin
- an epitope within amino acid residues 101-109 of TTR may consist of amino acids 101-109, 101- 108, 102-109, 101-107, 102-108, 103-109, 101-106, 102-107, 103-108, 104-109, 101-105, 102- 106, 103-107, 104-108, 105-109, 101-104, 102-105, 103-106, 104-107, 105-108, 106-109, 101- 103, 102-104, 103-105, 104-106, 105-107, 106-108, 107-109, 101-102, 102-103, 103-104, 104- 105, 105-106, 106-107, 107-108, or 108-109 of SEQ ID NO:26, among other linear segments of SEQ ID NO: 30, or in the case of conformational epitopes, non-contiguous segments of amino acids of SEQ ID NO:30.
- Antibodies that recognize the same or overlapping epitopes can be identified in a simple immunoassay showing the ability of one antibody to compete with the binding of another antibody to a target antigen.
- the epitope of an antibody can also be defined by X-ray crystallography of the antibody bound to its antigen to identify contact residues.
- two antibodies have the same epitope if all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Two antibodies have overlapping epitopes if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Competition between antibodies is determined by an assay in which an antibody under test inhibits specific binding of a reference antibody to a common antigen (see, e.g., Junghans et al., Cancer Res. 50: 1495, 1990).
- a test antibody competes with a reference antibody if an excess of a test antibody ⁇ e.g., at least 2x, 5x, lOx, 20x or lOOx) inhibits binding of the reference antibody by at least 50% as measured in a competitive binding assay.
- Some test antibodies inhibit binding of the references antibody by at least 75%, 90% or 99%.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- TTR transthyretin
- TTR transthyretin
- non-native forms of TTR include, for example, misfolded TTR tetramers, TTR monomers, aggregated forms of TTR, and fibril forms of TTR.
- Non-native forms of TTR can include molecules comprising wild-type TTR amino acid sequences or mutations.
- TTR misfolded refers to the secondary and tertiary structure of a TTR polypeptide monomer or multimer, and indicates that the polypeptide has adopted a conformation that is not normal for that protein in its properly functioning state.
- TTR misfolding can be caused by mutations in the protein (e.g., deletion, substitution, or addition), wild-type TTR proteins can also be misfolded in diseases, exposing specific epitopes.
- pharmaceutically acceptable means that the carrier, diluent, excipient, or auxiliary is compatible with the other ingredients of the formulation and not substantially deleterious to the recipient thereof.
- patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- An individual is at increased risk of a disease if the subject has at least one known risk- factor (e.g., genetic, biochemical, family history, and situational exposure) placing individuals with that risk factor at a statistically significant greater risk of developing the disease than individuals without the risk factor.
- risk- factor e.g., genetic, biochemical, family history, and situational exposure
- biological sample refers to a sample of biological material within or obtainable from a biological source, for example a human or mammalian subject.
- samples can be organs, organelles, tissues, sections of tissues, bodily fluids, peripheral blood, blood plasma, blood serum, cells, molecules such as proteins and peptides, and any parts or
- biological sample can also encompass any material derived by processing the sample. Derived material can include cells or their progeny.
- Processing of the biological sample may involve one or more of filtration, distillation, extraction, concentration, fixation, inactivation of interfering components, and the like.
- control sample refers to a biological sample not known or suspected to include monomeric, misfolded, aggregated, or fibril forms of transthyretin (TTR), such as in TTR amyloid deposits.
- TTR transthyretin
- Control samples can be obtained from individuals not afflicted with a TTR amyloidosis or a specifically chosen type of TTR amyloidosis.
- control samples can be obtained from patients afflicted with TTR amyloidosis or a specifically chosen type of TTR amyloidosis.
- Such samples can be obtained at the same time as a biological sample thought to comprise the TTR amyloidosis or on a different occasion.
- a biological sample and a control sample can both be obtained from the same tissue (e.g., a tissue section containing both TTR amyloid deposits and surrounding normal tissue).
- control samples consist essentially or entirely of tissue free of TTR amyloid deposits and can be used in comparison to a biological sample thought to comprise TTR amyloid deposits.
- the tissue in the control sample is the same type as the tissue in the biological sample (e.g., cardiomyocytes in the heart).
- disease refers to any abnormal condition that impairs physiological function.
- the term is used broadly to encompass any disorder, illness, abnormality, pathology, sickness, condition, or syndrome in which physiological function is impaired, irrespective of the nature of the etiology.
- symptom refers to a subjective evidence of a disease, such as altered gait, as perceivable by a subject.
- a “sign” refers to objective evidence of a disease as observable by a physician.
- amino acids are grouped as follows: Group I (hydrophobic side chains): met, ala, val, leu, ile; Group II (neutral hydrophilic side chains): asn, gin, cys, ser, thr; Group III (acidic side chains): asp, glu; Group IV (basic side chains): his, lys, arg; Group V (residues influencing chain orientation): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe. Conservative substitutions involve substitutions between amino acids in the same class. Non-conservative substitutions constitute exchanging a member of one of these classes for a member of another.
- Percentage sequence identities are determined with antibody sequences maximally aligned by the Kabat numbering convention. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
- a subject antibody region e.g., the entire mature variable region of a heavy or light chain
- compositions or methods "comprising” or “including” one or more recited elements may include other elements not specifically recited.
- a composition that "comprises” or “includes” an antibody may contain the antibody alone or in combination with other ingredients.
- Designation of a range of values includes all integers within or defining the range, and all subranges defined by integers within the range.
- Antibodies of the invention can be administered concomitant with another treatment for the same indication as the antibody, meaning that the other treatment is administered at least once during the period in which the antibody is administered, such period beginning one month before the first dosing and ending one month after the last dosing of the antibody.
- the other treatment can be administered at recurring intervals during this period, which may or may not be the same as the intervals at which the antibody is administered.
- the other treatment may be a symptomatic treatment.
- a treatment is symptomatic if it only affects one or more symptoms of a disease, not its cause, i.e., its etiology.
- the invention provides antibodies that specifically bind to residues 89-97 or to residues 101-109 of transthyretin (TTR). Some antibodies bind any or all of monomeric, misfolded, aggregated, or fibril forms of TTR preferentially relative to native tetrameric form of TTR. Some antibodies bind either or both of monomeric or misfolded forms of TTR preferentially relative to native tetrameric form of TTR.
- the antibodies can be used for treating or effecting prophylaxis of diseases or disorders associated with TTR accumulation or accumulation of TTR deposits (e.g., TTR amyloidosis). The antibodies can also be used for diagnosing TTR amyloidosis and inhibiting or reducing aggregation of TTR.
- the antibodies can also be used to demonstrate pharmacodynamics effects of a transthyretin-mediated amyloidosis therapy, among other applications.
- Preferential binding means an association constant at least five times higher for any or all of monomeric, misfolded, aggregated, or fibril forms of TTR than for native tetrameric form of TTR.
- the association constant is at least ten times higher for any or all of monomeric, misfolded, aggregated, or fibril forms of TTR than for native tetrameric form of TTR.
- the antibody such as 9D5 or 18C5, for example, lacks specific binding to native tetrameric form of TTR.
- Transthyretin is a 127-amino acid, 55 kDa serum and cerebrospinal fluid transport protein primarily synthesized by the liver. It has also been referred to as prealbumin, thyroxine binding prealbumin, ATTR, and TBPA. In its native state, TTR exists as a tetramer. In homozygotes, the tetramers comprise identical 127-amino-acid beta-sheet-rich subunits. In heterozygotes, the TTR tetramers are made up of variant and/or wild-type subunits, typically combined in a statistical fashion.
- TTR The established function of TTR in the blood is to transport ⁇ / ⁇ -retinol binding protein.
- TTR is the major carrier of thyroxine (T 4 ) in the blood of rodents, utilizing binding sites that are orthogonal to those used for zo/o-retinol binding protein, the T 4 binding sites are effectively unoccupied in humans.
- TTR is one of at least thirty different human proteins whose extracellular misfolding and/or misassembly (amyloidogenesis) into a spectrum of aggregate structures is thought to cause degenerative diseases referred to as amyloid diseases. TTR undergoes conformational changes in order to become amyloidogenic.
- Dissociation of the TTR tetramer and partial unfolding exposes stretches of largely uncharged hydrophobic residues in an extended conformation that efficiently misassemble into largely unstructured spherical aggregates that ultimately undergo conformation conversion into cross-beta sheet amyloid structures.
- transthyretin or its fragments or domains includes the natural human amino acid sequences including isoforms, mutants (e.g., E89K and E89Q), and allelic variants thereof.
- Exemplary TTR polypeptide sequences are designated by Accession Numbers P02766.1 (UniProt) (SEQ ID NO:26), AAB35639.1
- Residues are numbered according to Swiss Prot P02766.1, with the first amino acid of the mature protein (i.e., not including the 20 amino acid signal sequence) designated residue 1. In any other TTR protein, residues are numbered according to the corresponding residues in P02766.1 on maximum alignment.
- Transthyretin (TTR) amyloidosis is a systemic disorder characterized by pathogenic, misfolded TTR and the extracellular deposition of amyloid fibrils composed of TTR.
- TTR amyloidosis is generally caused by destabilization of the native TTR tetramer form (due to environmental or genetic conditions), leading to dissociation, misfolding, and aggregation of TTR into amyloid fibrils that accumulate in various organs and tissues, causing progressive dysfunction. See, e.g., Almeida and Saraiva, FEB Letters 586:2891-2896 (2012); Ando et al, Orphanet Journal of Rare Diseases 8:31 (2013).
- TTR amyloidoses encompass diseases caused by pathogenic misfolded TTR resulting from mutations in TTR or resulting from non- mutated, misfolded TTR.
- wild-type ATTR amyloidosis also called senile systemic amyloidosis or SSA
- SCA senile cardiac amyloidosis
- TTR amyloidoses associated with point mutations in the TTR gene include familial amyloid polyneuropathy (FAP), familial amyloid cardiomyopathy (FAC), and the rare central nervous system selective amyloidosis (CNSA).
- FAP familial amyloid polyneuropathy
- FAC familial amyloid cardiomyopathy
- CNSA rare central nervous system selective amyloidosis
- Patients with hereditary (familial) TTR amyloidosis are almost always heterozygotes, meaning that the TTR tetramers are composed of mutant and/or wild-type TTR subunits, generally statistically distributed.
- Hereditary (familial) versions of TTR amyloidosis are generally autosomal dominant and are typically earlier onset than the sporadic diseases (SSA and SCA).
- TTR amyloidogenesis The tissue damage caused by TTR amyloidogenesis appear to stem largely from the toxicity of small, diffusible TTR aggregates, although accumulation of extracellular amyloid may contribute and almost certainly compromises organ structure in the late stages of the TTR amyloidosis.
- Exemplary TTR mutations include V30M, Yl 14C, G47R, S50I, E61L, T49S, F33V, A45T, E89K, E89Q, and V122I.
- TTR amyloidosis presents in many different forms, with considerable phenotypic variation across individuals and geographic locations. For example, TTR amyloidosis can present as a progressive, axonal sensory autonomic and motor neuropathy. TTR amyloidosis can also present as an infiltrative cardiomyopathy.
- TTR amyloidosis diagnosis is considered when one or several of the following are present: (1) family history of neuropathic disease, especially associated with heart failure; (2) neuropathic pain or progressive sensory disturbances of unknown etiology; (3) carpal tunnel syndrome without obvious cause, particularly if it is bilateral and requires surgical release; (4) gastrointestinal motility
- etiology e.g., erectile dysfunction, orthostatic hypotension, neurogenic bladder
- cardiac disease characterized by thickened ventricular walls in the absence of hypertension
- (6) vitreous body inclusions of the cotton-wool type See Ando et al, Orphanet Journal of Rare Diseases 8:31 (2013).
- Other symptoms can include, for example, polyneuropathy, sensory loss, pain, weakness in lower limbs, dyshidrosis, diarrhea, constipation, weight loss, and urinary
- TTR amyloidosis typically relies on target organ biopsies, followed by histological staining of the excised tissue with the amyloid-specific dye, Congo red. If a positive test for amyloid is observed, immunohistochemical staining and mass spectroscopic
- TTR amyloidosis e.g. amyloid light-chain (AL) amyloidosis, also known as primary systemic amyloidosis.
- A amyloid light-chain
- TTR amyloidosis e.g. amyloid light-chain (AL) amyloidosis
- demonstration of a mutation in the gene encoding TTR is then needed before diagnosis can be made. This can be accomplished, for example, through isoelectric focusing electrophoresis, polymerase chain reaction, or laser dissection/liquid chromatography -tandem mass spectrometry. See, e.g., US 2014/0056904; Ruberg and Berk, Circulation 126: 1286-1300 (2012); Ando et al, Orphanet Journal of Rare Diseases 8:31 (2013). IV. Antibodies
- the invention provides monoclonal antibodies binding to transthyretin (TTR) protein, more specifically, to epitopes within amino acid residues 89-97 (SEQ ID NO:45) or to epitopes within amino acid residues 101-109 (SEQ ID NO: 30) of TTR.
- TTR transthyretin
- Such epitopes are buried in the native TTR tetramer and exposed in monomelic, misfolded, aggregated, or fibril forms of TTR.
- Such antibodies include 9D5, 18C5, and their chimeric, veneered and humanized forms.
- 9D5 specifically binds within amino acid residues 89-97 (SEQ ID NO:45) of TTR.
- 18C5 specifically binds within amino acid residues 101-109 (SEQ ID NO: 30) of TTR.
- These antibodies are further characterized by their ability to bind to monomelic, misfolded, aggregated, or fibril forms of TTR but not to native tetrameric form of TTR.
- Ability to bind to specific proteins or fragments thereof may be demonstrated using exemplary assay formats provided in the examples.
- 9D5 or 18C5 should be understood as referring to any of the mouse, chimeric, veneered or humanized forms.
- a hybridoma cell line that produces monoclonal antibody 9D5 was deposited with the Patent Depository of the American Type Culture Collection (ATCC), Manassas, Virginia, 20110-2209 on April 4, 2017 and assigned Patent Deposit No. PTA- 124078.
- a hybridoma cell line that produces monoclonal antibody 18C5 was deposited with the Patent Depository of the American
- Some antibodies bind to the same or overlapping epitope as an antibody designated 9D5.
- the sequences of the heavy and light chain mature variable regions of 9D5 are designated SEQ ID NOs: 81 and 82, respectively.
- Other antibodies having such a binding specificity can be produced by immunizing mice with TTR, or a portion thereof including the desired epitope (e.g., SEQ ID NO:45), and screening resulting antibodies for binding to monomeric TTR or a peptide comprising SEQ ID NO:45, optionally in competition with an antibody having the variable regions of mouse 18C5 (IgGl, kappa).
- Fragments of TTR including the desired epitope can be linked to a carrier that helps elicit an antibody response to the fragment and/or be combined with an adjuvant that helps elicit such a response.
- a carrier that helps elicit an antibody response to the fragment and/or be combined with an adjuvant that helps elicit such a response.
- Such antibodies can be screened for differential binding to wild-type, monomeric versions of TTR or a fragment thereof (e.g., SEQ ID NO:26) compared with mutants of specified residues.
- Some antibodies bind to the same or overlapping epitope as an antibody designated 18C5.
- the sequences of the heavy and light chain mature variable regions of 18C5 are designated SEQ ID NOs: 1 and 3, respectively.
- Other antibodies having such a binding specificity can be produced by immunizing mice with TTR, or a portion thereof including the desired epitope (e.g., SEQ ID NO: 30), and screening resulting antibodies for binding to monomeric TTR or a peptide comprising SEQ ID NO:30, optionally in competition with an antibody having the variable regions of mouse 18C5 (IgGl, kappa).
- Fragments of TTR including the desired epitope can be linked to a carrier that helps elicit an antibody response to the fragment and/or be combined with an adjuvant that helps elicit such a response.
- a carrier that helps elicit an antibody response to the fragment and/or be combined with an adjuvant that helps elicit such a response.
- Such antibodies can be screened for differential binding to wild-type, monomeric versions of TTR or a fragment thereof (e.g., SEQ ID NO:26) compared with mutants of specified residues.
- the mutations can be systematic replacement substitution with alanine (or serine or glycine if an alanine is present already) one residue at a time, or more broadly spaced intervals, throughout the target or throughout a section thereof in which an epitope is known to reside. If the same set of mutations significantly reduces the binding of two antibodies, the two antibodies bind the same epitope.
- Antibodies having the binding specificity of a selected murine antibody can also be produced using a variant of the phage display method. See Winter, WO 92/20791. This method is particularly suitable for producing human antibodies. In this method, either the heavy or light chain variable region of the selected murine antibody is used as a starting material. If, for example, a light chain variable region is selected as the starting material, a phage library is constructed in which members display the same light chain variable region (i.e., the murine starting material) and a different heavy chain variable region. The heavy chain variable regions can for example be obtained from a library of rearranged human heavy chain variable regions.
- a phage showing strong specific binding e.g., at least 10 and preferably at least 10 9 M "1 ) for monomeric TTR or a fragment thereof (e.g., amino acid residues 89-97 or amino acid residues 101-109) is selected.
- the heavy chain variable region from this phage then serves as a starting material for constructing a further phage library.
- each phage displays the same heavy chain variable region (i.e., the region identified from the first display library) and a different light chain variable region.
- the light chain variable regions can be obtained for example from a library of rearranged human variable light chain regions.
- phage showing strong specific binding for monomeric TTR or a fragment thereof are selected.
- the resulting antibodies usually have the same or similar epitope specificity as the murine starting material.
- Other antibodies can be obtained by mutagenesis of cDNA encoding the heavy and light chains of an exemplary antibody, such as 9D5 or 18C5.
- Monoclonal antibodies that are at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identical to 9D5 or 18C5 in amino acid sequence of the mature heavy and/or light chain variable regions and maintain its functional properties, and/or which differ from the respective antibody by a small number of functionally inconsequential amino acid substitutions (e.g., conservative substitutions), deletions, or insertions are also included in the invention.
- Monoclonal antibodies having at least one or all six CDR(s) as defined by conventional definition, but preferably Kabat, that are 90%, 95%, 99% or 100%) identical to corresponding CDRs of 9D5 or 18C5 are also included.
- the invention also provides antibodies having some or all (e.g., 3, 4, 5, and 6) CDRs entirely or substantially from 9D5 or 18C5.
- Such antibodies can include a heavy chain variable region that has at least two, and usually all three, CDRs entirely or substantially from the heavy chain variable region of 9D5 or 18C5 and/or a light chain variable region having at least two, and usually all three, CDRs entirely or substantially from the light chain variable region of 9D5 or 18C5.
- the antibodies can include both heavy and light chains.
- a CDR is substantially from a corresponding 9D5 or 18C5 CDR when it contains no more than 4, 3, 2, or 1 substitutions, insertions, or deletions, except that CDR-H2 (when defined by Kabat) can have no more than 6, 5, 4, 3, 2, or 1 substitutions, insertions, or deletions.
- Such antibodies can have at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identity to 9D5 or 18C5 in the amino acid sequence of the mature heavy and/or light chain variable regions and maintain their functional properties, and/or differ from 9D5 or 18C5 by a small number of functionally inconsequential amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
- Kabat CDRs (CDR-H1, CDR-H2, CDR-H3) of the heavy chain of 9D5 are designated SEQ ID NOs: 75, 76, and 77, respectively
- Kabat CDRs (CDR-Ll, CDR-L2, CDR-L3) of the light chain of 9D5 are designated SEQ ID NOs: 78, 79, and 80, respectively.
- Kabat/Chothia Composite CDRs (CDR-H1, CDR-H2, CDR-H3) of the heavy chain of 18C5 are designated SEQ ID NOs: 5, 7, and 9, respectively, and Kabat/Chothia Composite CDRs (CDR-Ll, CDR-L2, CDR-L3) of the light chain of 18C5 are designated SEQ ID NOs: 1 1, 13, and 15, respectively.
- Table 2 indicates the 18C5 CDRs as defined by Kabat, Chothia, Composite of Chothia and Kabat (also referred to herein as "Kabat/Chothia Composite"), AbM, and Contact.
- Some antibodies identified by such assays can bind to monomeric, misfolded, aggregated, or fibril forms of TTR but not to native tetrameric form of TTR, as described in the examples or otherwise. Likewise, some antibodies are immunoreactive on TTR-mediated amyloidosis tissue but not on healthy tissue.
- Some antibodies can inhibit or reduce aggregation of TTR, inhibit or reduce TTR fibril formation, reduce or clear TTR deposits or aggregated TTR, or stabilize non-toxic conformations of TTR in an animal model or clinical trial.
- Some antibodies can treat, effect prophylaxis of, or delay the onset of a TTR amyloidosis as shown in an animal model or clinical trial.
- Exemplary animal models for testing activity against a TTR amyloidosis include those described in Kohno et al, Am. J. Path. 150(4): 1497-1508 (1997); Teng et al, Laboratory Investigations 81 :385-396 (2001); Wakasugi et al, Proc. Japan Acad.
- Anti-TTR antibodies including chimeric and humanized versions thereof, are useful in combination therapies, in bispecific antibodies, in methods of diagnosis and/or treatment of TTR associated disorders, and in methods of detecting TTR.
- Such anti-TTR antibodies may include antibodies as in Table 3 below.
- non-human antibodies e.g., murine, guinea pig, primate, rabbit or rat
- monomeric TTR or a fragment thereof e.g., amino acid residues 89-97 or amino acid residues 101-109
- immunizing the animal with TTR or a fragment thereof See Harlow & Lane, Antibodies, A Laboratory Manual (CSHP NY, 1988) (incorporated by reference for all purposes).
- Such an immunogen can be obtained from a natural source, by peptide synthesis, or by recombinant expression.
- the immunogen can be administered fused or otherwise complexed with a carrier protein.
- the immunogen can be administered with an adjuvant.
- Several types of adjuvant can be used as described below. Complete Freund's adjuvant followed by incomplete adjuvant is preferred for immunization of laboratory animals. Rabbits or guinea pigs are typically used for making polyclonal antibodies. Mice are typically used for making monoclonal antibodies. Antibodies are screened for specific binding to monomeric TTR or an epitope within TTR (e.g., an epitope comprising one or more of amino acid residues 89-97 or of amino acid residues 101-109).
- Such screening can be accomplished by determining binding of an antibody to a collection of monomeric TTR variants, such as TTR variants containing amino acid residues 89-97 amino acid residues 101-109 or mutations within these residues, and determining which TTR variants bind to the antibody.
- Binding can be assessed, for example, by Western blot, FACS or ELISA.
- a humanized antibody is a genetically engineered antibody in which CDRs from a non- human "donor” antibody are grafted into human “acceptor” antibody sequences (see, e.g., Queen, US 5,530, 101 and 5,585,089; Winter, US 5,225,539; Carter, US 6,407,213; Adair, US 5,859,205; and Foote, US 6,881,557).
- the acceptor antibody sequences can be, for example, a mature human antibody sequence, a composite of such sequences, a consensus sequence of human antibody sequences, or a germline region sequence.
- a humanized antibody is an antibody having at least three, four, five or all CDRs entirely or substantially from a donor antibody and variable region framework sequences and constant regions, if present, entirely or substantially from human antibody sequences.
- a humanized heavy chain has at least one, two and usually all three CDRs entirely or substantially from a donor antibody heavy chain, and a heavy chain variable region framework sequence and heavy chain constant region, if present, substantially from human heavy chain variable region framework and constant region sequences.
- a humanized light chain has at least one, two and usually all three CDRs entirely or substantially from a donor antibody light chain, and a light chain variable region framework sequence and light chain constant region, if present, substantially from human light chain variable region framework and constant region sequences.
- a humanized antibody comprises a humanized heavy chain and a humanized light chain.
- a CDR in a humanized antibody is substantially from a corresponding CDR in a non-human antibody when at least 85%, 90%, 95% or 100% of corresponding residues (as defined by any conventional definition but preferably defined by Kabat) are identical between the respective CDRs.
- the variable region framework sequences of an antibody chain or the constant region of an antibody chain are substantially from a human variable region framework sequence or human constant region respectively when at least 85%, 90%, 95% or 100% of corresponding residues defined by any conventional definition but preferably defined by Kabat are identical.
- an antibody To be classified as humanized under the 2014 World Health Organization (WHO) International nonproprietary names (INN) definition of humanized antibodies, an antibody must have at least 85% identity in the mature variable regions to human germline antibody sequences (i.e., prior to somatic hypermutation).
- Mixed antibodies are antibodies for which one antibody chain (e.g., heavy chain) meets the threshold but the other chain (e.g., light chain) does not meet the threshold.
- An antibody is classified as chimeric if neither chain meets the threshold, even though the variable framework regions for both chains were substantially human with some murine backmutations. See, Jones et al.
- humanized as used herein is not intended to be limited to the 2014 WHO INN definition of humanized antibodies.
- Some of the humanized antibodies provided herein have at least 85% sequence identity to human germline sequences in either or both mature variable regions and some of the humanized antibodies provided herein have less than 85%> sequence identity to human germline sequences in either or both mature variable regions.
- Some of the mature heavy chain variable regions of the humanized antibodies provided herein have from about 60%> to 100%> sequence identity to human germ line sequences, such as, for example, in the range of about 60%> to 69%, 70% to 79%), 80%) to 84%), or 85%> to 89%>.
- Some of the mature light chain variable regions of the humanized antibodies provided herein have from about 60%> to 100%> sequence identity to human germ line sequences, such as, for example, in the range of about 80%> to 84%) or 85%) to 89%>.
- Some of the mature light chain variable regions fall below the 2014 WHO INN definition and have, for example, about 81%, 82%, 83% or 84% sequence identity to human germ line sequences, while other mature light chain variable regions meet the 2014 WHO INN definition and have about 85%, 86%, 87%, 88%, 89% or greater sequence identity to human germ line sequences.
- Some humanized antibodies provided herein that are "chimeric" under the 2014 WHO INN definition have mature heavy chain variable regions with less than 85% identity to human germ line sequences paired with mature light chain variable regions having less than 85%) identity to human germ line sequences.
- Some humanized antibodies provided herein are "mixed" under the 2014 WHO INN definition, for example, having a mature heavy chain variable region with at least 85% sequence identity to human germ line sequences paired with a mature light chain variable region having less than 85% sequence identity to human germ line sequences, or vice versa.
- Some humanized antibodies provided herein meet the 2014 WHO INN definition of "humanized” and have a mature heavy chain variable region with at least 85% sequence identity to human germ line sequences paired with a a mature light chain variable region having at least 85% sequence identity to human germ line sequences.
- Exemplary 18C5 antibodies that meet the 2014 WHO INN definition of "humanized” include antibodies having a mature heavy chain variable region with an amino acid sequence of SEQ ID NO:85 or SEQ ID NO: 86 paired with a mature light chain variable region having an amino acid sequence of SEQ ID NO:91 or SEQ ID NO:92.
- humanized antibodies often incorporate all six CDRs (preferably as defined by Kabat) from a mouse antibody, they can also be made with less than all CDRs (e.g., at least 3, 4, or 5 CDRs) from a mouse antibody (e.g., Pascalis et al., J. Immunol. 169:3076, 2002; Vajdos et al., J. of Mol. Biol, 320: 415-428, 2002; Iwahashi et al., Mol. Immunol. 36: 1079-1091, 1999; Tamura et al, J. Immunol, 164: 1432-1441, 2000).
- CDRs e.g., Pascalis et al., J. Immunol. 169:3076, 2002; Vajdos et al., J. of Mol. Biol, 320: 415-428, 2002; Iwahashi et al., Mol. Immunol. 36: 1079-1091, 1999; Tamura et al, J. Immuno
- CDR residues not contacting antigen and not in the SDRs can be identified based on previous studies (for example residues H60-H65 in CDR H2 are often not required), from regions of Kabat CDRs lying outside Chothia hypervariable loops (Chothia, J. Mol. Biol. 196:901, 1987), by molecular modeling and/or empirically, or as described in Gonzales et al, Mol. Immunol. 41 : 863, 2004.
- the amino acid occupying the position can be an amino acid occupying the corresponding position (by Kabat numbering) in the acceptor antibody sequence.
- the number of such substitutions of acceptor for donor amino acids in the CDRs to include reflects a balance of competing considerations. Such substitutions are potentially advantageous in decreasing the number of mouse amino acids in a humanized antibody and consequently decreasing potential immunogenicity. However, substitutions can also cause changes of affinity, and significant reductions in affinity are preferably avoided. Positions for substitution within CDRs and amino acids to substitute can also be selected empirically.
- the human acceptor antibody sequences can optionally be selected from among the many known human antibody sequences to provide a high degree of sequence identity (e.g., 65-85% identity) between a human acceptor sequence variable region frameworks and corresponding variable region frameworks of a donor antibody chain.
- An example of an acceptor sequence for the 18C5 heavy chain is the humanized Crenezumab Fab (CreneFab) VH, with PDB accession code 5VZY (SEQ ID NO:83).
- An example of an acceptor sequence for the 18C5 light chain is the humanized Crenezumab Fab (CreneFab) VL, with PDB accession code 5VZY (SEQ ID NO:89).
- Another example of an acceptor sequence for the 18C5 light chain is the human germline gene IGKV2-30*02 (SEQ ID NO:90).
- Certain amino acids from the human variable region framework residues can be selected for substitution based on their possible influence on CDR conformation and/or binding to antigen. Investigation of such possible influences is by modeling, examination of the
- the human framework amino acid when an amino acid differs between a murine variable region framework residue and a selected human variable region framework residue, the human framework amino acid can be substituted by the equivalent framework amino acid from the mouse antibody when it is reasonably expected that the amino acid:
- CDR region e.g., is within about 6 A of a CDR region
- a CDR region e.g., identified by modeling the light or heavy chain on the solved structure of a homologous known immunoglobulin chain
- the invention provides humanized forms of the murine 18C5 antibody including 2 exemplified humanized heavy chain mature variable regions (hul 8C5-VH_vl (SEQ ID NO:85), and hul 8C5-VH_v2 (SEQ ID NO:86)), and 2 exemplified humanized light chain mature variable regions (hul 8C5-VL_vl (SEQ ID NO:91) and hul 8C5-VL_v2 (SEQ ID NO: 92)).
- humanized sequences are generated using a two-stage PCR protocol that allows introduction of multiple mutations, deletions, and insertions using QuikChange site- directed mutagenesis [Wang, W. and Malcolm, B.A. (1999) BioTechniques 26:680-682)].
- framework residues that are candidates for substitution are residues creating a potential glycosylation site. Still other candidates for substitution are acceptor human framework amino acids that are unusual for a human immunoglobulin at that position. These amino acids can be substituted with amino acids from the equivalent position of the mouse donor antibody or from the equivalent positions of more typical human immunoglobulins.
- Exemplary humanized antibodies are humanized forms of the mouse 18C5, designated Hul8C5.
- the mouse antibody 18C5 comprises mature heavy and light chain variable regions having amino acid sequences comprising SEQ ID NO: 81 and SEQ ID NO:87, respectively.
- the invention provides 2 exemplified humanized mature heavy chain variable regions: hul8C5- VH_vl and hul8C5-VH_v2.
- the invention further provides 2 exemplified human mature light chain variable regions: hul8C5-VL_vl and hul8C5-VL_v2. Alignments of the murine 18C5 and various humanized antibodies are shown for the light chain variable regions (Table 8 and Figure 12), and heavy chain variable regions (Table 9 and Figure 11).
- variable region framework positions of 18C5 were considered as candidates for substitutions in the 2 exemplified human mature light chain variable regions and the 2 exemplified human mature heavy chain variable regions, as further specified in Example 7: L2 (I2V), L45 (Q45R), H37 (V37A), H45 (L45Q), H47 (L47W), H48 (V48I), H49 (A49G), and H94 (S94R).
- the first-mentioned residue is the residue of a humanized antibody formed by grafting Kabat CDRs or a composite Chothia Kabat CDR in the case of CDR-Hl into a human acceptor framework, and the second-mentioned residue is a residue being considered for replacing such residue.
- the first mentioned residue is human, and within CDRs, the first mentioned residue is mouse.
- Exemplified antibodies include any permutations or combinations of the exemplified mature heavy and light chain variable regions of 18C5 e.g., hul8C5VH_vl/ hul8C5VL_vl, hul8C5VH_vl/ hul8C5VL_v2, hul8C5VH_v2/ hul8C5VL_vl, or hul8C5VH_v2/
- the invention provides variants of the 18C5 humanized antibody in which the humanized mature heavy chain variable region shows at least 90%, 95%, 96%, 97%, 98%>, or 99% identity to any one of hul8C5-VH_vl, and hul8C5-VH_v2. (SEQ ID NOs: 85-86) and the humanized mature light chain variable region shows at least 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of hul8C5-VL_vl, and hul8C5-VL_v2, (SEQ ID NOs: 91-92). In some such antibodies at least 1, 2, 3, 4, 5, 6, 7, or all 8, of the backmutations or other mutations found in SEQ ID NO: 86 and SEQ ID NO: 92 are retained.
- H37 is occupied by V or A
- H45 is occupied by L or Q
- H47 is occupied by L or W
- H48 is occupied by L or I
- H49 is occupied by A or G
- H94 is occupied by S or R.
- positions H37, H45, H47, H48, H49, and H94 in the VH region are occupied by A, Q, W, I, G, and R, respectively, as in hul 8C5-VH_v2.
- L2 is occupied by I or V and L45 is occupied by Q or R.
- positions L2 and L45 in the VL region are occupied by V and R, respectively, as in hul 8C5-VL_v2.
- variable heavy chain has > 85% identity to human sequence.
- variable light chain has > 85% identity to human sequence.
- each of the variable heavy chain and variable light chain has > 85% identity to human germline sequence.
- the CDR regions of such humanized antibodies can be identical or substantially identical to the CDR regions of the 9D5 or 18C5 mouse donor antibody.
- the CDR regions can be defined by any conventional definition, such as those in Table 1, but are preferably as defined by Kabat or Kabat+Chothia composite.
- Variable regions framework positions are in accordance with Kabat numbering unless otherwise stated. Other such variants typically differ from the sequences of the exemplified Hul 8C5 heavy and light chains by a small number (e.g., typically no more than 1, 2, 3, 5, 10, or 15) of replacements, deletions or insertions.
- a possibility for additional variation in humanized 9D5 or 18C5 variants is additional backmutations in the variable region frameworks.
- Many of the framework residues not in contact with the CDRs in the humanized mAb can accommodate substitutions of amino acids from the corresponding positions of the donor mouse mAb or other mouse or human antibodies, and even many potential CDR-contact residues are also amenable to substitution.
- Even amino acids within the CDRs may be altered, for example, with residues found at the corresponding position of the human acceptor sequence used to supply variable region frameworks.
- alternate human acceptor sequences can be used, for example, for the heavy and/or light chain. If different acceptor sequences are used, one or more of the backmutations recommended above may not be performed because the corresponding donor and acceptor residues are already the same without backmutations.
- Hu9D5 or Hul8C5variants have no substantial effect on the binding affinity or potency of the humanized mAb, that is, its ability to bind to monomeric TTR (e.g., the potency in some or all of the assays described in the present examples of the variant humanized 9D5 or 18C5 antibody is essentially the same, i.e., within experimental error, as that of murine 9D5 or murine 18C5).
- Exemplary humanized 9D5 variants are described in WO 2016/120810.
- the invention further provides chimeric and veneered forms of non-human antibodies, particularly the 9D5 or 18C5 antibodies of the examples.
- a chimeric antibody is an antibody in which the mature variable regions of light and heavy chains of a non-human antibody ⁇ e.g., a mouse) are combined with human light and heavy chain constant regions. Such antibodies substantially or entirely retain the binding specificity of the mouse antibody, and are about two-thirds human sequence.
- a chimeric 18C5 antibody has a mature heavy chain variable region amino acid sequence of SEQ ID NO:81, a mature light chain variable region amino acid sequence of SEQ ID NO: 87, a human heavy chain constant region amino acid sequence of SEQ ID NO: 17, and a human light chain constant region amino acid sequence of SEQ ID NO: 19.
- An exemplary chimeric 9D5 antibody is described in WO 2016/120810,
- a veneered antibody is a type of humanized antibody that retains some and usually all of the CDRs and some of the non-human variable region framework residues of a non-human antibody but replaces other variable region framework residues that may contribute to B- or T- cell epitopes, for example exposed residues (Padlan, Mol. Immunol. 28:489, 1991) with residues from the corresponding positions of a human antibody sequence.
- the result is an antibody in which the CDRs are entirely or substantially from a non-human antibody and the variable region frameworks of the non-human antibody are made more human-like by the substitutions.
- Veneered forms of the 9D5 or 18C5 antibody are included in the invention.
- Human antibodies against monomeric TTR or a fragment thereof ⁇ e.g., amino acid residues 89-97 (SEQ ID NO:45) of TTR, or amino acid residues 101-109 (SEQ ID NO:30) of TTR) are provided by a variety of techniques described below. Some human antibodies are selected by competitive binding experiments, by the phage display method of Winter, above, or otherwise, to have the same epitope specificity as a particular mouse antibody, such as one of the mouse monoclonal antibodies described in the examples.
- Human antibodies can also be screened for particular epitope specificity by using only a fragment of TTR, such as a TTR variant containing only amino acid residues 89-97 or amino acid residues 101-109 of TTR, as the target antigen, and/or by screening antibodies against a collection of TTR variants, such as TTR variants containing various mutations within amino acid residues 89-97 or amino acid residues 101-109 of TTR.
- a fragment of TTR such as a TTR variant containing only amino acid residues 89-97 or amino acid residues 101-109 of TTR
- Methods for producing human antibodies include the trioma method of Oestberg et al, Hybridoma 2:361-367 (1983); Oestberg, U.S. Patent No. 4,634,664; and Engleman et al, US Patent 4,634,666, use of transgenic mice including human immunoglobulin genes ⁇ see, e.g., Lonberg et al, W093/12227 (1993); US 5,877,397; US 5,874,299; US 5,814,318; US 5,789,650; US 5,770,429; US 5,661,016; US 5,633,425; US 5,625, 126; US 5,569,825; US 5,545,806;
- the heavy and light chain variable regions of chimeric, veneered or humanized antibodies can be linked to at least a portion of a human constant region.
- the choice of constant region depends, in part, whether antibody-dependent cell-mediated cytotoxicity, antibody dependent cellular phagocytosis and/or complement dependent cytotoxicity are desired.
- human isotypes IgGl and IgG3 have complement-dependent cytotoxicity and human isotypes IgG2 and IgG4 do not.
- Human IgGl and IgG3 also induce stronger cell mediated effector functions than human IgG2 and IgG4.
- Light chain constant regions can be lambda or kappa. Numbering conventions for constant regions include EU numbering (Edelman, G.M.
- One or several amino acids at the amino or carboxy terminus of the light and/or heavy chain may be missing or derivatized in a proportion or all of the molecules. Substitutions can be made in the constant regions to reduce or increase effector function such as complement-mediated cytotoxicity or ADCC (see, e.g., Winter et al., US Patent No. 5,624,821; Tso et al., US Patent No. 5,834,597; and Lazar et al., Proc. Natl. Acad. Sci. USA 103 :4005, 2006), or to prolong half-life in humans (see, e.g., Hinton et al., J. Biol.
- substitutions include a Gin at position 250 and/or a Leu at position 428 (EU numbering is used in this paragraph for the constant region) for increasing the half-life of an antibody. Substitution at any or all of positions 234, 235, 236 and/or 237 reduce affinity for Fey receptors, particularly FcyRI receptor (see, e.g., US
- alanine substitution at positions 234, 235, and 237 of human IgGl can be used for reducing effector functions.
- Some antibodies have alanine substitution at positions 234, 235 and 237 of human IgGl for reducing effector functions.
- positions 234, 236 and/or 237 in human IgG2 are substituted with alanine and position 235 with glutamine (see, e.g., US 5,624,821).
- a mutation at one or more of positions 241, 264, 265, 270, 296, 297, 322, 329, and 331 by EU numbering of human IgGl is used.
- positions 234 and/or 235 are substituted with alanine and/or position 329 is substituted with glycine. In some antibodies, positions 234 and 235 are substituted with alanine, such as in SEQ ID NO:23. In some antibodies, the isotype is human IgG2 or IgG4.
- An exemplary human light chain kappa constant region has the amino acid sequence of SEQ ID NO:24.
- the N-terminal arginine of SEQ ID NO:24 can be omitted, in which case light chain kappa constant region has the amino acid sequence of SEQ ID NO:25.
- An exemplary human IgGl heavy chain constant region has the amino acid sequence of SEQ ID NO:21 (with or without the C-terminal lysine).
- Antibodies can be expressed as tetramers containing two light and two heavy chains, as separate heavy chains, light chains, as Fab, Fab', F(ab')2, and Fv, or as single chain antibodies in which heavy and light chain mature variable domains are linked through a spacer.
- Isoallotypes differ from allotypes in that sera recognizing an isoallotype bind to a non-polymorphic region of a one or more other isotypes.
- another heavy chain constant region is of IgGl Glm3 allotype and has the amino acid sequence of SEQ ID NO:22.
- Another heavy chain constant region of the IgGl Glm3 allotype has the amino acid sequence of SEQ ID NO:23 (with or without the C-terminal lysine).
- Reference to a human constant region includes a constant region with any natural allotype or any permutation of residues occupying positions in natural allotypes.
- a number of methods are known for producing chimeric and humanized antibodies using an antibody-expressing cell line ⁇ e.g., hybridoma).
- the immunoglobulin variable regions of antibodies can be cloned and sequenced using well known methods.
- the heavy chain variable VH region is cloned by RT-PCR using mRNA prepared from hybridoma cells. Consensus primers are employed to the VH region leader peptide
- sequences from multiple, independently derived clones can be compared to ensure no changes are introduced during amplification.
- sequence of the VH region can also be determined or confirmed by sequencing a VH fragment obtained by 5' RACE RT-PCR methodology and the 3' g2b specific primer.
- the light chain variable VL region can be cloned in an analogous manner.
- a consensus primer set is designed for amplification of VL regions using a 5' primer designed to hybridize to the VL region encompassing the translation initiation codon and a 3' primer specific for the Ck region downstream of the V- J joining region.
- 5'RACE RT-PCR methodology is employed to clone a VL encoding cDNA. Exemplary primers are described in Schenk, supra.
- the cloned sequences are then combined with sequences encoding human (or other non-human species) constant regions. Exemplary sequences encoding human constant regions include SEQ ID NO:32, which encodes a human IgGl constant region, and SEQ ID NOs:33 and 34, which encode a human kappa light chain constant region.
- the heavy and light chain variable regions are re-engineered to encode splice donor sequences downstream of the respective VDJ or VJ junctions and are cloned into a mammalian expression vector, such as pCMV- hyl for the heavy chain and pCMV-Mcl for the light chain.
- a mammalian expression vector such as pCMV- hyl for the heavy chain and pCMV-Mcl for the light chain.
- These vectors encode human ⁇ and Ck constant regions as exonic fragments downstream of the inserted variable region cassette.
- the heavy chain and light chain expression vectors can be co-transfected into CHO cells to produce chimeric antibodies. Conditioned media is collected 48 hours post-transfection and assayed by western blot analysis for antibody production or ELISA for antigen binding.
- the chimeric antibodies are humanized as described above.
- Chimeric, veneered, humanized, and human antibodies are typically produced by recombinant expression.
- Recombinant polynucleotide constructs typically include an expression control sequence operably linked to the coding sequences of antibody chains, including naturally associated or heterologous expression control elements, such as a promoter.
- the expression control sequences can be promoter systems in vectors capable of transforming or transfecting eukaryotic or prokaryotic host cells. Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences and the collection and purification of the crossreacting antibodies.
- E. coli is one prokaryotic host useful for expressing antibodies, particularly antibody fragments.
- Microbes, such as yeast are also useful for expression. Saccharomyces is a yeast host with suitable vectors having expression control sequences, an origin of replication, termination sequences, and the like as desired.
- Typical promoters include 3 -phosphogly cerate kinase and other glycolytic enzymes.
- Inducible yeast promoters include, among others, promoters from alcohol dehydrogenase, isocytochrome C, and enzymes responsible for maltose and galactose utilization.
- Mammalian cells can be used for expressing nucleotide segments encoding
- suitable host cell lines capable of secreting intact heterologous proteins have been developed, and include CHO cell lines, various COS cell lines, HeLa cells, HEK293 cells, L cells, and non-antibody-producing myelomas including Sp2/0 and NS0.
- the cells can be nonhuman.
- Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer (Queen et al., Immunol. Rev. 89:49 (1986)), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
- Expression control sequences can include promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. See Co et al., J.
- antibody coding sequences can be incorporated in transgenes for introduction into the genome of a transgenic animal and subsequent expression in the milk of the transgenic animal (see, e.g., U.S. Pat. No. 5,741,957; U.S. Pat. No. 5,304,489; and U.S. Pat. No. 5,849,992).
- Suitable transgenes include coding sequences for light and/or heavy chains operably linked with a promoter and enhancer from a mammary gland specific gene, such as casein or beta lactoglobulin.
- the vectors containing the DNA segments of interest can be transferred into the host cell by methods depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment, electroporation, lipofection, biolistics, or viral-based transfection can be used for other cellular hosts. Other methods used to transform mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection. For production of transgenic animals, transgenes can be microinjected into fertilized oocytes or can be incorporated into the genome of embryonic stem cells, and the nuclei of such cells transferred into enucleated oocytes.
- cell pools can be screened for growth productivity and product quality in serum-free media. Top-producing cell pools can then be subjected of FACS-based single-cell cloning to generate monoclonal lines. Specific productivities above 50 pg or 100 pg per cell per day, which correspond to product titers of greater than 7.5 g/L culture, can be used. Antibodies produced by single cell clones can also be tested for turbidity, filtration properties, PAGE, IEF, UV scan, HP- SEC, carbohydrate-oligosaccharide mapping, mass spectrometry, and binding assay, such as ELISA or Biacore. A selected clone can then be banked in multiple vials and stored frozen for subsequent use.
- antibodies can be purified according to standard procedures of the art, including protein A capture, FIPLC purification, column chromatography, gel electrophoresis and the like ⁇ see generally, Scopes, Protein Purification (Springer- Verlag, NY, 1982)).
- Methodology for commercial production of antibodies can be employed, including codon optimization, selection of promoters, selection of transcription elements, selection of terminators, serum-free single cell cloning, cell banking, use of selection markers for amplification of copy number, CHO terminator, or improvement of protein titers ⁇ see, e.g., US 5,786,464; US
- Antibodies can be subject to several screens including binding assays, functional screens, screens in animal models of diseases associated with TTR deposits, and clinical trials. Binding assays test for specific binding and, optionally, affinity and epitope specificity to monomeric TTR or a fragment thereof. For example, binding assays can screen for antibodies that bind to amino acid residues 89-97 (SEQ ID NO:45) or amino acid residues 101-109 (SEQ ID NO:30) of TTR , which which are epitopes that are buried in the native TTR tetramer and exposed in monomelic, misfolded, aggregated, or fibril forms of TTR.
- binding assays can screen for antibodies that bind to amino acid residues 89-97 (SEQ ID NO:45) or amino acid residues 101-109 (SEQ ID NO:30) of TTR , which which are epitopes that are buried in the native TTR tetramer and exposed in monomelic, misfolded, aggregated, or fibril forms
- Antibodies can also be screened for the ability to bind pre-fibrillar, non-native conformations of TTR and TTR amyloid fibrils but not native TTR conformations.
- antibodies can be screened for the ability to bind to monomelic forms of TTR created by dissociation or disaggregation of native tetrameric TTR, and can be counter-screened against native tetrameric TTR, as described in the examples or otherwise.
- antibodies can also be screened for their immunoreactivity on TTR- mediated amyloidosis tissue but not on healthy tissue. Such screens are sometimes performed in competition with an exemplary antibody, such as an antibody having the variable regions of 9D5 or of 18C5 or IgGl kappa isotype.
- either the antibody or TTR target is immobilized in such assay.
- Functional assays can be performed in cellular models including cells naturally expressing TTR or transfected with DNA encoding TTR or a fragment thereof. Suitable cells include cells derived from cardiac tissue or other tissues affected by TTR amyloidogenesis. Cells can be screened for reduced levels of monomeric, misfolded, aggregated, or fibril forms of TTR (e.g., by Western blotting or immunoprecipitation of cell extracts or supernatants) or reduced toxicity attributable to monomeric, misfolded, aggregated, or fibril forms of TTR. For example, antibodies can be tested for the ability to inhibit or reduce aggregation of TTR, inhibit or reduce TTR fibril formation, reduce TTR deposits, clear aggregated TTR, or stabilize nontoxic conformations of TTR.
- Other functional assays can be performed in solution, such as testing whether an antibody is capable of disrupting or reducing TTR fibril formation when monomeric TTR or misfolded TTR intermediates in solution are contacted with the antibody.
- the extent of fibril formation can be probed by turbidity measurements, for example, at 400 nm on a UV-visible spectrometer equipped with a temperature control unit.
- Thioflavin-T can also be used to assess the extent of amyloid fibril formation. For example, a five-fold molar excess of Thioflavin-T can be added to TTR samples and left at room temperature for 30 minutes before measurements are taken.
- Thioflavin-T fluorescence can be monitored using a spectrofluorimeter. See US 2014/0056904. [0308] Animal model screens test the ability of the antibody to therapeutically or
- TTR amyloidosis such as wild-type ATTR amyloidosis (also called senile systemic amyloidosis SSA), senile cardiac amyloidosis (SCA), familial amyloid polyneuropathy (FAP), familial amyloid cardiomyopathy (FAC), and central nervous system selective amyloidosis (CNSA).
- Suitable signs or symptoms that can be monitored include the presence and extent of amyloid deposits in various tissues, such as the gastrointestinal tract or heart.
- the extent of reduction of amyloid deposits can be determined by comparison with an appropriate control, such the level of TTR amyloid deposits in control animals that have received a control antibody (e.g., an isotype matched control antibody), a placebo, or no treatment at all.
- An exemplary animal model for testing activity against a TTR amyloidosis is a mouse model carrying a null mutation at the endogenous mouse Ttr locus and the human mutant TTR gene comprising a V30M mutation that is associated with familial amyloidotic polyneuropathy. See, e.g., Kohno et al, Am. J. Path. 150(4): 1497-1508 (1997); Cardoso and Saraiva, FASEB J 20(2):234-239 (2006).
- Transgenic animals can include a human TTR transgene, such as a TTR transgene with a mutation associated with TTR amyloidosis or a wild-type TTR transgene.
- a human TTR transgene such as a TTR transgene with a mutation associated with TTR amyloidosis or a wild-type TTR transgene.
- chimeric antibodies having a constant region appropriate for the animal model can be used ⁇ e.g., mouse-rat chimeras could be used for testing antibodies in rats).
- a humanized version of an antibody will be effective if the corresponding mouse antibody or chimeric antibody is effective in an appropriate animal model and the humanized antibody has similar binding affinity ⁇ e.g., within experimental error, such as by a factor of 1.5, 2, or 3).
- the invention further provides nucleic acids encoding any of the heavy and light chains described above ⁇ e.g., SEQ ID NOs: 2, 4, 18, and 20).
- nucleic acids further encode a signal peptide and can be expressed with the signal peptide linked to the constant region ⁇ e.g., signal peptides having amino acid sequences of SEQ ID NOs:35 (heavy chain) and 37 (light chain) that can be encoded by SEQ ID NOs:36 (heavy chain) and 38 (light chain), respectively.
- Coding sequences of nucleic acids can be operably linked with regulatory sequences to ensure expression of the coding sequences, such as a promoter, enhancer, ribosome binding site, transcription termination signal, and the like.
- the nucleic acids encoding heavy and light chains can occur in isolated form or can be cloned into one or more vectors.
- the nucleic acids can be synthesized by, for example, solid state synthesis or PCR of overlapping
- Nucleic acids encoding heavy and light chains can be joined as one contiguous nucleic acid, e.g., within an expression vector, or can be separate, e.g., each cloned into its own expression vector.
- Conjugated antibodies that specifically bind to antigens exposed in pathogenic forms of TTR but not in native tetrameric form of TTR, such as amino acid residues 89-97 (SEQ ID NO:45) or amino acid residues 101-109 (SEQ ID NO:30) of TTR, are useful in detecting the presence of monomeric, misfolded, aggregated, or fibril forms of TTR; monitoring and evaluating the efficacy of therapeutic agents being used to treat patients diagnosed with a TTR amyloidosis; inhibiting or reducing aggregation of TTR; inhibiting or reducing TTR fibril formation; reducing or clearing TTR deposits; stabilizing non-toxic conformations of TTR; or treating or effecting prophylaxis of a TTR amyloidosis in a patient.
- such antibodies can be conjugated with other therapeutic moieties, other proteins, other antibodies, and/or detectable labels. See WO 03/057838; US 8,455,622.
- Conjugated therapeutic moieties can be any agent that can be used to treat, combat, ameliorate, prevent, or improve an unwanted condition or disease in a patient, such as a TTR amyloidosis.
- Therapeutic moieties can include, for example, immunomodulators or any biologically active agents that facilitate or enhance the activity of the antibody.
- An immunomodulator can be any agent that stimulates or inhibits the development or maintenance of an immunologic response. If such therapeutic moieties are coupled to an antibody specific for monomelic, misfolded, aggregated, or fibril forms of TTR, such as the antibodies described herein, the coupled therapeutic moieties will have a specific affinity for non-native, pathogenic forms of TTR over native tetrameric form of TTR.
- conjugated antibodies directly targets tissues comprising pathogenic forms of TTR with minimal damage to surrounding normal, healthy tissue. This can be particularly useful for therapeutic moieties that are too toxic to be administered on their own. In addition, smaller quantities of the therapeutic moieties can be used.
- Suitable therapeutic moieties include drugs that reduce levels of TTR, stabilize the native tetrameric structure of TTR, inhibit aggregation of TTR, disrupt TTR fibril or amyloid formation, or counteract cellular toxicity. See, e.g., Almeida and Saraiva, FEBS Letters 586:2891-2896 (2012); Saraiva, FEBS Letters 498:201-203 (2001); Ando et al, Orphanet Journal of Rare Diseases 8:31 (2013); Ruberg and Berk, Circulation 126: 1286-1300 (2012); Johnson et al, J. Mol. Biol. 421(2-3): 185-203 (2012, Ueda and Ando, Translational
- antibodies can be conjugated to tafamidis, diflunisal, AGIO, ALN-TTROl,
- ALNTTR02 antisense oligonucleotides such as IONIS TTRRx (inotersen), siRNAs such as patisiran or revusiran, doxycycline (doxy), tauroursodeoxycholic acid (TUDCA), Doxy- TUDCA, cyclodextrin (CyD), 4'-iodo-4'-deoxydoxorubicin (IDOX), epigallocatechin gallate (EGCG), curcumin, resveratrol (3,5,4'-trihydroxystilbene), or antibodies to serum amyloid P component (SAP).
- IONIS TTRRx inotersen
- siRNAs such as patisiran or revusiran
- doxycycline doxy
- TUDCA tauroursodeoxycholic acid
- CyD cyclodextrin
- IDOX 4'-iodo-4'-deoxydoxorubicin
- EGCG epigallocatechin
- TTR amyloidosis or symptoms of a TTR amyloidosis.
- Other representative therapeutic moieties include other agents known to be useful for treatment, management, or amelioration of a TTR amyloidosis or symptoms of a TTR amyloidosis. See, e.g., Ando et al, Orphanet Journal of Rare Diseases 8:31 (2013) for common clinical symptoms of TTR amyloidosis and typical agents used to treat those symptoms.
- Antibodies can also be coupled with other proteins.
- antibodies can be coupled with Fynomers.
- Fynomers are small binding proteins ⁇ e.g., 7 kDa) derived from the human Fyn SH3 domain. They can be stable and soluble, and they can lack cysteine residues and disulfide bonds.
- Fynomers can be engineered to bind to target molecules with the same affinity and specificity as antibodies. They are suitable for creating multi-specific fusion proteins based on antibodies.
- Fynomers can be fused to N-terminal and/or C- terminal ends of antibodies to create bi- and tri-specific FynomAbs with different architectures.
- Fynomers can be selected using Fynomer libraries through screening technologies using FACS, Biacore, and cell-based assays that allow efficient selection of Fynomers with optimal properties. Examples of Fynomers are disclosed in Grabulovski et a/., J. Biol. Chem. 282:3196-3204 (2007); Bertsc ger et al, Protein Eng. Des. Sel. 20:57-68 (2007); Schlatter et a/., MAbs. 4:497-508 (2011); Banner et a/., Acta. Crystallogr. D. Biol. Crystallogr. 69(Pt6): 1124-1137 (2013); and Brack et al, Mol. Cancer Ther. 13:2030-2039 (2014).
- the antibodies disclosed herein can also be coupled or conjugated to one or more other antibodies ⁇ e.g., to form antibody heteroconjugates).
- Such other antibodies can bind to different epitopes within TTR or a portion thereof or can bind to a different target antigen.
- anti-TTR antibodies binding to TTR epitopes different from that of 9D5 or 18C5, may include antibodies as in Table 3.
- Antibodies can also be coupled with a detectable label. Such antibodies can be used, for example, for diagnosing a TTR amyloidosis, for monitoring progression of a TTR amyloidosis, and/or for assessing efficacy of treatment. Such antibodies are particularly useful for performing such determinations in subjects having or being susceptible to a TTR amyloidosis, or in appropriate biological samples obtained from such subjects.
- Representative detectable labels that may be coupled or linked to an antibody disclosed herein include various enzymes, such as horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase;
- prosthetic groups such streptavidin, avidin or biotin; fluorescent materials, such as
- detectable labels that may be coupled or linked to an antibody disclosed herein include electrochemiluminescent labels, for example MSD GOLD SULFO- TAG HS-Ester (SULFO-TAG) (Meso Scale Diagnostics, Rockville, MD).
- electrochemiluminescent labels for example MSD GOLD SULFO- TAG HS-Ester (SULFO-TAG) (Meso Scale Diagnostics, Rockville, MD).
- Linkage of radioisotopes to antibodies may be performed with conventional bifunction chelates.
- sulfur-based linkers may be used for radiosilver-111 and radiosilver-199 linkage. See Hazra et al., Cell Biophys. 24-25: 1-7 (1994).
- Linkage of silver radioisotopes may involve reducing the immunoglobulin with ascorbic acid.
- ibritumomab tiuxetan can be used and will react with such isotopes to form 11 lln-ibritumomab tiuxetan and 90Y-ibritumomab tiuxetan, respectively. See Witzig, Cancer Chemother.
- Therapeutic moieties, other proteins, other antibodies, and/or detectable labels may be coupled or conjugated, directly or indirectly through an intermediate ⁇ e.g., a linker), to a murine, chimeric, veneered, or humanized 9D5 or 18C5 antibody using techniques known in the art. See e.g., Arnon et al., "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy," in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc.
- Suitable linkers include, for example, cleavable and non-cleavable linkers. Different linkers that release the coupled therapeutic moieties, proteins, antibodies, and/or detectable labels under acidic or reducing conditions, on exposure to specific proteases, or under other defined conditions can be employed. V. Therapeutic Applications
- the above antibodies can be used for treating or effecting prophylaxis of a disease in a patient having or at risk for the disease mediated at least in part by transthyretin (TTR), and particularly by monomeric, misfolded, aggregated, or fibril forms of TTR.
- TTR transthyretin
- any or all of the following mechanisms may contribute to treatment of TTR amyloidosis using the above antibodies: antibody-mediated inhibition of TTR aggregation and fibril formation, antibody- mediated stabilization of non-toxic conformations of TTR (e.g., tetrameric forms), or antibody- mediated clearance of aggregated TTR, oligomeric TTR, or monomeric TTR.
- Antibody-drug conjugates can have additional mechanisms of action determined by the conjugated moiety.
- Antibodies are administered in an effective regime meaning a dosage, route of administration and frequency of administration that delays the onset, reduces the severity, inhibits further deterioration, and/or ameliorates at least one sign or symptom of a disorder being treated.
- the regime can be referred to as a therapeutically effective regime.
- the patient is at elevated risk of the disorder relative to the general population but is not yet experiencing symptoms, the regime can be referred to as a prophylactically effective regime.
- therapeutic or prophylactic efficacy can be observed in an individual patient relative to historical controls or past experience in the same patient.
- therapeutic or prophylactic efficacy can be demonstrated in a preclinical or clinical trial in a population of treated patients relative to a control population of untreated patients.
- the frequency of administration depends on the half-life of the antibody in the circulation, the condition of the patient and the route of administration among other factors.
- the frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the disorder being treated.
- An exemplary frequency for intravenous administration is between weekly and quarterly over a continuous cause of treatment, although more or less frequent dosing is also possible.
- An exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
- the number of dosages administered depends on whether the disorder is acute or chronic and the response of the disorder to the treatment. For acute disorders or acute exacerbations of a chronic disorder, between 1 and 10 doses are often sufficient.
- a single bolus dose is sufficient for an acute disorder or acute exacerbation of a chronic disorder. Treatment can be repeated for recurrence of an acute disorder or acute exacerbation.
- an antibody can be administered at regular intervals, e.g., weekly, fortnightly, monthly, quarterly, every six months for at least 1, 5 or 10 years, or the life of the patient.
- TTR transthyretin
- TTR amyloidosis examples include familial TTR amyloidoses, such as familial amyloid cardiomyopathy (FAC), familial amyloid polyneuropathy (FAP), or central nervous system selective amyloidosis (CNSA), and sporadic TTR amyloidoses, such as senile systemic amyloidosis (SSA) or senile cardiac amyloidosis (SCA).
- FAC familial amyloid cardiomyopathy
- FAP familial amyloid polyneuropathy
- CNSA central nervous system selective amyloidosis
- SSA senile systemic amyloidosis
- SCA senile cardiac amyloidosis
- Antibodies described above can be incorporated into a pharmaceutical composition for use in such methods.
- an antibody or pharmaceutical composition containing an antibody is administered to a subject in need thereof.
- Patients amenable to treatment include individuals at risk of TTR amyloidosis but not showing symptoms, as well as patients presently showing
- the pharmaceutical compositions can be administered prophylactically to individuals who have a known genetic risk of TTR amyloidosis.
- individuals include those having relatives who have experienced such a disease, and those whose risk is determined by analysis of genetic or biochemical markers (e.g., mutations in TTR associated with TTR amyloidosis), including using the diagnostic methods provided herein.
- genetic or biochemical markers e.g., mutations in TTR associated with TTR amyloidosis
- TTR amyloidosis Individuals suffering from TTR amyloidosis can sometimes be recognized from the clinical manifestations of TTR amyloidosis, including one or more of the following: (1) family history of neuropathic disease, especially associated with heart failure; (2) neuropathic pain or progressive sensory disturbances of unknown etiology; (3) carpal tunnel syndrome without obvious cause, particularly if it is bilateral and requires surgical release; (4) gastrointestinal motility disturbances or autonomic nerve dysfunction of unknown etiology (e.g., erectile dysfunction, orthostatic hypotension, neurogenic bladder); (5) cardiac disease characterized by thickened ventricular walls in the absence of hypertension; (6) advanced atrio-ventricular block of unknown origin, particularly when accompanied by a thickened heart; and (6) vitreous body inclusions of the cotton-wool type.
- family history of neuropathic disease especially associated with heart failure
- neuropathic pain or progressive sensory disturbances of unknown etiology (3) carpal tunnel syndrome without obvious cause, particularly if it is bilateral
- TTR amyloidosis typically relies on target organ biopsies, followed by histological staining of the excised tissue with the amyloid-specific dye, Congo red. If a positive test for amyloid is observed, immunohistochemical staining and mass spectroscopic identification of TTR are subsequently performed to ensure that the precursor protein responsible for amyloid formation is indeed TTR. For familial forms of the diseases, demonstration of a mutation in the gene encoding TTR is then needed before a definitive diagnosis can be made.
- the identification of the subject can occur in a clinical setting, or elsewhere, such as in the subject's home, for example, through the subject's own use of a self-testing kit.
- the subject can be identified based on various symptoms such as peripheral neuropathy (sensory and motor), autonomic neuropathy, gastrointestinal impairment, cardiomyopathy, nephropathy, or ocular deposition. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013).
- the subject can also be identified by increased levels of non-native forms of TTR in plasma samples from the subject compared to control samples, as disclosed in the examples.
- treatment can begin at any age (e.g., 20, 30, 40, 50, 60, or 70 years of age). Treatment typically entails multiple dosages over a period of time and can be monitored by assaying antibody or activated T-cell or B-cell responses to a therapeutic agent (e.g., a truncated form of TTR comprising amino acid residues 89-97 or comprising amino acid residues 101-109) over time. If the response falls, a booster dosage is indicated.
- a therapeutic agent e.g., a truncated form of TTR comprising amino acid residues 89-97 or comprising amino acid residues 101-109
- an antibody or a pharmaceutical composition of the same is administered to a subject susceptible to, or otherwise at risk of a disease (e.g., TTR amyloidosis) in a regime (dose, frequency and route of administration) effective to reduce the risk, lessen the severity, or delay the onset of at least one sign or symptom of the disease.
- a disease e.g., TTR amyloidosis
- an antibody or immunogen to induce an antibody is administered to a subject suspected of, or already suffering from a disease (e.g., TTR amyloidosis) in a regime (dose, frequency and route of administration) effective to ameliorate or at least inhibit further deterioration of at least one sign or symptom of the disease.
- a regime is considered therapeutically or prophylactically effective if an individual treated subject achieves an outcome more favorable than the mean outcome in a control population of comparable subjects not treated by methods disclosed herein, or if a more favorable outcome is demonstrated for a regime in treated subjects versus control subjects in a controlled clinical trial (e.g., a phase II, phase II/III, or phase III trial) or an animal model at the p ⁇ 0.05 or 0.01 or even 0.001 level.
- a controlled clinical trial e.g., a phase II, phase II/III, or phase III trial
- An effective regime of an antibody can be used for, e.g., inhibiting or reducing aggregation of TTR in a subject having or at risk of a condition associated with TTR
- TTR fibril formation in a subject having or at risk of a condition associated with TTR accumulation; reducing or clearing TTR deposits or aggregated TTR in a subject having or at risk of a condition associated with TTR accumulation; stabilizing non-toxic conformations of TTR in a subject having or at risk of a condition associated with TTR accumulation; inhibiting toxic effects of TTR aggregates, fibrils or deposits in a subject having or at risk of a condition associated with TTR accumulation; diagnosing the presence or absence of TTR amyloid accumulation in a tissue suspected of comprising the amyloid accumulation; determining a level of TTR deposits in a subject by detecting the presence of bound antibody in the subject following administration of the antibody; detecting the presence of monomelic, misfolded, aggregated, or fibril forms of TTR in a subject; monitoring and evaluating the efficacy of therapeutic agents being used to treat patients diagnosed with a TTR amyloidosis; inducing an immune response comprising antibodies to TTR in a subject; delaying the
- An exemplary dose range for antibodies can be from about 0.1-20, or 0.5-5 mg/kg body weight (e.g., 0.5, 1, 2, 3, 4 or 5 mg/kg) or 10-1500 mg as a fixed dosage. The dosage depends on the condition of the patient and response to prior treatment, if any, whether the treatment is prophylactic or therapeutic and whether the disorder is acute or chronic, among other factors.
- Antibody can be administered in such doses daily, on alternative days, weekly, fortnightly, monthly, quarterly, or according to any other schedule determined by empirical analysis.
- An exemplary treatment entails administration in multiple doses over a prolonged period, for example, of at least six months. Additional exemplary treatment regimes entail administration once per every two weeks or once a month or once every 3 to 6 months.
- Antibodies can be administered via a peripheral route. Routes of administration include topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intrathecal, intraperitoneal, intranasal or intramuscular. Routes for administration of antibodies can be intravenous or subcutaneous. Intravenous administration can be, for example, by infusion over a period such as 30-90 min. This type of injection is most typically performed in the arm or leg muscles. In some methods, agents are injected directly into a particular tissue where deposits have accumulated, for example intracranial injection.
- compositions for parenteral administration can be sterile and substantially isotonic (250-350 mOsm/kg water) and manufactured under GMP conditions.
- Pharmaceutical compositions can be provided in unit dose form (i.e., the dose for a single administration).
- compositions can be formulated using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries.
- the formulation depends on the route of
- antibodies can be formulated in aqueous solutions, e.g., in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline or acetate buffer (to reduce discomfort at the site of injection).
- physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline or acetate buffer (to reduce discomfort at the site of injection).
- the solution can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- antibodies can be in lyophilized form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- regimes can be administered in combination with, concomitantly with, or
- agents can include siRNA to inhibit expression of TTR or Vyndaqel, a stabilizer of TTR in tetramer formation.
- agents can include TTR tetramer stabilizers such as tafamidis or diflunisal (see, .e.g., WO2011116123, US Patent No. 9,150,489), gene therapies to suppress TTR expression such as antisense oligonucleotides such as IONIS-TTRRx (inotersen) (see, e.g., U.S. Patent Nos. 8,101,743, 8,697,860, 9,061,044, and 9,399,774; Japanese Patent No.
- siRNAs such as patisiran or revusiran (see, e.g., WO2016033326), amyloid degrader compounds such as doxycycline (doxy), tauroursodeoxycholic acid (TUDCA), Doxy-TUDCA, cyclodextrin (CyD), 4'-iodo-4'-deoxydoxorubicin (IDOX), or antibodies to serum amyloid P component (SAP).
- doxy doxycycline
- TUDCA tauroursodeoxycholic acid
- CyD cyclodextrin
- IDOX 4'-iodo-4'-deoxydoxorubicin
- SAP serum amyloid P component
- Another agent effective in treatment or prophylaxis of the disease being treated may be administered to a subject who has previously been treated with an antibody disclosed herein.
- the subject treated with another agent effective in treatment or prophylaxis of the disease being treated may no longer be receiving treatment with an antibody disclosed herein.
- Treatment with antibodies disclosed herein can be combined with other treatments effective against the disorder being treated. Combination treatments can be formulated together or administered separately. Some examples of treatments useful for combination therapies include a second anti-TTR antibody that binds an epitope different from that of 9D5 or 18C5, for example an antibody as disclosed in Table 3.
- the subject's condition can be evaluated to determine the progress or efficacy of such treatment.
- Such methods preferably test for changes in TTR amyloid levels or levels of non-native forms of TTR.
- TTR amyloid levels may be evaluated to determine improvement relative to the subject's TTR amyloid levels under comparable circumstances prior to treatment.
- the subject's TTR amyloid levels can also be compared with control populations under comparable circumstances.
- the control populations can be similarly afflicted, untreated subjects or normal untreated subjects (among other control subjects). Improvement relative to similarly afflicted, untreated subjects or levels approaching or reaching the levels in untreated normal subjects indicates a positive response to treatment.
- TTR amyloid levels can be measured by a number of methods, including imaging techniques.
- imaging techniques include PET scanning with radiolabeled TTR of fragments thereof, TTR antibodies or fragments thereof, Congo-red-based amyloid imaging agents, such as, e.g., PIB (US 2011/0008255), amyloid-imaging peptide p31
- the methods can be used to monitor a course of therapeutic and prophylactic treatment with the agents provided herein.
- the antibody profile following passive immunization typically shows an immediate peak in antibody concentration followed by an exponential decay. Without a further dose, the decay approaches pretreatment levels within a period of days to months depending on the half-life of the antibody administered. For example, the half-life of some human antibodies is of the order of 20 days.
- a baseline measurement of antibody to TTR in the subject is made before administration, a second measurement is made soon thereafter to determine the peak antibody level, and one or more further measurements are made at intervals to monitor decay of antibody levels.
- administration of a further dose of antibody is administered.
- peak or subsequent measured levels less background are compared with reference levels previously determined to constitute a beneficial prophylactic or therapeutic treatment regime in other subjects. If the measured antibody level is significantly less than a reference level (e.g., less than the mean minus one or, preferably, two standard deviations of the reference value in a population of subjects benefiting from treatment) administration of an additional dose of antibody is indicated.
- TTR amyloid or pathogenic forms of TTR e.g., monomeric, misfolded, aggregated, or fibril forms of TTR
- Such methods are useful to diagnose or confirm diagnosis of diseases associated with such pathogenic forms of TTR (e.g., TTR amyloidosis), or susceptibility thereto.
- the methods can also be used on asymptomatic subjects.
- the presence of monomeric, misfolded, aggregated, or fibril forms of TTR indicates susceptibility to future symptomatic disease.
- the methods are also useful for monitoring disease progression and/or response to treatment in subjects who have been previously diagnosed with a TTR
- Biological samples obtained from a subject having, suspected of having, or at risk of having a TTR amyloidosis can be contacted with the antibodies disclosed herein to assess the presence of monomeric, misfolded, aggregated, or fibril forms of TTR.
- levels of monomeric, misfolded, aggregated, or fibril forms of TTR in such subjects may be compared to those present in healthy subjects.
- levels of TTR amyloid or pathogenic forms of TTR e.g., monomeric, misfolded, aggregated, or fibril forms of TTR
- TTR amyloid or pathogenic forms of TTR e.g., monomeric, misfolded, aggregated, or fibril forms of TTR
- ELISA assays can also be used, for example, for assessing levels of monomeric, misfolded, aggregated, or fibril forms of TTR in fluid samples.
- Some such ELISA assays involve anti-TTR antibodies that preferentially bind monomeric, misfolded, aggregated, or fibril forms of TTR relative to native tetrameric form of TTR.
- Some such tests are sandwich immunoassays.
- Some such immunoassays employ the Meso Scale Discovery (MSD) electrochemiluminescence platform (Meso Scale Diagnostics, Rockville, MD.)
- MSD Meso Scale Discovery
- Some such immunoassays use electrochemiluminescent labels on reporter antibodies, e.g., MSD Assays (Meso Scale Diagnostics, Rockville, MD.)
- the reporter antibody can be labeled with a SULFO-TAG label ((Meso Scale Diagnostics, Rockville, MD).
- Plates useful in electrochemiluminescent assays may incorporate electrodes (e.g., MSD plates (Meso Scale Diagnostics, Rockville, MD).
- Plates useful in electrochemiluminescent assays may incorporate electrodes in the bottom of each well (e.g., MSD plates, (Meso Scale Diagnostics, Rockville, MD).
- Some assays employ a labeled capture antibody.
- the labeled capture antibody can be 9D5 or 18C5 or a humanized, chimeric, or veneered variant thereof.
- Some assays employ a labeled reporter antibody.
- the labeled reporter antibody can be 9D5 or 18C5 or a humanized, chimeric, or veneered variant thereof.
- the labeled reporter antibody can also be an antibody of Table 3, or a humanized, chimeric, or veneered variant thereof.
- the labeled reporter antibody can be an antibody that binds TTR with no conformational specificity. In an embodiment, the antibody that binds TTR with no
- conformational specificity can be 8C3 or 7G7 or a humanized, chimeric, or veneered variant thereof (See, e.g., WO 2016/120811).
- the antibody that binds TTR with no conformational specificity can be a polyclonal antibody.
- the polyclonal antibody is a polyclonal rabbit anti-human prealbumin (Cat. No. A000202-2, Dako, Agilent Technologies, Inc, Santa Clara, CA).
- the polyclonal rabbit anti-TTR antibody is Sigma, Catalog No. HPA002550 (Sigma-Aldrich, St. Louis, MO),
- Some assays detect all misfolded TTR in a sample (i.e., all misfolded forms of TTR including monomers and multimers). Other assays specifically detect monomeric misfolded TTR or multimeric misfolded TTR. Other assays detect all forms of TTR (misfolded forms and native tetrameric form).
- Some such assays employ a capture antibody that specifically binds to an epitope within residues 89-97 of TTR or an epitope within residues 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR; wherein if misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex; and wherein detection of the reporter antibody that binds to the misfolded TTR, if any, indicates presence or absence of all the misfolded forms of TTR present in the sample.
- Such reporter antibodies can include 18C5, 9D5, 14G8, 5A1, 6C1, AD7F6, RT24, NI-301.35G11, MFD101, MDF102, MFD103, MFD105, MFD107, MFD108, MFD109,
- reporter antibodies can include an antibody which binds within residues 89-97, 101-109, 118-122, 115- 124, 53-63, 54-61, 36-49, 49-61, 109-121, 30-66, 70-127, 80-127, 90-127, 100-127, 110-127, or 115-127 of TTR.
- reporter antibodies can include 8C3 or 7G7 (see, e.g., WO 2016/120811).
- Such reporter antibodies can include a polyclonal rabbit anti-hum n prealbumin (Cat. No.
- TTR tumor necrosis virus
- A000202-2 Dako, Agilent Technologies, Inc, Santa Clara, CA
- a polyclonal rabbit anti-TTR antibody Sigma, Catalog No. HPA002550, Sigma-Aldrich, St. Louis, MO.
- Some such assays detect misfolded forms of TTR in a biological sample from hereditary TTR amyloidosis patients carrying a mutation at position 89 within the 9D5 epitope of TTR. Exemplary mutations are E89K TTR and E89Q TTR.
- Some such assays employ a 9D5 capture antibody and a polyclonal anti-TTR reporter antibody or an 18C5 reporter antibody.
- Some assays detect multimeric forms of misfolded TTR in a sample. Such assays can be configured to detect multimeric misfolded TTR preferentially or exclusively over monomeric misfolded TTR. Some such assays employ a capture antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR and a reporter antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR. Such a combination of capture and reporter antibodies can bind preferentially or exclusively to multimeric TTR over monomeric because the multiple copies of TTR provide multiple epitopes for antibody binding.
- Detection of reporter antibody binding to multimeric misfolded TTR indicates presence or absence of the multimeric misfolded TTR.
- the reporter antibody competes for binding TTR with the capture antibody and/or the reporter and capture antibody bind to the same or overlapping epitope of TTR.
- the capture antibody binds a first misfolded TTR molecule in the multimeric misfolded TTR, and the reporter antibody binds a second misfolded TTR molecule in the multimeric misfolded TTR.
- the antibodies disclosed herein can be used in a method of determining a ratio of the level of total multimeric misfolded transthyretin (TTR) to the level of total misfolded TTR in a biological sample.
- TTR transthyretin
- a first portion of a biological sample can be assayed for all misfolded TTR in a sample (i.e., all misfolded forms of TTR including monomers and multimers) in a first assay wherein monomeric misfolded and multimeric misfolded TTR are detected.
- the first assay can employ a capture antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR.
- misfolded TTR If misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the misfolded TTR forming a sandwich complex. Detection of the reporter antibody that binds to the misfolded TTR, if any, indicates presence or absence of the misfolded TTR in the sample.
- a second portion of a biological sample can be assayed for multimeric forms of misfolded TTR a biological sample in a second assay that detects multimeric misfolded TTR preferentially over monomeric misfolded TTR.
- the second assay can employ a capture antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR and a reporter antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR. If multimeric misfolded TTR is present in the sample, the capture antibody and reporter antibody bind to the multimeric misfolded TTR forming a sandwich complex. The capture and the reporter antibody can bind simultaneously preferentially or exclusively to the multimeric misfolded TTR, if any, to indicate presence or absence of the multimeric misfolded TTR. In some such assays, the reporter antibody competes for binding TTR with the capture antibody or binds to the same or overlapping epitope as the capture antibody.
- the capture antibody binds a first misfolded TTR molecule in the multimeric misfolded TTR
- the reporter antibody binds a second misfolded TTR molecule in the multimeric misfolded TTR.
- Competition for binding between the capture and the reporter antibodies precludes or at least reduces (depending on whether competition is the result of overlapping epitopes or steric hindrance) simultaneous binding and detection of monomeric misfolded TTR.
- detection of the reporter antibody binding that binds to the second misfolded TTR molecule in the multimeric TTR indicates presence or absence of multimeric misfolded TTR.
- a ratio of multimeric misfolded TTR to all misfolded TTR is calculated.
- the antibodies disclosed herein can also be used in a method of determining a ratio of the level of all misfolded TTR to total TTR (misfolded forms and native tetrameric form) in a biological sample.
- a first portion of a biological sample can be assayed for all misfolded TTR in a sample (i.e., all misfolded forms of TTR including monomers and multimers), in a first assay wherein monomeric misfolded and multimeric misfolded TTR are detected.
- the first assay can employ a capture antibody that specifically binds to an epitope within residues 89-97 or 101-109 of TTR and a reporter antibody that specifically binds to a different epitope of TTR.
- a second portion of a biological sample can be assayed for total TTR (misfolded forms and native tetrameric form) in a second assay wherein total TTR is detected.
- the second assay can employ a capture antibody that binds TTR with no conformational specificity and a reporter antibody that binds TTR with no conformational specificity. If TTR is present in the sample, the capture antibody and reporter antibody bind to the TTR forming a sandwich complex.
- Detection of the reporter antibody binding to the TTR indicates presence or absence of TTR present in the sample.
- a ratio of all misfolded TTR to total TTR (misfolded forms and native tetrameric form) can be calculated.
- the in vivo imaging methods can work by administering a reagent, such as antibody that binds to monomeric, misfolded, aggregated, or fibril forms of TTR in the subject, and then detecting the reagent after it has bound.
- a reagent such as antibody that binds to monomeric, misfolded, aggregated, or fibril forms of TTR in the subject.
- Such antibodies typically bind to an epitope within residues 89-97 or 101-109 of TTR.
- the clearing response can be avoided by using antibody fragments lacking a full length constant region, such as Fabs.
- the same antibody can serve as both a treatment and diagnostic reagent.
- Diagnostic reagents can be administered by intravenous injection into the body of the subject, or via other routes deemed reasonable.
- the dose of reagent should be within the same ranges as for treatment methods.
- the reagent is labeled, although in some methods, the primary reagent with affinity for monomeric, misfolded, aggregated, or fibril forms of TTR is unlabeled and a secondary labeling agent is used to bind to the primary reagent.
- the choice of label depends on the means of detection. For example, a fluorescent label is suitable for optical detection. Use of paramagnetic labels is suitable for tomographic detection without surgical intervention. Radioactive labels can also be detected using PET or SPECT.
- Diagnosis is performed by comparing the number, size, and/or intensity of labeled loci to corresponding base line values.
- the base line values can represent the mean levels in a population of undiseased individuals. Base line values can also represent previous levels determined in the same subject. For example, base line values can be determined in a subject before beginning treatment, and measured values thereafter compared with the base line values. A decrease in values relative to base line generally signals a positive response to treatment.
- the change of values, if any, in a patient is compared with the change of values, if any, in a representative control population of patients not undergoing treatment.
- a difference in response in a particular patient from the normal response in the control patient e.g., mean plus variance of a standard deviation
- Changes in the above TTR parameters can also be combined with other change(s) in signs or symptoms such as side effects in determining whether and how to adjust treatment.
- monitoring indicates that the amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding is the same or greater than previously detected.
- the treatment regime can be continued as is or even increased in frequency of administration and/or dose if not already at the maximum recommended dose.
- monitoring indicates a detectable decline in amount of misfolded TTR, misfolded multimeric TTR, transthyretin deposits, anti-TTR antibody binding or the like but that amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding remains above normal.
- the treatment regime can be continued as is or even increased in frequency of administration and/or dose if not already at the maximum recommended dose.
- the treatment regime can be discontinued and replaced with treatment with other agents, such as a TTR tetramer stabilizer, an antisense oligonucleotide based therapeutic, an RNA interference (RNAi) based therapeutic or doxycycline plus tauroursodeoxycholic acid.
- agents such as a TTR tetramer stabilizer, an antisense oligonucleotide based therapeutic, an RNA interference (RNAi) based therapeutic or doxycycline plus tauroursodeoxycholic acid.
- the treatment regime can be adjusted from one of induction (i.e., that reduces the level of amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding) to one of maintenance (i.e., that maintains amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding at an approximately constant level).
- induction i.e., that reduces the level of amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding
- maintenance i.e., that maintains amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding at an approximately constant level
- Such a regime can be effected by reducing the dose and or frequency of administering the treatment.
- the treatment regime can be discontinued and replaced with treatment with other agents, such as a TTR tetramer stabilizer, an antisense oligonucleotide based therapeutic, an RNA interference (RNAi) based therapeutic or doxycycline plus tauroursodeoxycholic acid.
- RNAi RNA interference
- monitoring can indicate that the treatment regime is having some beneficial effect but a suboptimal effect.
- An optimal effect can be defined as a percentage reduction in amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding within the top half or quartile of the change in amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or amount of anti-TTR antibody binding) experienced by a representative sample of patients undergoing the treatment regime at a given time point after commencing therapy.
- Such patients can optionally be subject to an adjustment of regime in which the dose and or frequency of administration of an agent is increased.
- the treatment regime can be discontinued and replaced with treatment with other agents, such as a TTR tetramer stabilizer, an antisense oligonucleotide based therapeutic, an RNA interference (RNAi) based therapeutic or doxycycline plus tauroursodeoxycholic acid.
- agents such as a TTR tetramer stabilizer, an antisense oligonucleotide based therapeutic, an RNA interference (RNAi) based therapeutic or doxycycline plus tauroursodeoxycholic acid.
- amount of misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding may increase in similar or greater fashion to misfolded TTR, multimeric misfolded TTR, transthyretin deposits, or anti-TTR antibody binding in patients not receiving treatment. If such increases persist over a period of time, treatment can if desired be discontinued in favor of treatment with one or more other agents.
- Diagnostic methods with antibodies disclosed herein can be performed in combination with a second anti-TTR antibody that binds an epitope different from that of 9D5 or 18C5, for example an antibody as disclosed in Table 3.
- the biological sample can be an aliquot of a larger sample, referred to as a collected sample, such that the assay can be run in a parallel manner of multiple aliquots of the collected sample.
- the test antibody competes with the capture antibody (or alternatively the reporter antibody) for binding to TTR.
- the test antibody can bind to the same epitope as the capture antibody (or the reporter antibody).
- the sandwich assay described above can be run in parallel for first and second aliquots of a collected sample, which are usually of the same volume.
- One aliquot is supplemented with the test antibody and both aliquots are supplemented with capture and reporter antibodies.
- detection of the reporter antibody as part of a sandwich provides an indication of presence and amount of misfolded TTR in a sample.
- detection of a reduced amount of reporter antibody as part of a sandwich relative to the aliquot without the test antibody provides an indication the test antibody is binding to misfolded TTR and thereby competing with either the capture or reporter antibody and reducing formation of a sandwich between the capture antibody, misfolded TTR and the reporter antibody.
- Such an assay can be performed on additional aliquots containing increasing amounts of the test antibody (as well as capture antibody) further to characterize binding of the test antibody to misfolded TTR.
- the sample can be from a subject with a TTR amyloidosis.
- the sample can be from a subject with a hereditary TTR amyloidosis.
- the subject with a hereditary TTR amyloidosis may carry a mutation selected from the group consisting of V30M, Y1 14C, G47R, S50I, E61L, T49S, F33V, A45T, E89K, E89Q, and V122I.
- the biological sample is a plasma sample.
- the assay is performed with a 9D5 or 18C5 capture antibody and a polyclonal anti-TTR reporter antibody.
- a 9D5 or 18C5 capture antibody and a polyclonal anti-TTR reporter antibody Such an assay can be used to inform on target engagement in clinical trials of an antibody intended for therapeutic use as disclosed herein.
- the test antibody is 14G8, and the assay is performed with a 9D5 or 18C5 capture antibody and a polyclonal anti-TTR reporter antibody.
- the assays disclosed herein can be used to measure pharmocodynamic effects of therapies targeting misfolded forms of TTR.
- target engagement of unbound (free) mis-TTR in a biological sample is measured after ex-vivo treatment (spiking) of a biological sample with a test antibody.
- the assays disclosed herein can also be used to measure efficacy of a test antibody in a patient. Biological samples are collected from a patient before and after treatment with a test antibody.
- target engagement of unbound (free) mis-TTR in a biological sample is measured before and after in vivo treatment of a patient with a test antibody.
- the target of the test antibody is an epitope within residues 89-97 of TTR.
- the target of the test antibody is an epitope within residues 101- 109 of TTR.
- the present methods also allow distinction of a transthyretin-mediated amyloidosis from a non-TTR amyloidosis, e.g. amyloid light-chain (AL) amyloidosis, also known as primary systemic amyloidosis.
- a transthyretin-mediated amyloidosis from a non-TTR amyloidosis, e.g. amyloid light-chain (AL) amyloidosis, also known as primary systemic amyloidosis.
- AL amyloid light-chain
- kits comprising the 9D5 or 18C5 antibodies disclosed herein and related materials, such as instructions for use (e.g., package insert).
- the instructions for use may contain, for example, instructions for administration of the antibodies and optionally one or more additional agents.
- the containers of antibodies may be unit doses, bulk packages (e.g., multi-dose packages), or sub-unit doses.
- Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage,
- Kits can also include a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It can also include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- the antibodies can be used for detecting monomeric, misfolded, aggregated, or fibril forms of transthyretin (TTR), or fragments thereof, in the context of clinical diagnosis or treatment or in research.
- TTR transthyretin
- the antibodies can be used to detect the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in a biological sample as an indication that the biological sample comprises TTR amyloid deposits.
- Binding of the antibodies to the biological sample can be compared to binding of the antibodies to a control sample.
- the control sample and the biological sample can comprise cells of the same tissue origin. Control samples and biological samples can be obtained from the same individual or different individuals and on the same occasion or on different occasions.
- a direct comparison can then be made between the biological sample(s) and the control sample(s) to determine whether antibody binding (i.e., the presence of monomeric, misfolded, aggregated, or fibril forms of TTR) to the biological sample(s) is increased, decreased, or the same relative to antibody binding to the control sample(s).
- Increased binding of the antibody to the biological sample(s) relative to the control sample(s) indicates the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in the biological sample(s). In some instances, the increased antibody binding is statistically significant.
- antibody binding to the biological sample is at least 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, or 100-fold higher than antibody binding to the control sample.
- the antibodies can be used to detect the presence of monomelic, misfolded, aggregated, or fibril forms of TTR in a biological sample to monitor and evaluate the efficacy of a therapeutic agent being used to treat a patient diagnosed with a TTR amyloidosis.
- a biological sample from a patient diagnosed with a TTR amyloidosis is evaluated to establish a baseline for the binding of the antibodies to the sample (i.e., a baseline for the presence of the monomeric, misfolded, aggregated, or fibril forms of TTR in the sample) before commencing therapy with the therapeutic agent.
- a baseline for the binding of the antibodies to the sample i.e., a baseline for the presence of the monomeric, misfolded, aggregated, or fibril forms of TTR in the sample
- multiple biological samples from the patient are evaluated on multiple occasions to establish both a baseline and measure of random variation independent of treatment.
- a therapeutic agent is then administered in a regime.
- the regime may include multiple administrations of the agent over a period of time.
- binding of the antibodies i.e., presence of monomeric, misfolded, aggregated, or fibril forms of TTR
- binding of the antibodies is evaluated on multiple occasions in multiple biological samples from the patient, both to establish a measure of random variation and to show a trend in response to immunotherapy.
- the various assessments of antibody binding to the biological samples are then compared. If only two assessments are made, a direct comparison can be made between the two assessments to determine whether antibody binding (i.e., presence of monomeric, misfolded, aggregated, or fibril forms of TTR) has increased, decreased, or remained the same between the two
- the measurements can be analyzed as a time course starting before treatment with the therapeutic agent and proceeding through the course of therapy.
- the therapeutic agent was effective in treating the TTR amyloidosis in the patient.
- the decrease in antibody binding can be statistically significant.
- binding decreases by at least 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%).
- Assessment of antibody binding can be made in conjunction with assessing other signs and symptoms of TTR amyloidosis.
- the antibodies can also be used as research reagents for laboratory research in detecting monomeric, misfolded, aggregated, or fibril forms of TTR, or fragments thereof.
- antibodies can be labeled with fluorescent molecules, spin-labeled molecules, enzymes, or radioisotopes, and can be provided in the form of kit with all the necessary reagents to perform the detection assay.
- the antibodies can also be used to purify monomeric, misfolded, aggregated, or fibril forms of TTR, or binding partners of monomelic, misfolded, aggregated, or fibril forms of TTR, e.g., by affinity chromatography.
- the antibodies can also be used for inhibiting or reducing aggregation of TTR, inhibiting or reducing TTR fibril formation, reducing or clearing TTR deposits or TTR aggregates, or stabilizing non-toxic conformations of TTR in a biological sample.
- the biological sample can comprise, for example, blood, serum, plasma, or tissue (e.g., tissue from the heart, peripheral nervous system, autonomic nervous system, kidneys, eyes, abdominal fat, or gastrointestinal tract).
- tissue e.g., tissue from the heart, peripheral nervous system, autonomic nervous system, kidneys, eyes, abdominal fat, or gastrointestinal tract.
- TTR aggregation, TTR fibril formation, or TTR deposits are inhibited or reduced by at least 10%, 20%, 25%, 30%, 40%, 50%, or 75%, (e.g., 10%-75% or 30%-70%).
- Assays for detecting fibril formation are described elsewhere herein. See also US
- Biotinylation of 9D5 1 mg/mL 9D5 in PBS was biotinylated following manufacturer's instructions with the exception of a 10M excess of NHS-biotin (Thermo-Fisher Cat. 21329) to antibody which was used instead of a 20M excess.
- SULFO-TAG of Rabbit anti-TTR pAb Antibody (Cat. No. A000202-2, Dako, Agilent Technologies, Inc, Santa Clara, CA) was diluted to 1 mg/mL in PBS then desalted using a Zeba spin column (ThermoFisher Scientific). 50 ⁇ ⁇ of cold H2O was added to SULFO-TAG to reconstitute and then the material was vortexed. 2.2 ⁇ . of reconstituted SULFO-TAG was added to 50 of diluted antibody, vortexed, incubated 2 hours at RT, and stored in the dark at 4C.
- Antibody Cat. No. A000202-2, Dako, Agilent Technologies, Inc, Santa Clara, CA
- 50 ⁇ ⁇ of cold H2O was added to SULFO-TAG to reconstitute and then the material was vortexed.
- 2.2 ⁇ . of reconstituted SULFO-TAG was added to 50 of diluted antibody, vortexe
- Results are shown in Figure 1.
- the first column (labeled h-ATTR asympto”) depicts results for asymptomatic patients with hereditary TTR amyloidosis.
- the second column (labeled h-ATTR-taf ') depicts results for patients with hereditary TTR amyloidosis treated with tafamidis.
- the third column (labeled h-ATTR-no treatment”) depicts results for untreated patients with hereditary TTR amyloidosis.
- the fourth column (labeled "h-ATTR liver TX”) depicts results for patients with hereditary TTR amyloidosis with a liver transplant.
- the fifth column depicts results for patients with wild-type ATTR amyloidosis.
- the sixth column depicts results for healthy volunteers. Points are individual data and bars are mean and SD. * 0.01-0.05, ** 0.0005-0.0099, ***0.0001-0.005, and
- Hereditary TTR amyloidosis liver transplant patients produce normally folded TTR resulting in misfolded-TTR levels that were similar to normal, healthy subjects.
- the wild-type ATTR amyloidosis patient samples with the exception of a single outlier, also had little or no detectable misfolded-TTR similar to normal plasma, suggesting that misfolding of TTR may occur locally within the affected tissue and misfolded-TTR does not readily circulate in this wild-type ATTR amyloidosis patient subset.
- Plasma samples from 12 patients with elevated levels of misfolded-TTR as measured in the free misfolded-TTR assay were selected for analysis in a target engagement experiment to show ml4G8 (mouse 14G8) reduces levels of free misfolded-TTR when spiked into patient plasma. Since 9D5 (MSD plate ligand) and ml4G8 bind to the same epitope and compete for free misfolded-TTR, the assay effectively quantitates free misfolded-TTR unbound to ml4G8 (i.e. bound to 9D5), resulting in a reduction in ECL signal detection when competed off by ml4G8 bound to misfolded-TTR.
- Neat TTR amyloidosis patient plasma was spiked with a range of ml4G8concentrations (0, 12, 40, 120, 400 or 1200 ⁇ g/mL) and incubated for 30 minutes at room temperature. Samples were diluted 1 :5 and the assay and standard curves were run as described in Example 2.
- Figure 2 shows the antibody competition curve for exemplary TTR amyloidosis patient plasma samples with elevated misfolded-TTR levels indicating free misfolded-TTR (%) levels in the presence of increasing concentrations of ml4G8.
- Example 5 ECL Method for Determination of Free Misfolded-TTR in Plasma (9D5/18C5)
- Method Free (unbound) misfolded-TTR, including monomer, was detected in human plasma using a quantitative ECL (Meso Scale Discovery; MSD) assay research method.
- MSD Meso Scale Discovery
- a 96- well MSD plate was coated with 30 ⁇ per well of 4 ⁇ g/mL neutravidin in PBS, incubated overnight at 4°C, and washed three times in TBS containing 0.05% Tween 20. Plates had nonspecific binding sites blocked with 3% MSD Blocker A in PBS for 1 hour at room temperature with shaking, then washed three times. 30 ⁇ .
- Results are shown in Figure 3.
- the first column (labeled “h-ATTR asympto”) depicts results for asymptomatic patients with hereditary TTR amyloidosis.
- the second column (labeled “h-ATTR-taf ') depicts results for patients with hereditary TTR amyloidosis treated with tafamidis.
- the third column (labeled "h-ATTR-no treatment”) depicts results for untreated patients with hereditary TTR amyloidosis.
- the fourth column (labeled "h-ATTR liver TX”) depicts results for patients with hereditary TTR amyloidosis with a liver transplant.
- the fifth column (labeled "Normal”) depicts results for normal patients.
- Points are individual data and bars are mean and SD. * 0.01-0.05, ** 0.0005-0.0099, ***0.0001-0.005, **** ⁇ 0.0001, compared to Normal control (non-parametric Kruskal-Wallis test with Dunn's multiplicity adjustment).
- TTR-DM transthyretin-double mutant
- mice were titered against the TTR-DM, Native tetrameric TTR, and his-MCAM. Mice with the highest titers to TTR-DM and lowest titers to Native tetrameric TTR and his-MCAM (BALB/c #1 and 5 and C57BL/6 #4 and 5) were fused by a modification of Kohler and Milstein. Resultant hybridomas were screened against TTR-DM, native tetrameric TTR and his-MCAM. Hybridomas showing specificity to TTR-DM were cloned and further characterized. 18C5 was identified.
- Gu-TTR Various concentrations of Gu-TTR (ranging from 0.4 nM to 100 nM) were passed over the captured ligand at 50 uL/min in running buffer (HBS + 0.05% P-20, 1 mg/mL BSA, 50mM Gu-HCl) for 300s association time and 900s dissociation time. Regeneration of the chip surface was accomplished by 2 short injections of lOmM Glycine-HCl at pH 1.7. Concentrations of Gu- cTTR used ranged from 1-1000 nM, while concentrations of Human TTR tetramer ranged from 10 nM to 10,000 nM. Data was blank subtracted to both a sensor not containing ligand and 0 nM analyte concentration. Analysis was performed using a global 1 : 1 fit with Biacore Evaluation software (v3.0) with bulk refractive index set to zero RU. Binding data are shown in Table 6.
- Gu-TTR Various concentrations of Gu-TTR (ranging from 0.4 nM to 100 nM) were passed over the captured ligand at 50 pL/min in running buffer (HBS + 0.05% P-20, 1 mg/mL BSA, 50mM Gu-HCl) for 300s association time and 900s dissociation time. Regeneration of the chip surface was accomplished by 2 short injections of 3M Magnesium Chloride or 2 short injections of lOmM Glycine-HCl at pH 1.7. Data was blank subtracted to both a sensor not containing ligand and 0 nM analyte concentration. Analysis was performed using a global 1 : 1 fit with Biacore
- a mature heavy chain variable region amino acid sequence of a chimeric 18C5 antibody is provided as SEQ ID NO:81
- a mature light chain variable region amino acid sequence of a chimeric 18C5 antibody is provided as SEQ ID NO:87
- a human heavy chain constant region amino acid sequence of SEQ ID NO: 17 is provided as SEQ ID NO: 19.
- 18C5 hybridoma clone LA89 18C5. A1.A1 frozen cell pellet was used for mRNA extraction and purification. mRNA isolation & purification was performed using Oligotex direct mRNA mini kit (Qiagen, cat# 72022) protocol. Briefly, 9xl0 6 hybridoma clone cells were lysed and homogenized in the presence of highly denaturing guanidine-isothiocyanate buffer, which inactivates RNases. Oligotex suspension was added to the lysis mix, hybridization was allowed to take place between the oligo dT30 of the oligotex particles and the poly- A tail of the mRNA.
- RNA was reverse transcribed to cDNA using Marathon cDNA amplification kit (Clontech, cat# 634913). An adaptor was ligated to the 5' terminus of the cDNA. 5' RACE method was used to amplify V regions. 5' V region consensus primers and constant region specific anchor primers were used for PCR. Amplified V regions were cloned into pTOPO cloning vector and transformed into ToplO E. coli. 15-20 individual colonies were grown up and purified plasmid was sequenced. A clone sequence was considered a genuine V region sequence if it met following criteria
- the sequence contains key features of antibody V regions
- the sequence contains definable CDRs.
- Variable region sequences determined were cloned into expression vectors and transfected into CHOs cells. Purified chimeric antibody was characterized for binding using murine 18C5 as control antibody.
- the mature heavy chain variable amino acid sequence of 18C5 is provided as SEQ ID NO:81, and the mature light chain variable amino acid sequence of 18C5 is provided as SEQ ID NO:87.
- the Kabat/Chothia Composite heavy chain CDR-H1, CDR-H2, and CDR-H3 amino acid sequences are provided as SEQ ID NOs 5, 7, and 9, respectively.
- the Kabat/Chothia Composite light chain CDR-L1, CDR-L2, and CDR-L3 amino acid sequences are provided as SEQ ID NOs 11, 13, and 15, respectively.
- Example 11 Specificity of 18C5 Demonstrated by Western Blot Analysis [0401] To demonstrate the conformational specificity of 18C5 toward non-native (denatured) TTR, a Western blot analysis was performed as follows:
- Native TTR A 1.0, 0.5, and 0.1 ⁇ g sample of recombinant human TTR in LDS sample buffer (Life Technologies) was run on a 10% NuPAGE bis-tris gel (MES buffer; 90 V, 105 min) and transferred to nitrocellulose membranes for Western blot analysis.
- MES buffer 10% NuPAGE bis-tris gel
- Denatured TTR Recombinant human TTR was prepared as described above for native TTR except the LDS sample buffer contained reducing agent and the samples were denatured by boiling prior to SDS-PAGE.
- SDS-PAGE gels were blotted onto nitrocellulose membranes (iBlot, Life Technologies), treated with blocking buffer (LI-COR, Lincoln, NE) and incubated in l .O ⁇ g /mL primary antibody, washed with lx TBS and placed in 1 :20,000 dilution of IRDye 800CW-conjugated goat-anti-mouse or anti-rabbit secondary antibody (LI-COR, Lincoln, NE), then imaged on an Odyssey CLx infrared imager (LI-COR, Lincoln, NE).
- Total misTTR total misfolded TTR
- Samples were from normal patients and patients with transthyretrin-mediated amyloidosis (ATTR).
- Patients with transthyretrin-mediated amyloidosis (ATTR) had the following TTR mutations and treatments: ATTR (V30M familial amyloid polyneuropathy (FAP)) with Liver Transplant, ATTR (V30M familial amyloid polyneuropathy (FAP)) No Treatment, ATTR (V30M familial amyloid polyneuropathy (FAP)) with Tafamidis, ATTR (Yl 14C familial amyloid polyneuropathy (FAP)) with Tafamidis, and ATTR (S50I) No Treatment.
- FAP familial amyloid polyneuropathy
- FAP familial amyloid polyneuropathy
- 96-well MSD standard plate was first coated with NeutrAvidin Protein (Thermo Fisher Scientific, Waltham, MA), followed by blocking with 3% Blocker A in PBS (MSD, Rockville, MD). Biotinylated 18C5 was then added to each well at 0.5 ⁇ g/mL to capture misfolded TTR. Plasma samples were diluted 5-fold in 1% Blocker A/PBS before transferred to the MSD plate, along with guanidine denatured TTR as reference standard. After 1 -hour incubation, misfolded TTR bound to the wells was detected with SULFO-TAGTM-labeled Polyclonal Rabbit Anti-Human TTR (Agilent Technologies, Santa Clara, CA).
- Chemiluminescence signals proportional to the amount of misfolded TTR were generated by addition of IX MSD Read Buffer and captured on a MESO SECTOR S 600 plate reader.
- Results are shown in Figure 6.
- the first column depicts results for patients with transthyretrin-mediated amyloidosis (ATTR) with either no treatment or with tafamidis.
- the second column depicts results for patients with transthyretrin-mediated amyloidosis (ATTR) with a liver transplant.
- the third column depicts results for normal patients. 18C5 detected elevated misfolded TTR in all but one of the transthyretrin-mediated amyloidosis (ATTR) patients that had not undergone a liver transplant.
- TTR Total Multimeric misfolded TTR
- Samples were from normal patients and patients with transthyretrin-mediated amyloidosis (ATTR).
- Patients with transthyretrin-mediated amyloidosis (ATTR) had the following TTR mutations and treatments: ATTR (V30M familial amyloid polyneuropathy (FAP)) with Liver Transplant, ATTR (V30M familial amyloid polyneuropathy (FAP)) No Treatment, ATTR (V30M familial amyloid polyneuropathy (FAP)) with Tafamidis, ATTR (Yl 14C familial amyloid polyneuropathy (FAP)) with Tafamidis, and ATTR (S50I) No Treatment.
- FAP familial amyloid polyneuropathy
- FAP familial amyloid polyneuropathy
- S50I No Treatment
- MSD plates were coated overnight with 4 ⁇ g/mL NeutrAvidin. Plates were blocked for 1 hour with 3% MSD Blocker A, then washed 3x with Tris Buffered Saline with 0.1% Tween-20 (TBS-T). ⁇ g/mL biotinylated 18C5 was added for 1 hour, followed by 3x wash with TBS-T. Samples were diluted 5-fold in sample diluent (PBS + 0.1% BSA + 0.05% Triton X-100) and then were added to the plate in duplicate. A standard curve of TTR-DM was used ranging in concentration from 64pg/mL to ⁇ g/mL, with a 0 ⁇ g/mL blank.
- Results are shown in Figure 7.
- the first column depicts results for patients with transthyretrin-mediated amyloidosis (ATTR) with either no treatment or with tafamidis.
- the second column depicts results for patients with transthyretrin-mediated amyloidosis (ATTR) with a liver transplant.
- the third column depicts results for normal patients.
- Example 14 9D5 detects elevated levels of mis-TTR (misfolded TTR monomers and oligomers) in plasma from hereditary ATTR patients
- Plasma samples from ATTR patients with a positive diagnosis of hereditary (h-ATTR) and wildtype ATTR (WT-ATTR) were collected in 7ml Vacutainer K2-EDTA tubes and centrifuged to remove cellular debris. The plasma fractions were aliquoted into 1.5ml LoBind Eppendorf tubes and immediately frozen. Plasma samples from healthy normal volunteers were collected in the same fashion. All samples were used immediately after thawing and not refrozen. Samples are as described in Table 5.
- Plasma samples were diluted 10-fold into lithium dodecyl sulfate sample buffer (Life Technologies).
- mAb ⁇ g/ml 9D5; M, molecular weight markers (BioRad); solid black star, non-liver transplanted TTR-V30M patients; hatched star, (Patients 5, 20) TTR-T114C; open star, (Patients 21, 23) TTR-S50I; no star, liver transplantation; 1N-5N, normal (correspond to Pro IDs N1-N5 in Table 5).
- the conformation-specific mis-TTR antibody 9D5 detects elevated levels of mis-TTR species (monomers and oligomers) in plasma derived from hereditary ATTR patients. In contrast, plasma from hereditary ATTR patients that had undergone liver transplantation therapy had barely detectable levels of mis-TTR similar to those in plasma from normal individuals. Example 15. Elevated levels of mis-TTR in plasma from hereditary ATTR Patients
- Plasma samples from ATTR patients with a positive diagnosis of hereditary (h-ATTR) and wildtype ATTR (WT-ATTR) were collected in 7ml Vacutainer K2-EDTA tubes and centnfuged to remove cellular debris. The plasma fractions were aliquoted into 1.5ml LoBind Eppendorf tubes and immediately frozen. Plasma samples from healthy normal volunteers were collected in the same fashion. All samples were used immediately after thawing and not refrozen. Samples are as described in Table 5.
- MSD Meso Scale Discovery
- MSD plates were coated overnight with 4 ⁇ g/mL NeutrAvidin followed by ⁇ g/mL biotinylated mis-TTR 9D5.
- Plasma samples were diluted 5- fold in sample diluent (PBS + 0.1% BSA + 0.05% Tween-20) prior to adding to the plate. Plates were washed with TBS-T, followed by the addition of ⁇ g/mL anti-TTR polyclonal antibody (Dako) labeled with MSD Sulfo-tag. Plates were washed with TBS-T and read on an MSD Sector S 600 after addition of 15( ⁇ L/well of diluted MSD Read Buffer T. Samples were analyzed using MSD Discovery Workbench 4.0.
- h-ATTR hereditary ATTR
- Liver TX liver transplant.
- mis-TTR levels in plasma from hereditary ATTR patients are significantly elevated relative to normal controls. Elevated levels of mis-TTR were also observed in asymptomatic individuals positively genotyped for TTR mutations. Normal, low ( ⁇ 10 ng/ml to BLQ) levels of mis-TTR were observed in plasma from hereditary ATTR patients that had undergone liver transplantation treatment.
- Example 7 Design of Humanized 18C5 Antibodies
- the starting point or donor antibody for humanization was the mouse antibody 18C5.
- the heavy chain variable amino acid sequence of mature ml8C5 is provided as SEQ ID NO: 81.
- the light chain variable amino acid sequence of mature ml8C5 is provided as SEQ ID NO:87.
- the heavy chain Kabat/Chothia Composite CDRl, CDR2, and CDR3 amino acid sequences are provided as SEQ ID NOs:5, 7, and 9, respectively.
- the light chain Kabat CDRl, CDR2, and CDR3 amino acid sequences are provided as SEQ ID NOs: 11, 13, and 15 respectively. Kabat numbering is used throughout.
- VH heavy chain variable region
- VL kappa light chain variable region
- CDR-H1 consists of 10 amino acids and is similar to Chothia canonical class 1.
- CDR-H2 consists of 17 amino acids and is similar to Chothia canonical class 3.
- CDR-H3 consists of 4 amino acids; there are no classes for CDR-H3.
- CDR-L1 consists of 16 amino acids and is similar to Chothia canonical class 4.
- CDR-L2 consists of 7 amino acids and is of Chothia canonical class 1.
- CDR-L3 consists of 9 amino acids and is similar to Chothia canonical class 1.
- a search was made over the protein sequences in the PDB database [Deshpande et al, 2005, Nucleic Acids Research 33 :D233-D237] to find structures, which would provide a rough structural model of 18C5.
- the frameworks of 18C5 VH and VL share a high degree of sequence similarity with the corresponding regions of humanized Crenezumab Fab (CreneFab) PDB: 5VZY, designed by Ultsch M, et al. ((2016) Sci Rep.6:39374)
- the variable domains of 18C5 and CreneFab also share identical lengths for the CDR-H1, H2, LI, L2, and L3 loops.
- the framework regions of CreneFab VH (5 VZY-VH) and VL (5 VZY-VL) were chosen as the acceptor sequences for the CDRs of 18C5.
- Bioluminate software was used to model the structure. This software is licensed from Schrodinger Inc.
- SEQ ID NOs: 86 and 92 contain backmutations and other mutations as shown in Table 10.
- the amino acids at positions in hul8C5-VH_vl and hul8C5-VH_v2 are listed in Table 11.
- the amino acids at positions in hul8C5-VL_vl and hul8C5-VL_v2 are listed in Table 12.
- Positions at which Chothia class canonical, vernier, or interface/packing residues differ between mouse and human acceptor sequences are candidates for substitution.
- Chothia class canonical residues include Kabat residue H48 in Tables 8 and 9.
- interface/packing (VH+VL) residues include Kabat residues H35, H37, H39, H45, H47, H91, H93, H95, H103, L34, L36, L38, L44, L46, L87, L89, L91, L96, and L98 in Tables 8 and 9.
- I2V is a backmutation of a Chothia canonical residue.
- Q45R is a mutation to IGKV2-30*02 germline residue. Q is rare in human at this position. R is frequent at this position.
- 18C5-VL vl CDR-L1, L2, and L3 loops of 18C5-VL grafted onto the framework of CreneFab (5VZY-VL).
- hul8C5-VL v2 reverts all framework substitutions at positions that are key for defining the Chothia canonical classes, are part of the Vernier zone, or locate to the VH/VL domain interface; hul8C5-VL_v2 incorporates backmutations I2V and human acceptor to germline mutation Q45R, to enable assessment of these positions' contributions to antigen-binding affinity and immunogenicity.
- DIVMTQ SPL SLP VTPGEP ASISCRS SQ SIVD SNGNT YLEWYLQKPGQ SPQLLIYK VSNRF S GVPDRF S GS GS GTDF TLKI SRVE AED VGV Y YCF QGSHVPLTF GQGTK VEIK
- V37A is a backmutation in the vernier zone. Val shows repulsive interaction with Trp47.
- L45Q is a backmutation of a core interface residue per Chothia. Leu at this position has repulsive Van der Waals interactions.
- L47W is a backmutation of an interface residue.
- Trp is at 47 position and Trp makes hydrogen bond with Ser 35 thereby stabilizing intra-chain beta-sheets.
- Leu does not establish any interface with any residue and may destabilize conformation.
- V48I is a backmutation of a CDR interacting Vernier zone residue to preserve this interaction.
- A49G is a backmutation of a Vernier zone residue.
- S94R is a backmutation of a Vernier zone residue, to preserve CDR interaction.
- 18C5-VH vl CDR-H1, H2, and H3 loops of 18C5-VH grafted onto the framework of CreneFab VH (5VZY-VH).
- Hul8C5-VH v2 reverts all framework substitutions at positions that are key for defining the Chothia canonical classes, are part of the Vernier zone, or localize to the VH/VL domain interface. 18C5-VH_v2 incorporates backmutations V37A, L45Q, L47W, V48I, A49G and S94R, to enable assessment of these positions' contributions to antigen-binding affinity and immunogenicity.
- Heavy chain variable regions are also be assessed for reverts all framework substitutions at positions that are key for defining the Chothia canonical classes, are part of the Vernier zone, or localize to the VH/VL domain interface. 18C5-VH_v2 incorporates backmutations V37A, L45Q, L47W, V48I, A49G and S94R, to enable assessment of these positions' contributions to antigen-binding affinity and immunogenicity.
- VQL VE S GGGL VQPGGSLRL S C A AS GFDF SRF WMS W ARQ APGKGQEWIGEINPGS S TIN YTPSLKDRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGYGNYGWALDYWGQGTT VTVSS
- SEQ ID NO: 18 nucleic acid encoding a chimeric 18C5 heavy chain constant region (human IgGl) GCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCT GGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGAC GGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCT ACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTT GGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGG ACAAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAG CACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCAAAACCCAAGGACA CCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCA
- nucleic acid sequence encoding an amino acid sequence of a chimeric 18C5 light chain constant region (human kappa)
- ABI63351.1 (GenBank) MASHRLLLLCLAGLVFVSEAGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADD TWEPFAS GKT SE S GELHGLTTEEEF VEGI YK VEIDTK S YWK ALGI SPFHEH AE VVF TA D S GPRRYS Y S TTAV VT PKE SEQ ID NO:30
- nucleic acid sequence encoding an exemplary IgGl Glm3 heavy chain constant region GCCTCCACCAAGGGTCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCT GGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGAC GGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCT ACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTT GGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGG ACAAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAG CACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACA CCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACG AAGACCCTGAGGTCA
- SEQ ID NO:33 nucleic acid sequence encoding an exemplary light chain constant region with N-terminal Arginine
- nucleic acid sequence encoding an exemplary light chain constant region without N- terminal Arginine
- nucleic acid sequence encoding a light chain constant region signal peptide
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Pharmacology & Pharmacy (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Endocrinology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Neurosurgery (AREA)
- Plasma & Fusion (AREA)
- Neurology (AREA)
- Diabetes (AREA)
- Gastroenterology & Hepatology (AREA)
- Rheumatology (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3077353A CA3077353A1 (en) | 2017-10-06 | 2018-10-05 | Methods of detecting transthyretin |
| BR112020006791-1A BR112020006791A2 (pt) | 2017-10-06 | 2018-10-05 | métodos de detecção de transtirretina |
| US16/753,661 US12247985B2 (en) | 2017-10-06 | 2018-10-05 | Methods of detecting transthyretin |
| PE2020000647A PE20210042A1 (es) | 2017-10-06 | 2018-10-05 | Metodos para detectar transtiretina |
| CU2020000022A CU20200022A7 (es) | 2017-10-06 | 2018-10-05 | Métodos para detectar transtiretina |
| KR1020207010132A KR102581734B1 (ko) | 2017-10-06 | 2018-10-05 | 트랜스타이레틴의 검출 방법 |
| JP2020519805A JP7292569B2 (ja) | 2017-10-06 | 2018-10-05 | トランスサイレチンを検出する方法 |
| EA202090724A EA202090724A1 (ru) | 2018-03-23 | 2018-10-05 | Способы обнаружения транстиретина |
| MYPI2020001764A MY201963A (en) | 2017-10-06 | 2018-10-05 | Methods of detecting transthyretin |
| AU2018345807A AU2018345807B2 (en) | 2017-10-06 | 2018-10-05 | Methods of detecting transthyretin |
| CN201880064631.6A CN111757730A (zh) | 2017-10-06 | 2018-10-05 | 检测甲状腺素运载蛋白的方法 |
| EP18864376.1A EP3691626A4 (en) | 2017-10-06 | 2018-10-05 | METHODS OF DETECTION OF TRANSTHYRETINE |
| SG11202002490UA SG11202002490UA (en) | 2017-10-06 | 2018-10-05 | Methods of detecting transthyretin |
| MX2020003043A MX2020003043A (es) | 2017-10-06 | 2018-10-05 | Métodos para detectar transtiretina. |
| ZA2020/02137A ZA202002137B (en) | 2017-10-06 | 2020-05-04 | Methods of detecting transthyretin |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762569438P | 2017-10-06 | 2017-10-06 | |
| US62/569,438 | 2017-10-06 | ||
| US201762579817P | 2017-10-31 | 2017-10-31 | |
| US62/579,817 | 2017-10-31 | ||
| US201862647582P | 2018-03-23 | 2018-03-23 | |
| US62/647,582 | 2018-03-23 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019071206A1 true WO2019071206A1 (en) | 2019-04-11 |
Family
ID=65995330
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/054723 Ceased WO2019071206A1 (en) | 2017-10-06 | 2018-10-05 | METHODS OF DETECTING TRANSTHYRETIN |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US12247985B2 (enExample) |
| EP (1) | EP3691626A4 (enExample) |
| JP (1) | JP7292569B2 (enExample) |
| KR (1) | KR102581734B1 (enExample) |
| CN (1) | CN111757730A (enExample) |
| AU (1) | AU2018345807B2 (enExample) |
| BR (1) | BR112020006791A2 (enExample) |
| CA (1) | CA3077353A1 (enExample) |
| CU (1) | CU20200022A7 (enExample) |
| MX (1) | MX2020003043A (enExample) |
| MY (1) | MY201963A (enExample) |
| PE (1) | PE20210042A1 (enExample) |
| SG (1) | SG11202002490UA (enExample) |
| WO (1) | WO2019071206A1 (enExample) |
| ZA (1) | ZA202002137B (enExample) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016120810A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10669330B2 (en) | 2015-01-28 | 2020-06-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10906967B2 (en) | 2015-01-28 | 2021-02-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2021041731A1 (en) * | 2019-08-27 | 2021-03-04 | University Of Southern California | Assays for detecting and quantifying a biomarker of pericyte injury |
| US11267878B2 (en) | 2015-01-28 | 2022-03-08 | Neotope Neuroscience Limited | Anti-transthyretin antibodies |
| US11267877B2 (en) | 2017-10-06 | 2022-03-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2023099788A1 (en) | 2021-12-03 | 2023-06-08 | Neurimmune Ag | Novel potency assay for antibody-based drugs and useful means therefor |
| US11873332B2 (en) | 2017-11-29 | 2024-01-16 | Novo Nordisk A/S | Lyophilized formulation of a monoclonal antibody against transthyretin |
| US12247985B2 (en) | 2017-10-06 | 2025-03-11 | Novo Nordisk A/S | Methods of detecting transthyretin |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2024546046A (ja) * | 2021-11-15 | 2024-12-17 | アセンド バイオテクノロジー インク | Treml1により誘導された免疫抑制を逆転させる方法 |
| WO2023192161A2 (en) * | 2022-03-28 | 2023-10-05 | Intrinsic Medicine, Inc. | Methods and compositions for attenuating immune response associated with rna therapeutics |
Citations (63)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634666A (en) | 1984-01-06 | 1987-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | Human-murine hybridoma fusion partner |
| US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5741957A (en) | 1989-12-01 | 1998-04-21 | Pharming B.V. | Transgenic bovine |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5786464A (en) | 1994-09-19 | 1998-07-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5858657A (en) | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5871907A (en) | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877218A (en) | 1994-01-10 | 1999-03-02 | Teva Pharmaceutical Industries, Ltd. | Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5888809A (en) | 1997-05-01 | 1999-03-30 | Icos Corporation | Hamster EF-1α transcriptional regulatory DNA |
| US6063598A (en) | 1995-10-24 | 2000-05-16 | Dr. Karl Thomae Gmbh | Strong homologous promoter obtained from hamsters |
| US6114148A (en) | 1996-09-20 | 2000-09-05 | The General Hospital Corporation | High level expression of proteins |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| WO2003057838A2 (en) | 2001-12-28 | 2003-07-17 | Abgenix, Inc. | Antibodies against the muc18 antigen |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| WO2004050884A2 (de) | 2002-11-29 | 2004-06-17 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen |
| US20050009150A1 (en) | 1998-11-30 | 2005-01-13 | Elan Pharmaceuticals, Inc. | Humanized antibodies that recognize beta amyloid peptide |
| WO2005019442A2 (de) | 2003-08-19 | 2005-03-03 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur reklonierung von produktionszellen |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| WO2008012142A1 (de) | 2006-07-26 | 2008-01-31 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Regulatorische nukleinsäureelemente |
| WO2008107388A1 (en) | 2007-03-02 | 2008-09-12 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Improvement of protein production |
| WO2009027471A1 (de) | 2007-08-29 | 2009-03-05 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur steigerung von proteintitern |
| US7569339B2 (en) | 2004-11-10 | 2009-08-04 | Boehringer Ingelheim Pharma Gmbh & Co., Kg | Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells |
| US20110008255A1 (en) | 2006-04-21 | 2011-01-13 | The Department Of Health And Human Services | Beta-amyloid pet imaging agents |
| WO2011116123A1 (en) | 2010-03-19 | 2011-09-22 | Irm Llc | Tafamidis for the treatment of ophthalmic diseases |
| US8101743B2 (en) | 2004-04-05 | 2012-01-24 | Isis Pharmaceuticals, Inc. | Modulation of transthyretin expression |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| US20140056904A1 (en) | 2012-08-24 | 2014-02-27 | University Health Network | Antibodies to TTR and Methods of Use |
| US8697860B1 (en) | 2010-04-29 | 2014-04-15 | Isis Pharmaceuticals, Inc. | Diagnosis and treatment of disease |
| US9150489B2 (en) | 2010-04-21 | 2015-10-06 | Chiesi Farmaceutici S.P.A. | 1-(2-fluorobiphenyl-4-yl)-alkyl carboxylic acid derivatives for the therapy of transthyretin amyloidosis |
| US20160039916A1 (en) | 2013-02-08 | 2016-02-11 | Misfolding Diagnostics, Inc. | Transthyretin antibodies and uses thereof |
| WO2016033326A2 (en) | 2014-08-29 | 2016-03-03 | Alnylam Pharmaceuticals, Inc. | Methods of treating transthyretin (ttr) mediated amyloidosis |
| WO2016120811A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2016120810A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US20160340419A1 (en) * | 2014-01-29 | 2016-11-24 | The Chemo-Sero-Therapeutic Research Institute | Anti-transthyretin human antibody |
| US20160347832A1 (en) * | 2014-01-29 | 2016-12-01 | The Chemo-Sero-Therapeutic Research Institute | Anti-transthyretin humanized antibody |
| US20160355576A1 (en) * | 2013-12-20 | 2016-12-08 | Neurimmune Holding Ag | Antibody-based therapy of transthyretin (ttr) amyloidosis and human-derived antibodies therefor |
| US20170058023A1 (en) | 2015-01-28 | 2017-03-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US20170121398A1 (en) * | 2015-01-28 | 2017-05-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US9731292B2 (en) * | 2006-10-20 | 2017-08-15 | Clondiag Gmbh | Assay devices and methods for the detection of analytes |
Family Cites Families (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA81216C2 (en) | 1999-06-01 | 2007-12-25 | Prevention and treatment of amyloid disease | |
| EP1353944A2 (en) | 2000-04-05 | 2003-10-22 | The University Of Tennessee Research Corporation | Methods of investigating, diagnosing, and treating amyloidosis |
| US8420353B2 (en) | 2002-03-22 | 2013-04-16 | Aprogen, Inc. | Humanized antibody and process for preparing same |
| US9535076B2 (en) | 2002-09-12 | 2017-01-03 | The Regents Of The University Of California | Methods and compositions for eliciting an amyloid-selective immune response |
| US20110200609A1 (en) | 2002-09-12 | 2011-08-18 | The Regents Of The University Of California | Monoclonal antibodies specific for pathological amyloid aggregates common to amyloids formed from proteins of differing sequence |
| EP1578361B1 (en) | 2002-09-12 | 2011-04-20 | The Regents of The University of California | Immunogens and corresponding antibodies specific for high molecular weight aggregation intermediates common to amyloids formed from proteins of differing sequence |
| WO2010012004A2 (en) | 2008-07-25 | 2010-01-28 | The Regents Of The University Of California | Monoclonal antibodies specific for pathological amyoid aggregates common to amyloids formed from proteins of differing sequence |
| JP2007527865A (ja) | 2003-09-12 | 2007-10-04 | ザ・レジェンツ・オブ・ザ・ユニバーシティ・オブ・カリフォルニア | 種々の配列を有するタンパク質から形成されたアミロイドに共通の高分子量凝集中間体に特異的なモノクローナル抗体 |
| WO2006108234A1 (en) | 2005-04-13 | 2006-10-19 | Garvan Institute Of Medical Research | Modified animal lacking functional pyy gene, monoclonal antibodies that bind pyy isoforms and uses therefor |
| AU2007219615B2 (en) | 2006-03-03 | 2013-11-28 | Promis Neurosciences Inc. | Methods and compositions to treat and detect misfolded-SOD1 mediated diseases |
| EP2044443B1 (en) | 2006-07-03 | 2011-01-12 | The Johns Hopkins University | Peptide antibody depletion and its application to mass spectrometry sample preparation |
| WO2010030203A1 (en) | 2008-09-09 | 2010-03-18 | Biocodex - Incubação De Empresas De Ciências Da Vida, S.A. | Monoclonal antibody to human amyloidogenic and modified forms of transthyretin and its use in the detection and treatment of fap and pathologies presenting modified ttr |
| CA2743361C (en) | 2008-10-06 | 2021-05-25 | Neil R. Cashman | Methods and systems for predicting misfolded protein epitopes |
| JP2010195710A (ja) | 2009-02-25 | 2010-09-09 | Kumamoto Univ | アミロイド線維形成抑制剤及びその利用 |
| CA2753621A1 (en) | 2009-03-02 | 2010-09-10 | The University Of British Columbia | Antibodies and epitopes specific to misfolded prion protein |
| TWI667346B (zh) | 2010-03-30 | 2019-08-01 | 中外製藥股份有限公司 | 促進抗原消失之具有經修飾的FcRn親和力之抗體 |
| FI20115165A0 (fi) | 2011-02-21 | 2011-02-21 | Polysackaridforskning I Uppsala Ab | Terapeuttisia ja diagnostisia menetelmiä |
| EP3604330A1 (en) | 2011-02-25 | 2020-02-05 | Chugai Seiyaku Kabushiki Kaisha | Fcgammariib-specific fc antibody |
| DK2698431T3 (da) | 2011-03-30 | 2020-11-30 | Chugai Pharmaceutical Co Ltd | Opretholdelse af antigen-bindende molekyler i blodplasma og fremgangsmåde til modifikation af immunogenicitet |
| TW201326209A (zh) | 2011-09-30 | 2013-07-01 | Chugai Pharmaceutical Co Ltd | 具有促進抗原清除之FcRn結合域的治療性抗原結合分子 |
| DK2857419T3 (da) | 2012-05-30 | 2021-03-29 | Chugai Pharmaceutical Co Ltd | Antigen-bindende molekyle til eliminering af aggregerede antigener |
| US9216219B2 (en) | 2012-06-12 | 2015-12-22 | Novartis Ag | Anti-BAFFR antibody formulation |
| UA118441C2 (uk) | 2012-10-08 | 2019-01-25 | Протена Біосаєнсиз Лімітед | Антитіло, що розпізнає альфа-синуклеїн |
| AU2014204083A1 (en) | 2013-01-03 | 2015-07-23 | Meso Scale Technologies, Llc | Assay panels |
| CN105121642B (zh) | 2013-03-12 | 2018-04-10 | 国立大学法人名古屋大学 | 增加植物的光合作用及产量的方法 |
| EP3022225B1 (en) | 2013-07-19 | 2021-09-29 | Board Of Regents Of the University Of Texas System | Transthyretin amyloid-selective and polyreactive catabodies |
| TWI705827B (zh) | 2014-11-07 | 2020-10-01 | 瑞士商諾華公司 | 治療眼部疾病之方法 |
| TWI718121B (zh) * | 2015-01-28 | 2021-02-11 | 愛爾蘭商普羅佘納生物科技有限公司 | 抗甲狀腺素運送蛋白抗體 |
| US10633433B2 (en) | 2015-01-28 | 2020-04-28 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| EP3478716A2 (en) | 2016-07-02 | 2019-05-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2018007923A2 (en) | 2016-07-02 | 2018-01-11 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| EP3478714A2 (en) | 2016-07-02 | 2019-05-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| JP7292569B2 (ja) | 2017-10-06 | 2023-06-19 | ノボ ノルディスク エー/エス | トランスサイレチンを検出する方法 |
| AU2018345806A1 (en) | 2017-10-06 | 2020-03-12 | Novo Nordisk A/S | Anti-transthyretin antibodies |
| PE20211453A1 (es) | 2017-11-29 | 2021-08-05 | Prothena Biosciences Ltd | Formulacion liofilizada de un anticuerpo monoclonal contra transtirretina |
| WO2021168156A1 (en) | 2020-02-20 | 2021-08-26 | Prothena Biosciences Limited | Monitoring transthyretin amyloidosis |
-
2018
- 2018-10-05 JP JP2020519805A patent/JP7292569B2/ja active Active
- 2018-10-05 MY MYPI2020001764A patent/MY201963A/en unknown
- 2018-10-05 SG SG11202002490UA patent/SG11202002490UA/en unknown
- 2018-10-05 CU CU2020000022A patent/CU20200022A7/es unknown
- 2018-10-05 BR BR112020006791-1A patent/BR112020006791A2/pt unknown
- 2018-10-05 PE PE2020000647A patent/PE20210042A1/es unknown
- 2018-10-05 WO PCT/US2018/054723 patent/WO2019071206A1/en not_active Ceased
- 2018-10-05 KR KR1020207010132A patent/KR102581734B1/ko active Active
- 2018-10-05 US US16/753,661 patent/US12247985B2/en active Active
- 2018-10-05 MX MX2020003043A patent/MX2020003043A/es unknown
- 2018-10-05 CA CA3077353A patent/CA3077353A1/en active Pending
- 2018-10-05 CN CN201880064631.6A patent/CN111757730A/zh active Pending
- 2018-10-05 AU AU2018345807A patent/AU2018345807B2/en active Active
- 2018-10-05 EP EP18864376.1A patent/EP3691626A4/en active Pending
-
2020
- 2020-05-04 ZA ZA2020/02137A patent/ZA202002137B/en unknown
Patent Citations (69)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
| US4634666A (en) | 1984-01-06 | 1987-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | Human-murine hybridoma fusion partner |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5741957A (en) | 1989-12-01 | 1998-04-21 | Pharming B.V. | Transgenic bovine |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5871907A (en) | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5858657A (en) | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5877218A (en) | 1994-01-10 | 1999-03-02 | Teva Pharmaceutical Industries, Ltd. | Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives |
| US5786464C1 (en) | 1994-09-19 | 2012-04-24 | Gen Hospital Corp | Overexpression of mammalian and viral proteins |
| US5786464A (en) | 1994-09-19 | 1998-07-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| US6063598A (en) | 1995-10-24 | 2000-05-16 | Dr. Karl Thomae Gmbh | Strong homologous promoter obtained from hamsters |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US6114148A (en) | 1996-09-20 | 2000-09-05 | The General Hospital Corporation | High level expression of proteins |
| US6114148C1 (en) | 1996-09-20 | 2012-05-01 | Gen Hospital Corp | High level expression of proteins |
| US5888809A (en) | 1997-05-01 | 1999-03-30 | Icos Corporation | Hamster EF-1α transcriptional regulatory DNA |
| US20050009150A1 (en) | 1998-11-30 | 2005-01-13 | Elan Pharmaceuticals, Inc. | Humanized antibodies that recognize beta amyloid peptide |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| WO2003057838A2 (en) | 2001-12-28 | 2003-07-17 | Abgenix, Inc. | Antibodies against the muc18 antigen |
| WO2004050884A2 (de) | 2002-11-29 | 2004-06-17 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen |
| WO2005019442A2 (de) | 2003-08-19 | 2005-03-03 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur reklonierung von produktionszellen |
| US8101743B2 (en) | 2004-04-05 | 2012-01-24 | Isis Pharmaceuticals, Inc. | Modulation of transthyretin expression |
| US7569339B2 (en) | 2004-11-10 | 2009-08-04 | Boehringer Ingelheim Pharma Gmbh & Co., Kg | Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells |
| US20110008255A1 (en) | 2006-04-21 | 2011-01-13 | The Department Of Health And Human Services | Beta-amyloid pet imaging agents |
| WO2008012142A1 (de) | 2006-07-26 | 2008-01-31 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Regulatorische nukleinsäureelemente |
| US9731292B2 (en) * | 2006-10-20 | 2017-08-15 | Clondiag Gmbh | Assay devices and methods for the detection of analytes |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2008107388A1 (en) | 2007-03-02 | 2008-09-12 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Improvement of protein production |
| WO2009027471A1 (de) | 2007-08-29 | 2009-03-05 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur steigerung von proteintitern |
| WO2011116123A1 (en) | 2010-03-19 | 2011-09-22 | Irm Llc | Tafamidis for the treatment of ophthalmic diseases |
| US9150489B2 (en) | 2010-04-21 | 2015-10-06 | Chiesi Farmaceutici S.P.A. | 1-(2-fluorobiphenyl-4-yl)-alkyl carboxylic acid derivatives for the therapy of transthyretin amyloidosis |
| JP5896175B2 (ja) | 2010-04-29 | 2016-03-30 | アイオーニス ファーマシューティカルズ, インコーポレーテッドIonis Pharmaceuticals,Inc. | トランスサイレチン発現の調節 |
| US8697860B1 (en) | 2010-04-29 | 2014-04-15 | Isis Pharmaceuticals, Inc. | Diagnosis and treatment of disease |
| US9061044B2 (en) | 2010-04-29 | 2015-06-23 | Isis Pharmaceuticals, Inc. | Modulation of transthyretin expression |
| US9399774B2 (en) | 2010-04-29 | 2016-07-26 | Ionis Pharmaceuticals, Inc. | Modulation of transthyretin expression |
| US20140056904A1 (en) | 2012-08-24 | 2014-02-27 | University Health Network | Antibodies to TTR and Methods of Use |
| US20160039916A1 (en) | 2013-02-08 | 2016-02-11 | Misfolding Diagnostics, Inc. | Transthyretin antibodies and uses thereof |
| US20160355576A1 (en) * | 2013-12-20 | 2016-12-08 | Neurimmune Holding Ag | Antibody-based therapy of transthyretin (ttr) amyloidosis and human-derived antibodies therefor |
| US20160340419A1 (en) * | 2014-01-29 | 2016-11-24 | The Chemo-Sero-Therapeutic Research Institute | Anti-transthyretin human antibody |
| US20160347832A1 (en) * | 2014-01-29 | 2016-12-01 | The Chemo-Sero-Therapeutic Research Institute | Anti-transthyretin humanized antibody |
| WO2016033326A2 (en) | 2014-08-29 | 2016-03-03 | Alnylam Pharmaceuticals, Inc. | Methods of treating transthyretin (ttr) mediated amyloidosis |
| WO2016120811A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2016120810A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US20170058023A1 (en) | 2015-01-28 | 2017-03-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US20170121398A1 (en) * | 2015-01-28 | 2017-05-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
Non-Patent Citations (77)
| Title |
|---|
| "A hybridoma cell line that produces monoclonal antibody 18C5 was deposited with the Patent Depository of the American Type Culture Collection (ATCC", 31 October 2017, pages: 20110 - 2209 |
| "GenBank", Database accession no. 1FN550289.1 |
| "lonis Pharmaceuticals Announces Phase 3 NEURO-TTR Study of Inotersen (lONIS-TTRRx) Meets Both Primary Endpoints", LONIS PHARMACEUTICALS, 15 May 2017 (2017-05-15), pages 1 - 4, XP055589699, Retrieved from the Internet <URL:http://ir.ionispharma.com/static-files/a652dc14-1d68-48ab-ac47-a932944c9fc2> [retrieved on 20181212] * |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| "Patent Depository of the American Type Culture Collection (ATCC", 4 April 2017, pages: 20110 - 2209 |
| "Swiss Prot", Database accession no. P02766.1 |
| ALMEIDASARAIVA, FEBS LETTERS, vol. 586, 2012, pages 2891 - 2896 |
| ALMEIDASARAIVA, FEES LETTERS, vol. 586, 2012, pages 2891 - 2896 |
| ANDO ET AL., ORPHANET JOURNAL OF RARE DISEASES, vol. 8, 2013, pages 31 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| ATWAL ET AL., SCI. TRANS. MED., vol. 3, 2011, pages 84ra44 |
| BANNER ET AL., ACTA. CRYSTALLOGR. D. BIOL. CRYSTALLOGR., vol. 69, no. 6, 2013, pages 1124 - 1137 |
| BERTSCHINGER ET AL., PROTEIN ENG. DES. SEL., vol. 20, 2007, pages 57 - 68 |
| BRACK ET AL., MOL. CANCER THER., vol. 13, 2014, pages 2030 - 2039 |
| CARDOSOSARAIVA, FASEB J, vol. 20, no. 2, 2006, pages 234 - 239 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| DAMASSARAIVA, J. STRUCT. BIOL., vol. 130, pages 290 - 299 |
| DESHPANDE ET AL., NUCLEIC ACIDS RESEARCH, vol. 33, 2005, pages D233 - D237 |
| DWULETBENSON, BIOCHEM. BIOPHYS. RES. COMMUN., vol. 114, 1983, pages 657 - 662 |
| EDELMAN, G.M. ET AL., PROC. NATL. ACAD. USA, vol. 63, 1969, pages 78 - 85 |
| FOOTE JWINTER G., J MOLBIOL., vol. 224, no. 2, 1992, pages 487 - 99 |
| FOOTEWINTER, J. MOL. BIOL, vol. 224, 1992, pages 487 - 499 |
| FRIDEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 4771 - 4775 |
| FRIDEN ET AL., SCIENCE, vol. 259, 1993, pages 373 - 377 |
| GALANT ET AL.: "Substoichiometric inhibition of transthyretin misfolding by immune-targeting sparsely populated misfolding intermediates: a potential diagnostic and therapeutic for TTR amyloidoses", SCIENTIFIC REPORTS, vol. 6, no. 25080, 28 April 2016 (2016-04-28), pages 1 - 11, XP055417219 * |
| GONZALES ET AL., MOL. IMMUNOL., vol. 41, 2004, pages 863 |
| GRABULOVSKI ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 3196 - 3204 |
| HARLOWLANE: "Antibodies, A Laboratory Manual", 1988, CSHP |
| HAWKINS ET AL., ANNALS OF MEDICINE, vol. 47, 2015, pages 625 - 638 |
| HAZRA ET AL., CELL BIOPHYS., vol. 24-25, 1994, pages 1 - 7 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HIGAKI ET AL.: "Novel conformation-specific monoclonal antibodies against amyloidogenic forms of transthyretin", AMYLOID, vol. 23, no. 2, 16 March 2016 (2016-03-16), pages 86 - 97, XP055372418, DOI: doi:10.3109/13506129.2016.1148025 * |
| HINTON, BIOL. CHEM., vol. 279, 2004, pages 6213 |
| ITOMAEDA: "Mouse Models of Transthyretin Amyloidosis, in Recent Advances in Transthyretin Evolution, Structure, and Biological Functions", 2009, SPRINGER BERLIN HEIDELBERG, pages: 261 - 280 |
| IWAHASHI ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 1079 - 1091 |
| JOHNSON ET AL., J. MOL. BIOL., vol. 421, no. 2-3, 2012, pages 185 - 203 |
| JONES ET AL.: "The INNs and outs of antibody nonproprietary names", MABS, vol. 8, no. 1, 2016, pages 1 - 9, XP055813029, DOI: 10.1080/19420862.2015.1114320 |
| JUNGHANS ET AL., CANCER RES., vol. 50, 1990, pages 1495 |
| KABAT E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KOHNO ET AL., AM. J. PATH., vol. 150, no. 4, 1997, pages 1497 - 1508 |
| KOSTELNY ET AL.: "148", J. IMMUNOL., vol. 148, 1992, pages 1149 - 53 |
| LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 4005 |
| LEFRANC M.-P. ET AL.: "IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains", DEV. COMP. IMMUNOL., vol. 29, 2005, pages 185 - 203, XP093138816, DOI: 10.1016/j.dci.2004.07.003 |
| LÉGER OJP;SALDANHA J.: "Monoclonal Antibodies: a Practical Approach", 2000, OXFORD UNIVERSITY PRESS, article "Preparation of recombinant antibodies from immune rodent spleens and the design of their humanization by CDR grafting" |
| MARTIN ACR.: "Antibody Engineering.", 2010, SPRINGER INTERNATIONAL PUBLISHING |
| NAGATA ET AL., J. BIOCHEM., vol. 117, 1995, pages 169 - 175 |
| NEUBERGER, NAT. BIOTECHNOL., vol. 14, 1996, pages 826 |
| OESTBERG ET AL., HYBRIDOMA, vol. 2, 1983, pages 361 - 367 |
| PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 |
| PASCALIS ET AL., J. IMMUNOL., vol. 169, 2002, pages 3076 |
| PIECHOTTA, A. ET AL., J. BIOL. CHEM., vol. 292, 2017, pages 12713 - 12724 |
| QUEEN ET AL., IMMUNOL. REV., vol. 89, 1986, pages 49 |
| RUBERGBERK, CIRCULATION, vol. 126, 2012, pages 1286 - 1300 |
| SANTOS ET AL., NEUROBIOLOGY OF AGING, vol. 31, 2010, pages 280 - 289 |
| SARAIVA, FEES LETTERS, vol. 498, 2001, pages 201 - 203 |
| SARAIVA, HUM. MUTAT., vol. 17, no. 6, 2001, pages 493 - 503 |
| SCHLATTER ET AL., MABS., vol. 4, 2011, pages 497 - 508 |
| SCHONHOFT ET AL.: "Peptide probes detect misfolded transthyretin oligomers in plasma of hereditary amyloidosis patients", SCIENCE TRANSLATIONAL MEDICINE, vol. 9, no. 407, 13 September 2017 (2017-09-13), pages 1 - 12, XP055589739 * |
| See also references of EP3691626A4 |
| SHIMADA ET AL., MOL. BIOL. MED., vol. 6, 1989, pages 333 - 343 |
| SONGSIVILAILACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SOUSA ET AL., AM. J. PATH., vol. 161, 2002, pages 1935 - 1948 |
| TAMURA ET AL., J. IMMUNOL., vol. 164, 2000, pages 1432 - 1441 |
| TENG ET AL., LAB. INVEST., vol. 81, no. 3, 2001, pages 385 - 396 |
| TENG ET AL., LABORATORY INVESTIGATIONS, vol. 81, 2001, pages 385 - 396 |
| THORNTONMARTIN, J. MOL. BIOL., vol. 263, 1996, pages 800 - 815 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies 84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| UEDAANDO, TRANSLATIONAL NEURODEGENERATION, vol. 3, 2014, pages 19 |
| ULTSCH M ET AL., SCI REP, vol. 6, 2016, pages 39374 |
| VAJDOS ET AL., J. OF MOL. BIOL., vol. 320, 2002, pages 415 - 428 |
| WAKASUGI ET AL., PROC. JAPAN ACAD., vol. 63B, 1987, pages 344 - 347 |
| WALL ET AL.: "Biodistribution of amyloid-imaging peptide, p31, correlates with amyloid quantitation based on Congo red tissue staining", 2011, ISNM ANNUAL MEETING |
| WANG, W.MALCOLM, B.A., BIOTECHNIQUES, vol. 26, 1999, pages 680 - 682 |
| WITZIG, CANCER CHEMOTHER. PHARMACOL., vol. 48, no. 1, 2001, pages S91 - S95 |
| WU ET AL.: "Antibody Engineering", 2010, SPRINGER BERLIN HEIDELBERG, article "Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-IgTM) Molecule" |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016120810A1 (en) | 2015-01-28 | 2016-08-04 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10669330B2 (en) | 2015-01-28 | 2020-06-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10906967B2 (en) | 2015-01-28 | 2021-02-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US11028158B2 (en) | 2015-01-28 | 2021-06-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US11267878B2 (en) | 2015-01-28 | 2022-03-08 | Neotope Neuroscience Limited | Anti-transthyretin antibodies |
| US11629185B2 (en) | 2015-01-28 | 2023-04-18 | Novo Nordisk A/S | Anti-transthyretin antibodies |
| US11912759B2 (en) | 2015-01-28 | 2024-02-27 | Novo Nordisk A/S | Anti-transthyretin antibodies |
| US11267877B2 (en) | 2017-10-06 | 2022-03-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US12247985B2 (en) | 2017-10-06 | 2025-03-11 | Novo Nordisk A/S | Methods of detecting transthyretin |
| US11873332B2 (en) | 2017-11-29 | 2024-01-16 | Novo Nordisk A/S | Lyophilized formulation of a monoclonal antibody against transthyretin |
| WO2021041731A1 (en) * | 2019-08-27 | 2021-03-04 | University Of Southern California | Assays for detecting and quantifying a biomarker of pericyte injury |
| WO2023099788A1 (en) | 2021-12-03 | 2023-06-08 | Neurimmune Ag | Novel potency assay for antibody-based drugs and useful means therefor |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2018345807B2 (en) | 2025-02-06 |
| US20200249244A1 (en) | 2020-08-06 |
| JP7292569B2 (ja) | 2023-06-19 |
| CA3077353A1 (en) | 2019-04-11 |
| US12247985B2 (en) | 2025-03-11 |
| CN111757730A (zh) | 2020-10-09 |
| ZA202002137B (en) | 2023-07-26 |
| EP3691626A1 (en) | 2020-08-12 |
| KR102581734B1 (ko) | 2023-09-22 |
| PE20210042A1 (es) | 2021-01-08 |
| KR20200067144A (ko) | 2020-06-11 |
| SG11202002490UA (en) | 2020-04-29 |
| MY201963A (en) | 2024-03-27 |
| BR112020006791A2 (pt) | 2020-12-01 |
| EP3691626A4 (en) | 2021-06-30 |
| MX2020003043A (es) | 2020-10-05 |
| AU2018345807A1 (en) | 2020-03-12 |
| JP2020537128A (ja) | 2020-12-17 |
| CU20200022A7 (es) | 2021-01-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12247985B2 (en) | Methods of detecting transthyretin | |
| US11267877B2 (en) | Anti-transthyretin antibodies | |
| EP3250593B1 (en) | Anti-transthyretin antibodies | |
| EP3250594B1 (en) | Anti-transthyretin antibodies | |
| US11267878B2 (en) | Anti-transthyretin antibodies | |
| US10494426B2 (en) | Anti-transthyretin antibodies | |
| EP3478716A2 (en) | Anti-transthyretin antibodies | |
| WO2021263279A1 (en) | Antibodies recognizing sortilin | |
| AU2022420022A1 (en) | Antibodies recognizing sortilin | |
| EP3247392A1 (en) | Antibodies recognizing medin | |
| EA046080B1 (ru) | Способы обнаружения транстиретина | |
| EA043913B1 (ru) | Анти-транстиретиновые антитела | |
| HK1240247B (en) | Anti‐transthyretin antibodies | |
| HK1240247A1 (en) | Anti‐transthyretin antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18864376 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2018345807 Country of ref document: AU Date of ref document: 20181005 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3077353 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020519805 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018864376 Country of ref document: EP Effective date: 20200506 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2020/0005587 Country of ref document: CO |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2020/0005587 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020006791 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112020006791 Country of ref document: BR Free format text: REGULARIZE A PROCURACAO APRESENTADA, TENDO EM VISTA QUE O DOCUMENTO APRESENTADO NAO POSSUI DATA. |
|
| ENP | Entry into the national phase |
Ref document number: 112020006791 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200403 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 16753661 Country of ref document: US |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2020/003043 Country of ref document: MX |