WO2019066586A1 - 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 - Google Patents
글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 Download PDFInfo
- Publication number
- WO2019066586A1 WO2019066586A1 PCT/KR2018/011586 KR2018011586W WO2019066586A1 WO 2019066586 A1 WO2019066586 A1 WO 2019066586A1 KR 2018011586 W KR2018011586 W KR 2018011586W WO 2019066586 A1 WO2019066586 A1 WO 2019066586A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glp
- derivative
- lysine
- glycine
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- GLP-2 glycopeptides
- GLP-2 glycopeptides
- Peptide drugs need to be frequently administered to patients in order to maintain their blood concentration and activity.
- most peptide drugs are administered to patients in the form of injections, and thus are frequently injected to maintain blood levels of the bioactive peptide, which causes the patient to suffer tremendous pain.
- Various attempts have been made to overcome these problems.
- the GLP-2 derivative is represented by formula
- the immunoglobulin Fc region is characterized by a GLP-2 conjugate that is an IgG4 Fc region.
- X 1 is histidine, imidazoacetyldehistidine, desaminohistidine,? -Hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or? -Carboxyimidazopropionyldeshistidine;
- X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidyl lysine, or cysteine;
- sequence identical to SEQ ID NO: 1 is excluded from the amino acid sequence of the general formula (1).
- Another embodiment of the present invention is an isolated nucleic acid encoding said GLP-2 derivative.
- Another embodiment of the present invention is a transformant comprising said recombinant expression vector.
- Another embodiment of the present invention is directed to a method of making a GLP-2 derivative or immunoglobulin Fc region by reacting (a) a non-peptide polymer having at least two terminal reactors with one of said GLP-2 derivative or immunoglobulin Fc region, And having a reactor at the other end; And
- step (b) reacting the ligand prepared in the step (a) with another immunoglobulin Fc region or another GLP-2 derivative not attached to the linkage, so that the GLP-2 derivative and the immunoglobulin Fc region are immobilized on the nonpeptide polymer To form a GLP-2 conjugate.
- the non-peptide polymer has at least one reactor selected from the group consisting of an aldehyde group, a propionaldehyde group, a butylaldehyde group, a maleimide group, and a succinimide derivative. .
- the succinimide derivative is selected from the group consisting of succinimidyl carboxymethyl, succinimidyl valerate, succinimidyl methyl butanoate, succinimidyl methyl propionate, succinimidyl butanoate, succinimidyl propionate , N-hydroxysuccinimide or succinimidyl carbonate. ≪ Desc / Clms Page number 7 >
- Another embodiment of the present invention is a GLP-2 sustained-release formulation having enhanced persistence and stability in vivo, comprising the GLP-2 conjugate.
- the gastrointestinal disorder is a gastrointestinal disorder, gastritis, gastric ulcer, duodenal ulcer, or duodenal ulcer.
- Another aspect of the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising GLP-2 derivative, GLP-2 conjugate or a pharmaceutical composition comprising the same as an active ingredient, Or a disease or disorder selected from the group consisting of:
- the medicament is for the use of a GLP-2 derivative or GLP-2 conjugate, which is for preventing or treating one or more diseases selected from enteric diseases, intestinal disorders and gastric diseases.
- Another embodiment of the present invention is the use of said GLP-2 derivative or GLP-2 conjugate in the prevention or treatment of one or more diseases selected from intestinal diseases, intestinal disorders and gastric diseases.
- the GLP-2 derivative of the present invention and its sustained-type conjugate are highly active and have an excellent effect sustaining effect in vivo, so they can be effectively used for preventing, ameliorating, and treating intestinal diseases, intestinal damage, and gastric diseases.
- FIG. 1 shows the results of analyzing the purity of the GLP-2 derivative's persistent complex by a reversed phase column.
- FIG. 2 is a graph showing changes in blood concentration of the GLP-2 derivative's sustained-type conjugate.
- FIG. 3 is a graph showing changes in the blood concentration of a continuous conjugate of Teduglutide and GLP-2 derivatives.
- FIG. 4 is a graph showing in vivo effects (A: small bowel weight, B: small intestine villi length) of a continuous conjugate of Teduglutide and GLP-2 derivatives.
- One embodiment for implementing the present invention provides a GLP-2 derivative.
- GLP-2 derivative means a peptide having at least one amino acid sequence difference compared to native GLP-2; A peptide modified through modification of the wild-type GLP-2 sequence; A natural type GLP-2 mimetic having a function of preventing, treating and / or improving intestinal damage, intestinal diseases and gastric diseases such as natural type GLP-2, and is capable of inhibiting GLP-2 receptor in vitro and / or in vivo ≪ / RTI > derivatives having excellent activity.
- Glucagon-like peptide-2 (GLP-2) of the present invention is a peptide having a function of preventing, treating and / or improving intestinal damage, intestinal diseases, 2, as well as agonists, fragments, variants and derivatives thereof, and the like.
- GLP-2 agonist in the present invention refers to a substance which binds to a GLP-2 receptor in vivo to cause the same or similar physiological activity as native GLP-2 regardless of the structure of GLP-2.
- GLP-2 fragment in the present invention means a peptide in which one or more amino acids are added or deleted at the N-terminal or C-terminal of GLP-2, wherein the added amino acid is an unnatural amino acid Type amino acids) are also possible.
- GLP-2 variant means a peptide in which at least one amino acid is different from wild-type GLP-2, and the non-natural amino acid can be substituted in addition to the native amino acid.
- Such variations for the preparation of agonists, fragments, variants and derivatives of native GLP-2 in the present invention include modifications using L- or D-type amino acids, and / or non-native amino acids; And / or altering the native sequence by modifying or post-translational modification (e.g., methylation, acylation, ubiquitination, intramolecular covalent bonding, etc.).
- Such agonists, fragments, variants and derivatives of native GLP-2 may have the function of preventing, treating and improving intestinal damage, enteric diseases and gastric diseases.
- the agonists, fragments, variants and derivatives of native GLP-2 to be applied to the present invention can be prepared by a combination of various methods for producing agonists, fragments, variants and derivatives.
- the GLP-2 used in the present invention can be synthesized by a solid phase synthesis method and can also be produced by a recombinant method.
- the GLP-2 derivative is selected from the group consisting of any of amino acid substitution, addition, deletion and modification in native GLP-2, or a combination of these methods. It may be deformed through.
- the amino acid sequence of the wild-type GLP-2 is as follows.
- HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID NO: 1)
- the GLP-2 derivative is a GLP-2 derivative, which is obtained by substituting the second amino acid of natural type GLP-2 with glycine or Aib (2-aminoisobutyric acid), substituting the 30th amino acid with arginine, But is not limited thereto.
- derivatives of GLP-2 may be at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homologous to the native GLP-2 , Or some group of amino acid residues of GLP-2 may be chemically substituted (eg, alpha-methylation, alpha-hydroxylation), eliminated (eg, deamination) or modified (eg, N-methylated) But is not limited thereto.
- the GLP-2 derivative may include, but not limited to, a thiol group, an amino group, or an azide group in GLP-2. Since the GLP-2 derivative has excellent activity in vitro and / or in vivo against the GLP-2 receptor, and the GLP-2 derivative binds in the introduced group when the GLP-2 derivative is prepared as a persistent conjugate, An optionally modified GLP-2 conjugate can be prepared. Specifically, a substance capable of binding one end of the non-peptide polymer to the hydroxyl group, thiol group, amino group or azide group of the GLP-2 derivative and increasing the half-life in vivo at the other end of the non-peptide polymer ( For example, an immunoglobulin Fc region) can be combined.
- a substance capable of binding one end of the non-peptide polymer to the hydroxyl group, thiol group, amino group or azide group of the GLP-2 derivative and increasing the half-life in vivo at the other end of the non-peptide polymer for example,
- the thiol group, amino group or azide group may be introduced by adding an amino acid to GLP-2, but is not limited thereto.
- the thiol group is introduced by adding cysteine (C) to GLP-2;
- the amino group is introduced by addition of lysine (K), arginine (R), glutamine (Q) or histidine (H);
- the azide group may be introduced by adding 6-azidolysine, AZ K, but is not limited thereto.
- the GLP-2 derivative may be, but is not limited to, at least one of the residues may be cysteine, lysine, arginine, glutamine, histidine or 6-azidoraicin.
- the GLP-2 derivative may be substituted, removed, or modified with an N-terminal amino group, but is not limited thereto.
- the GLP-2 derivative of the present invention can be prepared by a method of removing the alpha amino group of N-terminal histidine, a method of removing N-terminal histidine, a method of removing N- Terminal amino group is replaced with a hydroxyl group or a carboxyl group, a method in which an N-terminal amino group bonded to an alpha carbon and an alpha carbon of an N-terminal histidine is removed to form an imidazo-acetyl group, A method of leaving only the functional group, a method of modifying the N-terminal amino group with two methyl groups, and the like.
- GLP-2 imidazoacetyl-deshistidyl (GLP-2) in which the N-terminal amino group bonded to the alpha carbon and alpha carbon of the histidine residue, the N-terminal first amino acid of GLP- (Desaminohistidyl GLP-2, DA-GLP-2) in which the N-terminal amino group of GLP-2 is removed, the N-terminus of GLP-2 Beta -hydroxyimidazopropionyldeshistidyl GLP-2, HY-GLP-2) in which the amino group is substituted with a hydroxyl group, a compound in which the N-terminal amino group of GLP- (N-dimethylhistidyl GLP-2, DM-GLP-2), or a beta-carboxyimidazopropionyldehydeshtidyl-GLP-2 in which the N-terminal amino group of GLP- But is not limited to, GLP-2 (? -
- the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native type GLP-2, with glycine and introduction of a thiol group (for example, cysteine) at the C-terminus, more specifically N Terminal amino group bonded to the alpha carbon and alpha carbon of the histidine residue which is the terminal first amino acid, and examples thereof include, but not limited to, the amino acid sequence of SEQ ID NO: 2 Do not.
- the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native type GLP-2, with glycine and introduction of an amino group (for example, lysine) at the C-terminus, more specifically N End amino group bonded to the alpha carbon and alpha carbon of the histidine residue, which is the terminal first amino acid, and may include, for example, but not limited to, the amino acid sequence of SEQ ID NO: 3 Do not.
- the GLP-2 derivative of the present invention is a GLP-2 derivative, which is obtained by substitution of alanine, which is the second amino acid of natural type GLP-2, with glycine, substitution of arginine as the 30 th amino acid of natural GLP- Includes the introduction of an amino group (e. G., Lysine), and more specifically, an imidazoacetyl dehydrohyde having an N-terminal amino group bonded to the alpha carbon and alpha carbon of the histidine residue, For example, but is not limited to, the amino acid sequence of SEQ ID NO: 4.
- the GLP-2 derivative of the present invention comprises the substitution of alanine, which is the second amino acid of native type GLP-2, with glycine and the introduction of an azide group at the C-terminus (for example, 6- , More specifically imidazoacetyldecyl histidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, is removed, for example, an amino acid sequence of SEQ ID NO: 5 But is not limited thereto.
- the GLP-2 derivative of the present invention is a GLP-2 derivative, which is obtained by substitution of alanine, which is the second amino acid of natural type GLP-2, with glycine, substitution of arginine as the 30 th amino acid of natural GLP- (E. G., Cysteine), and more specifically may include imidazoacetyl dehydrohyde, in which the N-terminal amino group attached to the alpha carbon and alpha carbon of the histidine residue, the N-terminal first amino acid, For example, but is not limited to, the amino acid sequence of SEQ ID NO: 6.
- the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native type GLP-2, with glycine and introduction of a thiol group (for example, cysteine) at the C-terminus, 8, and more specifically, imidazoacetyldecyl histidine in which the N-terminal amino group bound to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, is removed,
- alanine which is the second amino acid of native type GLP-2
- glycine for example, cysteine
- imidazoacetyldecyl histidine in which the N-terminal amino group bound to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, is removed
- the amino acid sequence of SEQ ID NO: 7 is not limited thereto.
- the GLP-2 derivatives of SEQ ID NOS: 2 to 8 are shown in Table 1 below.
- Ca H is replaced with imidazoacetyldehyde histidine instead of histidine
- Aib is 2-aminoisobutyric acid
- AZ K is 6-azido-L-lysine (6-azido -L-lysyine. ≪ / RTI >
- the GLP-2 derivative according to the present invention may be, but is not limited to, a peptide comprising a specific sequence as described above, a peptide consisting essentially of the specific sequence described above.
- the GLP-2 derivative may comprise, but is not limited to, the amino acid sequence of the following general formula:
- X 1 is histidine, imidazoacetyldehistidine, desaminohistidine,? -Hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or? -Carboxyimidazopropionyldeshistidine;
- X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
- X 30 is lysine or arginine
- X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidyl lysine, or cysteine;
- sequence identical to SEQ ID NO: 1 is excluded from the amino acid sequence of the general formula (1).
- the GLP-2 derivative may be represented by the general formula (1) wherein X 2 is glycine, (2) X 30 is arginine, or (3) X 2 is glycine and X 30 is arginine, But is not limited thereto.
- the GLP-2 derivative is represented by the general formula 1
- X 1 is histidine
- X 2 is Aib
- X 30 is lysine
- X 34 is cysteine
- the GLP-2 derivative includes both the peptide itself, a salt thereof (e.g., a pharmaceutically acceptable salt of the peptide), or a solvate thereof.
- the peptide or GLP-2 derivative may be in any pharmaceutically acceptable form.
- the kind of the salt is not particularly limited. However, it is preferable to be a safe and effective form for an individual such as a mammal, but the present invention is not particularly limited thereto.
- pharmaceutically acceptable means a substance that can be effectively used in a desired application without causing undue toxicity, irritation, or allergic reaction within the scope of medical judgment.
- salts derived from pharmaceutically acceptable inorganic acids, organic acids, or bases include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, perchloric acid, fumaric acid, maleic acid, phosphoric acid, glycolic acid, lactic acid, salicylic acid, succinic acid, toluene-p-sulfonic acid, tartaric acid, acetic acid, , Benzoic acid, malonic acid, naphthalene-2-sulfonic acid, and benzenesulfonic acid.
- Salts derived from suitable bases may include alkali metals such as sodium and potassium, alkaline earth metals such as magnesium, and ammonium.
- solvate refers to a peptide or its salt according to the present invention complexed with a solvent molecule.
- the GLP-2 derivative of the present invention can be synthesized by a solid phase synthesis method, can also be produced by a recombinant method, and can be produced commercially.
- Another aspect for implementing the present invention provides a transformant comprising the isolated nucleic acid encoding the GLP-2 derivative, a recombinant expression vector comprising the nucleic acid, and the recombinant expression vector.
- the GLP-2 derivative is as described above.
- the nucleic acids of the present invention can be isolated or prepared using standard molecular biology techniques. For example, it can be amplified by PCR (polymerase chain reaction) from the native GLP-2 gene sequence using appropriate primer sequences and can be prepared using standard synthetic techniques using an automated DNA synthesizer.
- vector refers to a nucleic acid construct comprising a necessary regulatory element operably linked to the expression of a nucleic acid insert, as a recombinant vector capable of expressing a desired protein in a suitable host cell.
- the present invention can produce a recombinant vector comprising a nucleic acid encoding a GLP-2 derivative. By transforming or transfecting the recombinant vector into a host cell, the GLP-2 derivative of the present invention .
- the recombinant vector according to the present invention can be typically constructed as a vector for cloning or as a vector for expression, and can be constructed with prokaryotic or eukaryotic cells as host cells.
- a nucleic acid encoding a GLP-2 derivative may be operably linked to a promoter.
- operatively linked refers to a functional linkage between a nucleic acid expression control sequence (e.g., a promoter, a signal sequence, a ribosome binding site, a transcription termination sequence, , Whereby the regulatory sequence regulates transcription and / or translation of the different nucleic acid sequences.
- a nucleic acid expression control sequence e.g., a promoter, a signal sequence, a ribosome binding site, a transcription termination sequence, , Whereby the regulatory sequence regulates transcription and / or translation of the different nucleic acid sequences.
- promoter refers to a nucleic acid sequence which is usually located upstream of the coding region, including the binding site for the polymerase and which has a transcription initiation activity to the mRNA of the promoter subgenus, refers to a DNA region that binds to initiate transcription of a gene and may be located at the 5'-site of the mRNA transcription initiation site.
- a strong promoter capable of promoting transcription such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter
- a ribosome binding site for initiation of detoxification such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter
- a ribosome binding site for initiation of detoxification such as a ribosome binding site for initiation of detoxification
- a transcription / translation termination sequence such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promote
- the vectors that can be used in the present invention include plasmids such as pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, , pGEX series, pET series, pPICZ? series, pUC19 and the like), phage (e.g.? gt4? B,? -charon,? z1 and M13) or viruses such as SV40.
- plasmids such as pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, , pGEX series, pET series, pPICZ? series, pUC19 and the
- a promoter derived from the genome of a mammalian cell such as a metallothionein promoter
- a mammalian virus e.g., adenovirus Late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter, and tk promoter of HSV
- a polyadenylation sequence e.g., bovine growth hormone terminator and SV40 derived polyadenylation sequence
- the recombinant vector of the present invention may further comprise other sequences as necessary in order to facilitate the purification of the recovered target protein, i.e. GLP-2 derivative.
- the further included sequences may be tag sequences for protein purification and include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and hexahistidine.
- glutathione S-transferase Pharmacia, USA
- maltose binding protein NEB, USA
- FLAG IBI, USA
- hexahistidine hexahistidine
- the fusion protein expressed by the recombinant vector containing the tag sequence as described above can be purified by affinity chromatography.
- affinity chromatography For example, when glutathione-S-transferase is fused, glutathione, which is a substrate of the enzyme, can be used.
- glutathione which is a substrate of the enzyme, can be used.
- six histidine tags are used, a target protein can be easily recovered using a Ni-NTA column .
- the method for transforming a recombinant vector comprising a nucleic acid encoding a GLP-2 derivative according to the present invention is not limited to the above examples, and the transformation or transfection methods conventionally used in the art can be used without limitation .
- the Recode technology of Ambrx which can attach polyethylene glycol in a position-specific manner when polyethylene glycol is used as a carrier can be included, and the glycopegylation technique of Neose which can be specifically attached to the sugar chain site can be included have.
- releasable PEG techniques in which polyethylene glycol is slowly removed in vivo may be included, but the present invention is not limited thereto, and techniques for increasing bioavailability using PEG may be included.
- immunoglobulin Fc region means the remaining portion of the immunoglobulin except for the heavy chain and light chain variable region, heavy chain constant region 1 (CH1) and light chain constant region (CL) It may also include a hinge region in the constant region. Particularly a fragment comprising the entire immunoglobulin Fc region and a portion thereof, and in the present invention the immunoglobulin Fc region may be mixed with an immunoglobulin fragment or an immunoglobulin constant region.
- the immunoglobulin Fc fragment has a relatively smaller molecular weight than that of the whole immunoglobulin molecule, it is advantageous in terms of preparation, purification and yield of the conjugate, and since the Fab region exhibiting high inhomogeneity due to the different amino acid sequence is removed, And the possibility of inducing blood antigenicity can be expected to be lowered.
- the immunoglobulin constant region may be a natural type sugar chain, an increased sugar chain as compared with the native type, and a reduced sugar chain or sugar chain as compared with the native type.
- Conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms can be used to increase or decrease the immunoglobulin constant region sugar chains.
- the immunoglobulin constant region in which the sugar chain is removed in the immunoglobulin constant region significantly decreases the binding force of the complement (c1q) and reduces or eliminates the antibody-dependent cytotoxicity or complement-dependent cytotoxicity, Lt; / RTI >
- forms that are more consistent with the original purpose of the drug as a carrier will be immunoglobulin constant regions with or without glycosylation.
- non-glycosylated Fc regions derived from human IgG4, i.e., human unchallenged IgG4 Fc regions can be used.
- the human-derived Fc region may be preferable to the non-human-derived Fc region which can act as an antigen in a human organism and cause an undesirable immune response such as the generation of new antibodies thereto.
- the linker may be a peptide linker or a non-peptide linker.
- the non-peptide linker By using a protease resistant polymer as the non-peptide linker, the blood half-life of the GLP-2 derivative can be maintained similarly to a substance capable of increasing the in vivo half-life of the GLP-2 derivative. Therefore, the non-peptide linker that can be used in the present invention can be used without limitation as long as it has the above-mentioned role, that is, a non-peptide polymer resistant to in vivo protease.
- non-peptide polymer in the present invention includes a biocompatible polymer having two or more repeating units bonded, and is mixed with a " non-peptide linker ".
- the repeating units are linked to each other via any covalent bond rather than a peptide bond.
- the non-peptide polymer may include a reactive group at the terminal thereof to form a conjugate through reaction with other constituent components constituting the conjugate.
- Such non-peptide polymers may have both ends or three ends.
- the GLP-2 derivative is conjugated to an immunoglobulin Fc region and a GLP-2 derivative through a non-peptide polymer comprising a reactor capable of binding to both an immunoglobulin Fc region and a GLP-2 derivative at both ends And may be covalently linked to each other.
- the non-peptide polymer is selected from the group consisting of polyethylene glycol, polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, a polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl Biodegradable polymers such as ethyl ether, polylactic acid (PLA) and polylactic-glycolic acid (PLGA), lipopolymers, chitins, hyaluronic acid, oligonucleotides, and combinations thereof.
- the non-peptide polymer may be, but is not limited to, polyethylene glycol.
- the linkage by the linker may be any chemical bond such as a non-covalent chemical bond or a covalent chemical bond, and there is no limitation thereto.
- the non-peptide polymer which can be used in the present invention may be any polymer that is resistant to proteolytic enzymes in vivo, but specifically, the molecular weight of the non-peptide polymer is in the range of more than 0 to 200 kDa, specifically in the range of 1 to 100 kDa , More specifically in the range of 1 to 50 kDa, even more specifically in the range of 1 to 20 kDa, even more specifically in the range of 3.4 to 10 kDa, even more specifically about 3.4 kDa.
- both ends of the non-peptide polymer may be bonded to a thiol group, an amino group, an azide group, or a hydroxyl group of a thiol group, an amino group, a hydroxyl group and a GLP-2 derivative of an immunoglobulin Fc region have.
- the reactor of the non-peptide polymer may be at least one selected from the group consisting of an aldehyde group, a propionaldehyde group, a butylaldehyde group, a maleimide group and a succinimide derivative, but is not limited thereto.
- succinimide derivatives examples include succinimide derivatives such as succinimidyl carboxymethyl, succinimidyl valerate, succinimidyl methyl butanoate, succinimidyl methyl propionate, succinimidyl butanoate, succinimidyl butanoate, N-hydroxysuccinimide, or succinimidyl carbonate may be used, but the present invention is not limited thereto.
- the terminal reactors of the non-peptide polymers of the present invention may be the same or different from each other.
- the non-peptide polymer may have an aldehyde group reactor at the end, and the non-peptide polymer may have an aldehyde group and a maleimide reactor at the ends, respectively, or may have an aldehyde group and a succinimide reactor at the ends, respectively But is not limited thereto.
- the reactor of the non-peptide polymer may be connected to the cysteine residue of a GLP-2 derivative, more specifically to the -SH group of cysteine, but is not limited thereto.
- the maleimide group is linked to the -SH group of the GLP-2 derivative by a thioether bond, and the aldehyde group is linked to the -NH 2 group of the immunoglobulin Fc through a reductive alkylation reaction But is not limited thereto, which corresponds to one example.
- the N-terminal amino group of the immunoglobulin Fc region is linked to the oxygen atom located at one end of the PEG through a linker functional group having a structure of -CH 2 CH 2 CH 2 - to form -PEG-O -CH 2 CH 2 CH 2 NH- it is possible to form a structure, such as an immunoglobulin Fc, there is one end of the PEG via a thioether bond to form a structure attached to a sulfur atom of a cysteine in the GLP-2 derivative.
- the thioether linkage As shown in FIG.
- the present invention is not particularly limited to the above-mentioned example, which corresponds to one example.
- the linkage of a GLP-2 derivative and a substance capable of extending in vivo half-life may be a genetic recombination method.
- the GLP-2 conjugate of the present invention is a GLP-2 derivative wherein the GLP-2 derivative and the immunoglobulin Fc region are linked via covalent bonds at both ends of the non-peptide polymer via non-peptide polymers, As a combination,
- the non-peptide polymer may be selected from the group consisting of polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, ≪ / RTI > or a GLP-2 conjugate selected from the group consisting of combinations thereof.
- the GLP-2 derivative of the present invention can form a covalent bond with the non-peptide polymer in which the introduced thiol group, amino group or azide group is a linker.
- the GLP-2 derivative of the present invention is used, 0.0 > GLP-2 < / RTI >
- the GLP-2 derivative of the present invention can prevent the N-terminal amino group from being substituted, removed or modified so that the non-peptide polymer is prevented from binding to the N-terminal, which is an important site for in vivo activity, 0.0 > GLP-2 < / RTI >
- the GLP-2 conjugate is used in combination with a conjugate of a GLP-2 derivative, a GLP-2 derivative sustained conjugate, or a combination of a continuous GLP-2 derivative.
- the GLP-2 derivative, a substance capable of increasing the in vivo half-life thereof, and the GLP-2 conjugate are as described above.
- ligand refers to an intermediate in which only one of the non-peptide polymer and the GLP-2 derivative or carrier is linked by a covalent bond, and the terminal of the non-peptide polymer to which the GLP- , A GLP-2 derivative or a carrier not attached to the linkage may be bonded.
- Another aspect of the present invention provides GLP-2 persistent formulations with increased persistence and stability in vivo, comprising the GLP-2 conjugate.
- agents capable of increasing bioavailability or maintaining sustained activity include microparticles using PLGA, hyaluronic acid, chitosan, etc., sustained release formulations using nanoparticles, and the like.
- agents for increasing bioavailability or maintaining sustained activity may be agents such as implants, inhalations, nasal preparations, patches, and the like.
- the GLP-2 conjugate of the present invention not only maintains the in vivo activity of the existing GLP-2 but also significantly increases the blood half-life of the GLP-2 derivative and thus the sustained effect of the peptide in vivo, Diseases, intestinal disorders and gastric diseases.
- the pharmaceutical composition may be a pharmaceutical composition for prevention or treatment of one or more diseases selected from intestinal diseases, intestinal injury and gastric diseases.
- the GLP-2 derivative and the GLP-2 conjugate are as described above.
- intestinal disease in the present invention may be, but is not limited to, Gingko's syndrome, irritable bowel disease, inflammatory bowel disease, Crohn's disease, colitis, colitis, pancreatitis, ileitis, mucositis or intestinal atrophy.
- gastric disease includes, but is not limited to, gastric ulcer, gastritis, gastric ulcer, duodenal ulcer, or duodenal ulcer.
- prevention means any action that inhibits or delays the onset of the disease by administration of the pharmaceutical composition
- treatment means that administration of the pharmaceutical composition alleviates or ameliorates symptoms of the disease It means all acts.
- the pharmaceutical composition according to the present invention may comprise a pharmaceutically acceptable carrier.
- pharmaceutically acceptable in the present invention means that the compound does not cause a sufficient amount and side effects sufficient to exhibit the therapeutic effect, and the kind of the disease, the age, body weight, health, sex, , The route of administration, the manner of administration, the frequency of administration, the duration of treatment, the formulations, or the medicaments used concurrently, well known in the medical arts.
- the pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizing agent, a dispersing agent, a stabilizer, a suspending agent, a coloring matter and a perfume in the case of oral administration, A solubilizer, an isotonic agent, and a stabilizer may be used in combination.
- a base, an excipient, a lubricant and a preservative may be used.
- Formulations of the pharmaceutical compositions of the present invention may be prepared in a variety of ways by mixing with a pharmaceutically acceptable carrier as described above.
- oral administration may be in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc.
- unit dosage ampoules or multiple dosage forms may be prepared.
- it can be formulated into solutions, suspensions, tablets, pills, capsules and sustained release formulations.
- suitable carriers, excipients and diluents for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil and the like can be used. Further, it may further include a filler, an anticoagulant, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent and an antiseptic agent.
- the GLP-2 derivative and / or GLP-2 conjugate of the present application may be contained in an amount of 0.001% by weight to 10% by weight based on the total weight of the composition of the present application, but is not particularly limited thereto.
- Another embodiment for implementing the present invention is a pharmaceutical composition
- a pharmaceutical composition comprising the GLP-2 derivative, GLP-2 conjugate and / or a pharmaceutical composition comprising the same as an active ingredient, And at least one disease selected from gastric diseases.
- the GLP-2 derivative, GLP-2 conjugate, pharmaceutical composition, intestinal disease, intestinal injury, gastric disease, prevention and treatment are as described above.
- individual in the present invention refers to an individual suspected of having a bowel disorder, intestinal injury, or gastrointestinal disorder, wherein the suspected individual is a mammal including a human, Quot; means that the GLP-2 derivative of the present invention, the GLP-2 conjugate, or an individual treatable with the above composition comprising the same is not limited.
- administration means introducing a predetermined substance into a patient by any appropriate method, and the analogue administration route can be administered through any conventional route so long as the drug can reach the target tissue. But are not limited to, intraperitoneal, intravenous, intramuscular, subcutaneous, intradermal, oral, topical, intranasal, intrapulmonary and rectal administration. However, since the peptide is extinguished upon oral administration, it is preferable that the oral composition is formulated so as to coat the active agent or protect it from decomposition at the top. Preferably in the form of an injection. In addition, the pharmaceutical composition may be administered by any device capable of transferring the active ingredient to the target cell.
- the pharmaceutical composition of the present invention is determined depending on the kind of drug, which is an active ingredient, together with various related factors such as the disease to be treated, the route of administration, the age, sex and weight of the patient and the severity of the disease. Since the pharmaceutical composition of the present invention is excellent in persistence in vivo, the frequency and frequency of administration of the pharmaceutical composition of the present invention can be remarkably reduced.
- the total effective amount of the composition of the present invention may be administered to a patient in a single dose and may be administered by a fractionated treatment protocol administered over a prolonged period of time in multiple doses.
- the content of the active ingredient may be varied depending on the degree of the disease.
- a preferred total dose of the GLP-2 derivative or GLP-2 conjugate of the present invention may be about 0.0001 mg to 500 mg per kg body weight of the patient per day.
- the dose of the GLP-2 derivative or the GLP-2 conjugate is not limited to the administration route of the pharmaceutical composition and the number of treatments, but also various factors such as the patient's age, body weight, health condition, sex, severity of disease, Given this fact, one of ordinary skill in the art will be able to determine the appropriate effective dose according to the particular use of the composition of the present invention, since the effective dose for the patient will be determined.
- the pharmaceutical composition according to the present invention is not particularly limited to its formulation, administration route and administration method as long as the effect of the present invention is exhibited.
- Another aspect for implementing the present invention is the use of said GLP-2 derivative or GLP-2 conjugate in the manufacture of a medicament.
- the medicament is for prevention or treatment of one or more selected from intestinal diseases, intestinal disorders and gastric diseases, but is not particularly limited thereto.
- Another embodiment for implementing the present invention is the use of said GLP-2 derivative or GLP-2 conjugate in the prevention or treatment of at least one selected from enteric diseases, intestinal disorders and gastric diseases.
- the GLP-2 derivative, GLP-2 conjugate, intestinal disease, intestinal damage, gastric disease are as described above.
- 10 kDa MAL-ALD PEG polyethylene glycol having a molecular weight of 10 kDa modified with an aminopropyl group and a propyl aldehyde group, both of which were hydrogen at both terminals thereof, 3 - [(3-N-maleimidyl) propane oil, Japan NOF)
- the molar ratio of CA-GLP-2 KC or CA-GLP-2 RC to PEG was adjusted to 1: 1 to cause pegylation to cysteine residue 34 of GLP-2 KC or CA-GLP-2 RC (CPC, Chinese Peptide Co, 1 to 2, and the peptide concentration was 1 to 3 mg / ml for 1 to 3 hours.
- the reaction was carried out in a mixed solvent of 50 mM Tris pH 7.5 and isopropanol.
- the reaction mixture contained mono-PEGylated CA-GLP-2 KC or monopegylated KC using SP citrate high performance (GE, USA) column with sodium citrate pH 2.0, ethanol buffer and potassium chloride concentration gradient
- the lengthened CA-GLP-2 RC was purified.
- the molar ratio of the purified monopegylated CA-GLP-2 KC or monopegylated CA-GLP-2 RC to the immunoglobulin Fc fragment was 1: 2 to 1: 6, 30 ⁇ 35 mg / mL at 2 ⁇ 8 °C for 12 ⁇ 20 hours.
- 20 mM sodium cyanoborohydride (NaCNBH3) was added to 100 mM potassium phosphate buffer (pH 6.0) and isopropanol as a reducing agent.
- the reaction mixture was applied to a Source 15 Q (GE, USA) column using a bis-Tris pH 6.5 buffer and a sodium chloride concentration gradient, and a gradient of ammonium sulfate and sodium citrate pH 5.0-5.2 GLP-2 KC (10K PEG), which is a conjugate of c-GLP-2 KC or CA-GLP-2 RC covalently linked by PEG to immunoglobulin Fc, was applied to Source 15ISO GLP-2 RC-PEG (10K) - a sustained-release conjugate of derivatives of the CA-GLP-2 KC-PEG (10K) -immunoglobulin Fc and CA- Fc.
- the purity of the conjugate was 92.9% and 95.6%, respectively, and the results are shown in Fig.
- GLP-2 RK CPC, Chinese Peptide Co., China
- PEG polyethylene glycol having a molecular weight of 3.4 kDa modified with a propylaldehyde group at both terminals
- the reaction was carried out at 2 to 8 ° C for 4 to 16 hours at a molar ratio of CA-GLP-2 RK to PEG of 1: 5 to 1:20 and a peptide concentration of 5 to 10 mg / ml for pegylation to lysine residue 34 .
- the reaction was carried out in 20 mM HEPES pH 7.5 and ethanol and reacted by adding 20 mM sodium cyanoborohydride as a reducing agent.
- the reaction solution was purified by monopepylated CA-GLP-2 RK using a buffer solution containing sodium citrate pH 2.0, ethanol and a Source 15S (GE, USA) column using a potassium chloride concentration gradient.
- the purity of the persistent conjugate CA-GLP-2 RK-PEG (10K) -immunoglobulin Fc of immunoglobulin Fc and CA GLP-2 RK (10K PEG) derivatives was 94.3% and 92.6%, respectively, 1.
- the immunoglobulin Fc CA-GLP-2 KK or CA-GLP-2 K AZ K is shared by PEG Long-acting conjugates of CA GLP-2 KK (10K PEG ) derivatives in combination with associated coupling CA-GLP-2 KK- PEG ( 10K) - Long-acting of the immunoglobulin Fc and the CA GLP-2 K AZ K ( 10K PEG) derivative
- the conjugate CA-GLP-2 K AZ K-PEG (10K) -immunoglobulin Fc was prepared and purified.
- GLP-2 derivatives and GLP-2 derivative continuous conjugates obtained in the previous examples a method of measuring cell activity in vitro using GLP-2 receptor-transformed cell lines was used.
- the cell line is transformed to express human GLP-2 receptor in CHO (Chinese hamster ovary) -K1, and is suitable for measuring the activity of GLP-2 (DiscoverX, USA).
- GLP-2 and Teduglutide were diluted from 166.7 nM to 0.0028 nM by 3-fold, GLP-2 derivative from 500 nM to 0.0085 nM by 3-fold, The continuous conjugate of GLP-2 derivative was serially diluted from 3000 nM to 3,050 nM by 3-fold.
- the culture solution was removed from CHO-K1 cells expressing the cultured human GLP-2 receptor, 5 ⁇ l of each of the continuously diluted substances was added to the cells, and 5 ⁇ l of a buffer containing cAMP antibody was added And incubated at room temperature for 15 minutes.
- novel GLP-2 derivative and the sustained-type conjugate prepared as described above have the function of activating the GLP-2 receptor, and it was confirmed that the GLP-2 derivative has a higher relative titer than human GLP-2. Further, the persistent conjugates of the GLP-2 derivative (CA GLP-2 RK) of SEQ ID NO: 4 and the GLP-2 derivative of SEQ ID NO: 6 (CA GLP-2 RC) KC) as compared to the sustained-type conjugate, it can be used as a therapeutic substance for a desired disease.
- the pharmacokinetics of the GLP-2 derivatives' persistent binders were compared in normal rats.
- the 8-week-old normal rats were treated with CA GLP-2 KC (10K PEG) derivatives, CA GLP-2 RC (10K PEG) derivatives, CA GLP-2 RK (10K PEG) (2.52 mg / kg), respectively.
- the test substances were administered at 1, 4, 8, 24, 48, 72, 96, 120, 144 24, 48, 72, 96, 120, 144, 168, 192, 216 in the continuous conjugates of the other CA GLP-2 derivatives , 240, 264, 288, 312, and 336 hours.
- anti-human IgG4-HPR (Alpha Diagonosis, # 10124) was added, reacted at room temperature for 1 hour, color developed with TMB reagent, and absorbance was measured at 450 nm wavelength. Pharmacokinetic parameters were calculated using serum concentrations.
- the PK parameter which indicates the body's exposure level of the drug and closely related to the efficacy / toxicity of the drug. (In order for the drug to be effective in the body, it should exhibit a certain level of body- Action can be shown)
- - MRT last : The mean residence time of the drug, the average time for the drug to disappear from the body. The longer the MRT is, the longer the drug stays in the body and the longer the MRT has has exist
- the 8-week-old normal rats were divided into the Teduglutide-treated group (2.5 mg / kg) and the CA GLP-2 RK (3.4K PEG) derivative-treated group (0.705 mg / kg).
- the administration of the CAGLP-2 RK derivative in the Teduglutide group was continued for 0.25, 0.5, 1, 1.5, 2, 3, 4, 6,
- the whole blood was obtained from the venous blood collection at 4, 8, 24, 48, 72, 96, 120, 144, 168, 192, 216, 240, 264, 288, 312 and 336 hours.
- anti-human IgG4-HPR (Alpha Diagonosis, # 10124) was added, reacted at room temperature for 1 hour, color developed with TMB reagent, and absorbance was measured at 450 nm wavelength. Pharmacokinetic parameters were calculated using serum concentrations.
- Example 7 In normal mice of the GLP-2 derivative sustained conjugate in vivo Chapter weight Ascertain the increase effect
- mice Seven-week-old C57BL / 6 mice were treated with vehicle, Teduglutide (7.5 & 15 nmol / kg / BID) and CA GLP-2 RK (3.4K PEG) / Q2D). Five mice were placed in each group and autopsied after 13 days of administration. After the intestine was perfused, the weight of the small intestine and the length of the villi within the small intestine were measured.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2020517828A JP7751381B2 (ja) | 2017-09-28 | 2018-09-28 | Glp-2誘導体の持続型結合体 |
| EA202090571A EA202090571A1 (ru) | 2017-09-28 | 2018-09-28 | Конъюгаты производных glp-2 пролонгированного действия |
| AU2018339210A AU2018339210B2 (en) | 2017-09-28 | 2018-09-28 | Long-acting conjugates of GLP-2 derivatives |
| BR112020006189-1A BR112020006189A2 (pt) | 2017-09-28 | 2018-09-28 | conjugado de peptídeo-2 tipo glucagon (glp-2), derivado de glp-2 que compreende uma sequência de aminoácidos e seu método se preparação, ácido nucleico isolado que codifica o derivado de glp-2, vetor de expressão recombinante que compreende o ácido nucleico, transformante que compreende o vetor de expressão recombinante, composição farmacêutica para prevenir ou tratar uma ou mais doenças selecionadas |
| CN201880074180.4A CN111433221B (zh) | 2017-09-28 | 2018-09-28 | 胰高血糖素样肽-2(glp-2)衍生物的长效缀合物 |
| SG11202002563WA SG11202002563WA (en) | 2017-09-28 | 2018-09-28 | Long-acting conjugates of glp-2 derivatives |
| MX2020004453A MX2020004453A (es) | 2017-09-28 | 2018-09-28 | Conjugados de accion prolongada de derivados de glp-2. |
| IL273528A IL273528B2 (en) | 2017-09-28 | 2018-09-28 | Long-acting conjugates of glp-2 derivatives |
| NZ762962A NZ762962B2 (en) | 2018-09-28 | Long-acting conjugates of glp-2 derivatives | |
| CA3084326A CA3084326A1 (en) | 2017-09-28 | 2018-09-28 | Long-acting conjugates of glp-2 derivatives |
| EP18860379.9A EP3689898B1 (en) | 2017-09-28 | 2018-09-28 | Long-acting conjugate of glucagon-like peptide-2 (glp-2) derivative |
| PH12020550105A PH12020550105A1 (en) | 2017-09-28 | 2020-03-19 | Long-acting conjugates of glp-2 derivatives |
| ZA2020/01888A ZA202001888B (en) | 2017-09-28 | 2020-03-24 | Long-acting conjugate of glucagon-like peptide-2 (glp-2) derivative |
| US16/832,634 US11530249B2 (en) | 2017-09-28 | 2020-03-27 | Long-acting conjugates of GLP-2 derivatives |
| SA520411644A SA520411644B1 (ar) | 2017-09-28 | 2020-03-28 | مترافق طويل المفعول لمشتق ببتيد-2 شبيه بالجلوكاجون (glp-2) |
| US17/721,048 US20220251164A1 (en) | 2017-09-28 | 2022-04-14 | Long-acting conjugates of glp-2 derivatives |
| US17/979,531 US20230090790A1 (en) | 2017-09-28 | 2022-11-02 | Long-acting conjugates of glp-2 derivatives |
| JP2023111438A JP2023138505A (ja) | 2017-09-28 | 2023-07-06 | Glp-2誘導体の持続型結合体 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20170126577 | 2017-09-28 | ||
| KR10-2017-0126577 | 2017-09-28 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/832,634 Continuation US11530249B2 (en) | 2017-09-28 | 2020-03-27 | Long-acting conjugates of GLP-2 derivatives |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019066586A1 true WO2019066586A1 (ko) | 2019-04-04 |
Family
ID=65902619
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2018/011586 Ceased WO2019066586A1 (ko) | 2017-09-28 | 2018-09-28 | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 |
Country Status (18)
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021198195A1 (en) | 2020-03-30 | 2021-10-07 | Zealand Pharma A/S | Agonist combination |
| CN115052619A (zh) * | 2019-12-24 | 2022-09-13 | 韩美药品株式会社 | 包含glp-2或其缀合物的用于预防或治疗代谢性骨病的药物组合物 |
| CN115697375A (zh) * | 2020-04-03 | 2023-02-03 | 韩美药品株式会社 | 预防或治疗放疗、化疗或其组合引发的粘膜炎的包含glp-2衍生物或其长效缀合物的药物组合物 |
| US20230285584A1 (en) * | 2020-05-22 | 2023-09-14 | Hanmi Pharm. Co., Ltd. | Liquid formulation of long-acting conjugate of glp-2 |
| US12576025B2 (en) | 2019-06-14 | 2026-03-17 | Zealand Pharma A/S | Pharmaceutical parenteral composition of dual GLP1/2 agonist |
| EP4512414A4 (en) * | 2022-04-18 | 2026-04-15 | Hanmi Pharmaceutical Co Ltd | GLP-2 POLYTHERAPY WITH INSULIN-TROPIC PEPTIDE, TNF INHIBITOR? OR BOTH TO PREVENT OR TREAT INTESTINAL DISEASES |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BR112022025141A2 (pt) | 2020-06-09 | 2023-04-25 | Vectivbio Ag | Fabricação, formulação e dosagem de apraglutida |
| KR20220092446A (ko) * | 2020-12-24 | 2022-07-01 | 한미약품 주식회사 | 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법 |
| CN120435309A (zh) | 2022-12-23 | 2025-08-05 | 韩美药品株式会社 | 含有glp-2衍生物或其长效缀合物的用于预防或治疗移植物抗宿主病的药物组合物 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| KR20080064750A (ko) * | 2007-01-05 | 2008-07-09 | 한미약품 주식회사 | 면역글로불린 단편을 이용한 인슐린분비 펩타이드 약물결합체 |
| KR20110093924A (ko) * | 2005-05-04 | 2011-08-18 | 질랜드 파마 에이/에스 | 글루카곤 유사 펩티드-2(glp-2) 유사체 |
| KR20120043205A (ko) * | 2010-10-26 | 2012-05-04 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 글루카곤 유사 펩타이드?2(glp?2)약물 결합체 |
| KR20130078634A (ko) * | 2011-12-30 | 2013-07-10 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 위치 특이적 글루카곤 유사 펩타이드-2 약물 결합체 |
| KR20140069131A (ko) * | 2011-09-12 | 2014-06-09 | 아뮤닉스 오퍼레이팅 인코포레이티드 | 글루카곤-유사 펩티드-2 조성물 및 이의 제조 및 사용 방법 |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK1360202T3 (da) * | 2001-02-16 | 2008-09-22 | Conjuchem Biotechnologies Inc | Langvarigt glucagon-lignende peptid 2 (GLP-2) til behandling af gastrointestinale sygdomme og lidelser |
| US20090238838A1 (en) * | 2003-11-13 | 2009-09-24 | Hanmi Pharm. Ind. Co. Ltd. | Insulinotropic peptide conjugate using an immunoglobulin fc |
| HRP20060362A2 (en) * | 2004-04-23 | 2007-03-31 | Conjuchem Biotechnologies Inc. | Method for the purification of albumin conjugates |
| US20110171164A1 (en) * | 2008-09-19 | 2011-07-14 | Nektar Therapeutics | Polymer conjugates of glp-2-like peptides |
-
2018
- 2018-09-28 EA EA202090571A patent/EA202090571A1/ru unknown
- 2018-09-28 SG SG11202002563WA patent/SG11202002563WA/en unknown
- 2018-09-28 AR ARP180102806A patent/AR113258A1/es unknown
- 2018-09-28 BR BR112020006189-1A patent/BR112020006189A2/pt unknown
- 2018-09-28 IL IL273528A patent/IL273528B2/en unknown
- 2018-09-28 EP EP18860379.9A patent/EP3689898B1/en active Active
- 2018-09-28 CN CN201880074180.4A patent/CN111433221B/zh active Active
- 2018-09-28 TW TW107134398A patent/TWI795443B/zh active
- 2018-09-28 MX MX2020004453A patent/MX2020004453A/es unknown
- 2018-09-28 KR KR1020180116327A patent/KR102681143B1/ko active Active
- 2018-09-28 WO PCT/KR2018/011586 patent/WO2019066586A1/ko not_active Ceased
- 2018-09-28 TW TW110126453A patent/TWI794897B/zh active
- 2018-09-28 CA CA3084326A patent/CA3084326A1/en active Pending
- 2018-09-28 JP JP2020517828A patent/JP7751381B2/ja active Active
- 2018-09-28 AU AU2018339210A patent/AU2018339210B2/en active Active
-
2020
- 2020-03-19 PH PH12020550105A patent/PH12020550105A1/en unknown
- 2020-03-24 ZA ZA2020/01888A patent/ZA202001888B/en unknown
- 2020-03-27 US US16/832,634 patent/US11530249B2/en active Active
- 2020-03-28 SA SA520411644A patent/SA520411644B1/ar unknown
-
2022
- 2022-04-14 US US17/721,048 patent/US20220251164A1/en active Pending
- 2022-11-02 US US17/979,531 patent/US20230090790A1/en active Pending
-
2023
- 2023-07-06 JP JP2023111438A patent/JP2023138505A/ja active Pending
-
2024
- 2024-01-22 KR KR1020240009740A patent/KR102681144B1/ko active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| KR20110093924A (ko) * | 2005-05-04 | 2011-08-18 | 질랜드 파마 에이/에스 | 글루카곤 유사 펩티드-2(glp-2) 유사체 |
| KR20080064750A (ko) * | 2007-01-05 | 2008-07-09 | 한미약품 주식회사 | 면역글로불린 단편을 이용한 인슐린분비 펩타이드 약물결합체 |
| KR20120043205A (ko) * | 2010-10-26 | 2012-05-04 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 글루카곤 유사 펩타이드?2(glp?2)약물 결합체 |
| KR20140069131A (ko) * | 2011-09-12 | 2014-06-09 | 아뮤닉스 오퍼레이팅 인코포레이티드 | 글루카곤-유사 펩티드-2 조성물 및 이의 제조 및 사용 방법 |
| KR20130078634A (ko) * | 2011-12-30 | 2013-07-10 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 위치 특이적 글루카곤 유사 펩타이드-2 약물 결합체 |
Non-Patent Citations (4)
| Title |
|---|
| BOLETTE H. ET AL., THE JOURNAL OF CLINICAL ENDOCRINOLOGY & METABOLISM, vol. 85, no. 8, 2000, pages 2884 - 2888 |
| H. NEURATHR. L. HILL: "The Proteins", 1979, ACADEMIC PRESS |
| SCHEIT: "Nucleotide Analogs", 1980, JOHN WILEY |
| UHLMANPEYMAN, CHEMICAL REVIEWS, vol. 90, 1990, pages 543 - 584 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12576025B2 (en) | 2019-06-14 | 2026-03-17 | Zealand Pharma A/S | Pharmaceutical parenteral composition of dual GLP1/2 agonist |
| CN115052619A (zh) * | 2019-12-24 | 2022-09-13 | 韩美药品株式会社 | 包含glp-2或其缀合物的用于预防或治疗代谢性骨病的药物组合物 |
| EP4082561A4 (en) * | 2019-12-24 | 2024-02-07 | Hanmi Pharm. Co., Ltd. | Pharmaceutical composition for preventing or treating metabolic bone diseases, comprising glp-2 or conjugate thereof |
| WO2021198195A1 (en) | 2020-03-30 | 2021-10-07 | Zealand Pharma A/S | Agonist combination |
| CN115697375A (zh) * | 2020-04-03 | 2023-02-03 | 韩美药品株式会社 | 预防或治疗放疗、化疗或其组合引发的粘膜炎的包含glp-2衍生物或其长效缀合物的药物组合物 |
| JP2023520498A (ja) * | 2020-04-03 | 2023-05-17 | ハンミ ファーマシューティカル カンパニー リミテッド | Glp-2誘導体またはその持続型結合体を含む放射線療法、化学療法、またはこれらの組合わせにより誘発された粘膜炎の予防または治療用薬学的組成物 |
| US20230285584A1 (en) * | 2020-05-22 | 2023-09-14 | Hanmi Pharm. Co., Ltd. | Liquid formulation of long-acting conjugate of glp-2 |
| EP4512414A4 (en) * | 2022-04-18 | 2026-04-15 | Hanmi Pharmaceutical Co Ltd | GLP-2 POLYTHERAPY WITH INSULIN-TROPIC PEPTIDE, TNF INHIBITOR? OR BOTH TO PREVENT OR TREAT INTESTINAL DISEASES |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2019066586A1 (ko) | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 | |
| WO2017116205A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체 | |
| WO2015108398A1 (ko) | 지속형 인슐린 및 그 용도 | |
| WO2012173422A9 (en) | A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof | |
| WO2017003191A1 (en) | Glucagon derivative and a composition comprising a long acting conjugate of the same | |
| WO2017052321A1 (ko) | 다수의 생리활성 폴리펩타이드 및 면역글로불린 Fc 영역을 포함하는, 단백질 결합체 | |
| WO2018117613A1 (ko) | 뇌 표적 지속성 단백질 결합체 | |
| WO2018004283A2 (ko) | 글루카곤 유도체, 이의 결합체, 및 이를 포함하는 조성물, 및 이의 치료적 용도 | |
| WO2022080986A1 (ko) | Glp-1/gip 이중작용제, 이의 지속형 결합체, 및 이를 포함하는 약학적 조성물 | |
| EP2916860A1 (en) | A composition for treating diabetes or diabesity comprising oxyntomodulin analog | |
| WO2015152618A1 (ko) | 면역글로불린 fc 단편 결합을 이용한 단백질 및 펩타이드의 용해도를 개선시키는 방법 | |
| WO2019066570A1 (ko) | 지속형 단쇄 인슐린 아날로그 및 이의 결합체 | |
| WO2020071865A1 (ko) | 글루카곤 및 이를 포함하는 조합물의 치료학적 용도 | |
| WO2020130749A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물 | |
| WO2017116207A1 (ko) | Fgf21 아날로그, fgf21 결합체, 및 이의 용도 | |
| WO2018056764A1 (ko) | 인슐린 수용체와의 결합력이 감소된, 인슐린 아날로그 및 이의 용도 | |
| WO2019190293A1 (ko) | 뇌 표적 지속성 단백질 결합체, 이의 제조 방법, 및 이를 포함하는 조성물 | |
| WO2022211537A1 (ko) | 신규한 면역 활성 인터루킨 2 아날로그 결합체 및 이의 제조 방법 | |
| WO2022139538A1 (ko) | 신규한 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중활성체 및 이의 용도 | |
| WO2022035302A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 혈압 강하용 약학 조성물 | |
| WO2018174668A2 (ko) | 인슐린 수용체와의 결합력이 감소된 인슐린 아날로그의 결합체 및 이의 용도 | |
| WO2021235913A1 (ko) | Glp-2의 지속형 결합체의 액상 제제 | |
| WO2021215801A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법 | |
| WO2020214013A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도 | |
| WO2023106845A1 (ko) | 신규한 아디포넥틴 아날로그 및 결합체 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18860379 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3084326 Country of ref document: CA Ref document number: 2020517828 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018339210 Country of ref document: AU Date of ref document: 20180928 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018860379 Country of ref document: EP Effective date: 20200428 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020006189 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112020006189 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200327 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 524452052 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 524452052 Country of ref document: SA Ref document number: 520411644 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 201880074180.4 Country of ref document: CN |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2020/004453 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 524452052 Country of ref document: SA |