WO2019043604A1 - PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF - Google Patents
PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF Download PDFInfo
- Publication number
- WO2019043604A1 WO2019043604A1 PCT/IB2018/056611 IB2018056611W WO2019043604A1 WO 2019043604 A1 WO2019043604 A1 WO 2019043604A1 IB 2018056611 W IB2018056611 W IB 2018056611W WO 2019043604 A1 WO2019043604 A1 WO 2019043604A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- compound
- peptide
- formula
- conjugate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)C(C)N(C)* Chemical compound CC(C)C(C)N(C)* 0.000 description 6
- SNNKQYZDVRDZLN-UHFFFAOYSA-N CC(C1)C(C2)C[O+]12=C Chemical compound CC(C1)C(C2)C[O+]12=C SNNKQYZDVRDZLN-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/542—Carboxylic acids, e.g. a fatty acid or an amino acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/50—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton
- C07C323/51—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton
- C07C323/57—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups
- C07C323/58—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups with amino groups bound to the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/36—Extraction; Separation; Purification by a combination of two or more processes of different types
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6018—Lipids, e.g. in lipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to peptide conjugates, methods for making peptide conjugates, conj ugates produced by the methods, pharmaceutical compositions comprising the conjugates, methods of eliciting immune responses in a subject and methods of vaccinating a subject, uses of the conj ugates for the same, and uses of the conjugates in the ma nufacture of medicaments for the same.
- the present invention also relates to methods of making compounds useful in the synthesis of peptide conj ugates of the invention and to such componds.
- a key issue in the development of peptide vaccines is the lack of immunogenicity displayed by peptides as sole vaccine components. It is usua lly necessary to include in the vaccine a n adj uvant, designed to activate components of the innate immune system (e.g . Freund's adjuvant) .
- An alternative strategy in peptide vaccine design is to create self-adjuvanting vaccines in which the peptide epitope of interest is covalently linked to a n appropriate adjuvant.
- Such self-adj uvanting vaccines may have enhanced a ntigen uptake, presentation and dendritic cell maturation compared to simple co-formulation of the antigen with an external adjuvant.
- the present invention broadly consists in a peptide conj ugate compound of the formula (I) :
- n and w are each independently a n integer from 0 to 7 and v is an integer from 0 to 5,
- n 1 or 2;
- Zl and Z2 are each independently selected from the group consisting of -0-, - NR-, -S-, -S(O)-, -SO2-, -C(0)0-, -OC(O)-, -C(0)N R-, -NRC(O)-, -C(0)S-, - SC(O)-, -OC(0)0-, -N RC(0)0-, -OC(0)N R-, and -NRC(0)N R-;
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen or Cl-6aliphatic;
- R, R3, and R8 a re each independently hydrogen or Cl-6a liphatic;
- R9 is hydrogen, Cl-6a liphatic, an amino protecting group, L3-C(0)-, or A2; LI and L2 a re each independently selected from is C5-21aliphatic or C4-
- L3 is Cl-21aliphatic or C2-20heteroaliphatic
- Al is an amino acid, a peptide, OH, OP1, N H2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- any a liphatic or heteroaliphatic present in any of R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optionally substituted ;
- R9 a nd Al is a peptide comprising, consisting essentially of, or consisting of an amino acid sequence selected from the group consisting of:
- XaaiXaa2Xaa 3 Xaa4LQQLSLLMWITQXaa22FLPVFLAQPPSGQRR [SEQ ID NO: l ], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd Xaa4 is absent or is one or more hydrophilic amino acids,
- XaaiXaa2Xaa3LQQLSLLMWITQXaa22FLPVFLAQPPSGQRR [SEQ ID NO: 2], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, a nd Xaa3 is absent or is from one to ten hydrophilic amino acids,
- XaaiXaa 2 LQQLSLLMWITQXaa22FLPVFLAQPPSGQRR [SEQ ID NO: 3], wherein Xaa i is absent or is S, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids, (d) 8 or more contig uous amino acid residues from the sequence
- m is an integer from 3 to 7, and at least one of R9 and Al is an amino acid or a peptide.
- the present invention broadly consists in a peptide conj ugate compound of the formula (I) :
- n and w are each independently a n integer from 0 to 7 and v is an integer from 0 to 5,
- n 1 or 2;
- Zl and Z2 are each independently selected from the group consisting of -0-, -
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen or Cl-6aliphatic;
- R, R3, and R8 a re each independently hydrogen or Cl-6a liphatic;
- R9 is hydrogen, Cl-6a liphatic, an amino protecting group, L3-C(0)-, or A2; LI and L2 a re each independently selected from is C5-21aliphatic or C4- 20heteroaliphatic;
- L3 is Cl-21aliphatic or C2-20heteroaliphatic
- Al is an amino acid, a peptide, OH, OP1, NH2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- any a liphatic or heteroaliphatic present in any of R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optionally substituted ; or a pharmaceutically acceptable salt or solvate thereof;
- R9 a nd Al is a peptide comprising, consisting essentially of, or consisting of an amino acid sequence selected from the group consisting of: (a) 8 or more contig uous amino acid residues from the sequence
- XaaiXaa2Xaa 3 Xaa4LQQLSLLMWITQXaa22FLPVFLAQPPSGQRR [SEQ ID NO: l ], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd Xaa4 is absent or is one or more hydrophilic amino acids (b) 8 or more contig uous amino acid residues from the sequence
- XaaiXaa 2 LQQLSLLMWITQXaa22FLPVFLAQPPSGQRR [SEQ ID NO: 3], wherein Xaa i is absent or is S, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- the present invention broadly consists in a peptide conj ugate compound of the formu
- n and w are each independently a n integer from 0 to 7 and v is an integer from 0 to 5,
- n 1 or 2;
- Zl and Z2 are each independently selected from the group consisting of -0-, - NR-, -S-, -S(O)-, -SO2-, -C(0)0-, -OC(O)-, -C(0)N R-, -NRC(O)-, -C(0)S-, - SC(O)-, -OC(0)0-, -N RC(0)0-, -OC(0)N R-, and -NRC(0)N R-;
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen or Cl-6aliphatic;
- R, R3, and R8 a re each independently hydrogen or Cl-6a liphatic;
- R9 is hydrogen, Cl-6a liphatic, an amino protecting group, L3-C(0)-, or A2;
- LI and L2 a re each independently selected from is C5-21aliphatic or C4- 20heteroaliphatic;
- L3 is Cl-21aliphatic or C2-20heteroaliphatic
- Al is an amino acid, a peptide, OH, OPl, N H2, or N H P2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- any a liphatic or heteroaliphatic present in any of R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optionally substituted ; or a pharmaceutically acceptable salt or solvate thereof;
- m is an integer from 3 to 7, and at least one of R9 and Al is an amino acid or a peptide.
- any of the embod iments or preferences described herein may relate to any of the aspects herein alone or in combination with any one or more embodiments or preferences described herein, unless stated or ind icated otherwise.
- any of the embod iments or preferences described herein may relate to any of the aspects herein alone or in combination with any one or more embodiments or preferences described herein, unless stated or ind icated otherwise.
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen, Cl-6a lkyl, C2-6alkenyl, C2-6alkynyl, or C3-6cycloa lkyl;
- R, R3, and R8 a re each independently hyd rogen, Cl-6a lkyl, C2-6a lkenyl, C2- 6alkynyl, or C3-6cycloalkyl ;
- R9 is hydrogen, Cl-6a lkyl, C2-6alkenyl, C2-6alkynyl, C3-6cycloalkyl, an amino protecting group, L3-C(0), or A2;
- LI and L2 a re each independently selected from C5-21a lkyl, C5-21a lkenyl, C5- 21alkynyl, or C4-20heteroa lkyl;
- L3 is Cl-21alkyl, C5-21alkenyl, C5-21alkynyl, C3-6cycloalkyl, or C2- 20heteroalkyl;
- Al is an amino acid, a peptide, OH, OP1, N H2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen, Cl-6alkyl, C2-6alkenyl, or C3-6cycloalkyl ;
- R, R3, and R8 a re each independently hyd rogen, Cl-6a lkyl, C2-6a lkenyl, or C3-
- R9 is hydrogen, Cl-6a lkyl, C2-6alkenyl, C3-6cycloalkyl, a n amino protecting group, L3-C(0), or A2;
- LI and L2 a re each independently selected from C5-21alkyl, C5-21a lkenyl, or C4- 20heteroalkyl;
- L3 is Cl-21alkyl, C5-21alkenyl, C3-6cycloalkyl, or C2-20heteroalkyl ;
- Al is an amino acid, a peptide, OH, OP1, N H2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide;
- any a lkyl, a lkenyl, cycloalkyl or heteroalkyl present in any of R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optiona lly substituted .
- R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optiona lly substituted .
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen, Cl-6alkyl, or C3-6cycloalkyl;
- R, R3, and R8 a re each independently hydrogen, Cl-6a lkyl, or C3-6cycloa lkyl;
- R9 is hydrogen, Cl-6a lkyl, C3-6cycloalkyl, an amino protecting group, L3-C(0), or A2;
- LI and L2 a re each independently selected from C5-21alkyl, C5-21a lkenyl, or C4- 20heteroalkyl;
- L3 is Cl-21alkyl, C2-21alkenyl, C3-6cycloalkyl, or C2-20heteroalkyl ;
- Al is an amino acid, a peptide, OH, OP1, N H2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- any a lkyl, a lkenyl, cycloalkyl or heteroalkyl present in any of R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optiona lly substituted .
- R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, Rx, Ry, LI, L2, and L3 is optiona lly substituted .
- Rl, R2, Rx, Ry, R4, R5, R6, and R7 at each instance of m, v, w, a nd n are each independently hyd rogen, Cl-6alkyl, or C3-6cycloalkyl;
- R, R3, and R8 a re each independently hydrogen, Cl-6a lkyl, or C3-6cycloa lkyl;
- R9 is hydrogen, Cl-6a lkyl, C3-6cycloalkyl, an amino protecting group, L3-C(0), or A2;
- LI and L2 a re each independently selected from is C5-21alkyl or C4- 20heteroalkyl;
- L3 is Cl-21alkyl, C3-6cycloalkyl, or C2-20heteroa lkyl;
- Al is an amino acid, a peptide, OH, OP1, N H2, or NHP2, wherein PI is a carboxyl protecting group, and wherein P2 is a carboxamide protecting group;
- A2 is an amino acid or a peptide
- Zl and Z2 are each independently selected from the g roup consisting of -C(0)0-, -C(0)NR-, and -C(0)S-.
- the compound of the formula (I) is a compound of the formula (IA) :
- v is from 0 to 4, 0 to 3, or 0 to 2, or v is 0 or 1, for example 0.
- v is from 0 to 3. In exemplary embodiments, v is 0. In various embodiments, m and w are each independently from 0 to 6, 0 to 5, 0 to 4, 0 to 3, 0 to 2, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2.
- m and w are each independently from 0 to 5.
- m and w are each independently from 1 to 4.
- m is from 1 to 6, for example from 2 to 6, 1 to 5, or 2 to 5. In various embodiments, m is from 1 to 5. In various embodiments, m is from 1 to 3. In exemplary embodiments, m is 2.
- n is from 3 to 6. In certain embodiments, m is from 3 to 5.
- w is 1 or 2. In exemplary embodiments, w is 1.
- the sum of m and w is from 0 to 6, 0 to 5, 0 to 4, 0 to 3, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 2 to 7, 2 to 6, 2 to 5, 2 to 4, or 2 to 3.
- the sum of m and w is from 2 to 7.
- the sum of m and w is from 2 to 5.
- the sum of m and w is 3.
- v is from 0 to 3; m and w are each independently from 0 to 5; and the sum of m and w is from 2 to 7.
- v is from 1 or 0; m and w are each independently from 0 to 5; and the sum of m and w is from 2 to 7.
- v is 1 or 0; m and w are each independently from 1 to 4; and the sum of m and w is from 2 to 7. In various embodiments, v is 1 or 0; m and w are each independently from 1 to 4; and the sum of m and w is from 2 to 5.
- LI and L2 are each independently C5-21aliphatic, for example C9-21alihpatic, Cl l-21aliphatic, or C11-, C13-, C15-, C17-, or C19-a liphatic.
- LI and L2 are each independently C5-21alkyl.
- LI and L2 are each independently C9-21alkyl. In yet another embodiment, LI and L2 are each independently Cll-21alkyl.
- LI and L2 are each independently Cll, C13, C15, C17, or C19alkyl, preferably n-alkyl.
- LI and L2 are each independently C15alkyl. In various embodiments, LI and L2 each independently comprise a linear chain of 9-21 carbon atoms.
- LI and L2 are each independently linear C15alkyl.
- L3 is Cl-21alkyl.
- L3 is methyl or linear C15alkyl.
- L3 is methyl (that is, R9 is acetyl).
- the amino protecting group is Boc, Fmoc, Cbz (carboxybenzyl), Nosyl (o- or p-nitrophenylsulfonyl), Bpoc (2-(4-biphenyl)isopropoxycarbonyl) and Dde (l-(4,4-dimethyl-2,6-dioxohexylidene)ethyl) .
- the amino protecting group is Boc or Fmoc. In some embod iments, the amino protecting group is Fmoc.
- the carboxyl protecting group is terf-butyl, benzyl, or allyl.
- the carboxamide protecting g roup is Dmcp or Trityl.
- Rl a nd R2 at each instance of m are each independently Cl- 6alkyl or hyd rogen. In various specifically contemplated embodiments, Rl and R2 at each instance of m are each hydrogen.
- R3 is Cl-6alkyl or hyd rogen .
- R3 is hyd rogen.
- R4 a nd R5 at each instance of w are each independently Cl- 6alkyl or hyd rogen, preferably hydrogen. In va rious specifically contemplated embodiments, R4 and R5 at each instance of w are each hydrogen.
- Rx and Ry at each instance of v are each independently Cl- 6alkyl or hyd rogen. In various specifically contemplated embodiments, Rx and Ry at each instance of v are each hydrogen.
- R6 a nd R7 at each instance of n are each independently Cl- 6alkyl or hyd rogen. In various specifically contemplated embodiments, R6 and R7 are each hydrogen.
- R8 is independently Cl-6alkyl or hydrogen. In exemplary embodiments, R8 is hydrogen.
- R9 is Cl-6alkyl, hydrogen, a n amino protecting group, L3- C(O), or A2.
- R9 is hydrogen, an a mino protecting group, L3-C(0), or A2.
- R8 is hydrogen and R9 is hydrogen, a n amino protecting group, L3-C(0), or A2.
- R8 a nd R9 are each hydrogen ; or R9 is L3-C(0) or A2. In various exemplary embodiments, R8 is hydrogen and R9 is L3-C(0). In various specifically contemplated embodiments, R9 is L3-C(0), wherein L3 is methyl.
- the compound of formula (I) is a compound of the formula (IF)
- the compound of formula (IF) is a compound of the formula (IF- 1):
- the compound of formula (I) is a compound of the formula (IB):
- k is an integer from 0 to 4 (i.e. k is from 0 to 4 when proviso (1) of the first aspect applies and from 1 to 4 when proviso (2) of the first aspect applies);
- Ra, Rb, and Rc are each independently hydrogen or Cl-6aliphatic.
- the compound of formula (IB) is a compound of the formula (IC):
- k is from 0 to 3, 0 to 2, 0 to 1, 1 to 4, 1 to 3, or 1 to 2, or k is 0 or 1. In certain embodiments, k is 0 to 3.
- k is 0 or 1.
- k 0.
- k is equal to v.
- k is from 1 to 3.
- Ra, Rb, and Rc are each independently hydrogen, Cl-6alkyl, C2-6alkenyl, C2-6alkynyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently hydrogen, Cl-6alkyl, C2-6alkenyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently selected from hydrogen or Cl-6alkyl, preferably hydrogen. In exemplary embodiments, Ra, Rb, and Rc are each hyd rogen.
- the compound of formula (I) is a compound of the formula (ID- 1) :
- m in the compound of formula (ID-1) is from 3 to 5.
- the compound of the formula (I) is a compound of the formula (ID) :
- the compound is a compound of the formula (ID) wherein LI and L2 are each linear C15alkyl.
- LI and L2 are each independently Cl l-21alkyl; m is 2-5; v is 0; w is 1; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- LI and L2 are each independently Cl l-21alkyl; m is 3-5; v is 0; w is 1; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- LI and L2 are each independently Cl l-21alkyl; m is 2; v is 0; w is 1 ; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- n 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, L3-C(0), or A2.
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(0), wherein L3 is linear C15alkyl or methyl.
- LI and L2 are each independently Cl l-21alkyl; m is 2-5; v is 0; w is 1; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(0), wherein L3 is linear C15alkyl or methyl.
- LI and L2 are each independently Cl l-21alkyl; m is 3-5; v is 0; w is 1; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(0), wherein L3 is linear C15alkyl or methyl.
- LI and L2 are each independently Cl l-21alkyl; m is 2; v is 0; w is 1 ; Rl and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(0), wherein L3 is linear C15alkyl or methyl.
- the compound of formula (I) has the formula (IE) :
- the compound of formula (I) has the formula (IEE):
- the compound of formula (I) has the formula (IE-1):
- the compound of formula (I) has the formula (IEE-1):
- the compound of formula (I) has the formula (IE-2):
- the compound of formula (I) has the formula (IEE-2):
- the compound of formula (I) has the formula (IEE-3) :
- the compound of formula (I) has the formula (IEE-4):
- the amino acid of the amino acid- or peptide conjugate to which the lipid moieties are conjugated is a cysteine residue.
- the moieties Ll-Zl- and L2-Z2- may be fatty acid groups, for example fatty acid esters.
- the moieties may be saturated or unsaturated fatty acid esters.
- the fatty acid is saturated .
- the fatty acid is a C4-22 fatty acid .
- the fatty acid is a C6-22 fatty acid .
- the fatty acid is a ClO-22 fatty acid . In certain specifically contemplated embodiments, the fatty acid is a C12-22 fatty acid . In various exemplary embodiments, the fatty acid is a C12, C14, C16, C18, or C20 fatty acid .
- the fatty acid is la uric acid, myristic acid, palmitic acid, stea ric acid, arachic acid, palmitoleic acid, oleic acid, elaidic acid, linoleic acid, a-linolenic acid, and a rachidonic acid .
- the fatty acid is lauric acid, myristic acid, palmitic acid, or stearic acid .
- the fatty acid is palmitic acid (and the moieties Ll- Zl- a nd L2-Z2-are each palmitoyl groups).
- Al is OH, OPl, N H2, or NHP2 or R9 is hydrogen, Cl-6alkyl, C3- 6cycloalkyl, an amino protecting g roup, or L3-C(0) .
- Al is OPl or OH or R9 is hydrogen, a n amino protecting group or L3-C(0).
- R9 is hydrogen, an amino protecting group or L3-C(0). In some embodiments, R9 is hydrogen or L3-C(0).
- the compound of formula (I) is a peptide conjugate.
- at least one of Al and R9 is a peptide comprising, consisting essentia lly of, or consisting of an amino acid sequence selected from the group consisting of those defined in proviso (1) of the first aspect.
- the peptide comprises, consists of, or consists essentially of a n amino acid seq uence selected from the group consisting of: (a) 8 or more contig uous amino acid residues from the sequence SLLMWITQXaa22FLPVF [SEQ ID NO :6],
- the peptide comprises, consists of, or consists essentially of a n amino acid seq uence selected from the group consisting of:
- the peptide comprises, consists of, or consists essentially of an amino acid seq uence selected from the group consisting of:
- the peptide comprises, consists of, or consists essentially of an amino acid seq uence selected from the group consisting of:
- Xaan in each seq uence is independently V, I, or L (that is, each Xaa22 is independently V, I, or L).
- Xaa ⁇ 2 in each sequence is V (that is, each Xaa ⁇ 2 is V).
- m is from 3 to 7 and at least one of Al and R9 is an amino acid or peptide as defined in proviso (2) of the first aspect.
- at least one of Al and R9 is a peptide.
- Al and/or A2 is an amino acid or a peptide. That is, in various embodiments, Al is an amino acid or a peptide and/or R9 is an amino acid or a peptide.
- Al and/or A2 is a peptide. That is, in various embodiments, Al is a peptide and/or R9 is a peptide.
- Al and/or A2 is a peptide comprising an epitope.
- Al and/or A2 is a peptide comprising a peptide epitope. In another embodiment, Al and/or A2 is a peptide, wherein the peptide comprises a peptide epitope.
- Aland/or A2 is a peptide substituted with an epitope.
- the epitope is bound to the peptide via a linker group.
- Al is a peptide. In certain exemplary embodiments, Al is a peptide and R9 is not A2 (that is, R9 is not an amino acid or a peptide).
- Al is a peptide and R9 is hydrogen or L3-C(0), for example Me-C(O).
- the peptide comprises an epitope.
- the epitope is a peptide epitope.
- the epitope is coupled or bound via a linker group.
- the amino acid of the peptide conjugate to which the lipid moieties are conjugated is an N-terminal amino acid residue.
- Al is serine or a peptide comprising serine as the first N- terminal amino acid residue.
- Al is a peptide comprising serine as the first N-terminal amino acid residue.
- the peptide conjugate comprises one or more solubilising groups.
- the solubilising group comprises a n amino acid sequence comprising two or more hydrophiiic amino acid residues in the peptide chain.
- the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophiiic amino acid residues in the peptide chain.
- the two or more hydrophiiic amino acid residues are adjacent to the serine residue.
- Al and/or A2 is a peptide comprising a solubilising group.
- Al and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophiiic amino acid residues in the peptide chain.
- Al is a peptide comprising a solubilising group comprising an amino acid seq uence comprising two or more hydrophiiic amino acid residues in the peptide chain.
- Al is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophiiic amino acid residues in the peptide chain adjacent to the serine.
- the compound comprises a linker or one or more amino acids thereof.
- the peptide comprises a linker or one or more amino acids thereof.
- the peptide comprises a peptide epitope bound via a linker to the amino acid to which the lipid moieties are bound .
- the peptide comprises two or more epitopes.
- the peptide comprises a peptide antigen.
- the linker is an amino acid sequence from about 2 to 20, 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, or 2 to 8 amino acids in length.
- the compound of formula (I) comprises 3 or more, 4 or more, or 5 or more contiguous a mino acids.
- the peptide conjugate is a lipopeptide.
- the compound of formula (I) is a self adjuvanting peptide.
- Al and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- Al and A2 are each independently a peptide comprising from about 8 to 60 amino acids.
- Al and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- Al and/or A2 are each independently a peptide comprising from about 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- Al and/or A2 are each independently a peptide, wherein the peptide comprises 8 to 60 amino acids.
- Al and/or A2 are each independently a peptide comprising or substituted with a peptide epitope, wherein the peptide epitope compises from 8 to 60 amino acids.
- Suitable peptide epitopes include without limitation those described in WO 2016/103192 filed 22 December 2015, the entirety of which is incorporated herein by reference.
- the peptide comprises, consists essentially of, or consists of one or more EBV LM P2 epitopes.
- the one or more EBV LMP2 epitopes a re MHCI epitopes.
- the peptide comprises one or more EBV LMP2 epitopes selected from the group consisting of a ny one of SEQ ID NOs 84 - 109.
- the peptide comprises a peptide comprising or consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83. In various embodiments, the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83, or comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83. In various embodiments, the peptide comprises a recombinant peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the recombinant peptide comprises or consists of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83, or comprises or consists of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs 9 - 83.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of
- XaaiXaa 2 DRHSDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO: 11], wherein Xaal is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- Xaa1Xaa2Xaa3Xaa4SLYLGLQHDGNDGL.PPPPYSPRDDSSQH.YEEA [SEQ ID NO: 14], wherein Xaal is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids, (g) 8 or more contiguous amino acid residues from the sequence
- XaaiXaa 2 Xaa 3 SLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO: 15], wherein Xaal is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids, (h) 8 or more contiguous amino acid residues from the sequence
- Xaa1Xaa2SLYLGLQHDGNDGL.PPPPYSPRDDSSQH.YEEA [SEQ ID NO: 16], wherein Xaal is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 Xaa4SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO: 19], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:20], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- XaaiXaa 2 SDYQPLGTQDQSLYLGLQHDGNDGL [SEQ ID NO:21], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- XaaiXaa2Xaa 3 Xaa4DRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO:24], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa2DRHSDYQPLGTQDQSLYLGLQHDGN DGLPPPPYSPRDDSSQHIYEEA [SEQ ID NO: 26], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- Xaa iXaa2Xaa3Xaa4LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO : 29], wherein Xaai is absent or is S or a hyd rophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa 2 Xaa3LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO : 30], wherein Xaa i is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa iXaa 2 LLWTLVVLLICSSCSSCPLSKILLARLFLYALALLL [SEQ ID NO: 31], wherein Xaa i is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids, (x) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa2Xaa 3 Xaa4LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO: 34], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa2Xaa 3 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO : 35], wherein Xaai is absent or is S or a hyd rophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa iXaa 2 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO: 36], wherein Xaai is absent or is S or a hyd rophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids, (cc) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa2Xaa 3 Xaa4LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO: 39], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa 2 LMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:41 ], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- SKKKKLMLLWTLVVLLICSSCSSCPLSKILL [SEQ ID NO:42], (ii) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa2Xaa 3 Xaa4LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:44], wherein Xaa i is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa2Xaa3LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:45], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa 1Xaa2LLICSSCSSCPLSKILLARLFLYALAL.LL.LA SEQ ID NO:46], wherein Xaai is absent or is S or a hydrophilic amino acid, a nd Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- LLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:48], (00) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa 2 Xaa3Xaa4LN LTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIA GGSI [SEQ ID NO:49], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa2 is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids, (pp) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa 2 LNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSI [SEQ ID NO: 51 ], wherein Xaa i is absent or is S or a hydrophilic amino acid, and Xaa2 is absent or is from one to four hydrophilic amino acids, (rr) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa2Xaa 3 Xaa4FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO: 54], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa2 is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd
- Xaa4 is absent or is one or more hydrophilic amino acids
- Xaa iXaa2Xaa 3 FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO: 55], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, a nd Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa iXaa2FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO: 56], wherein Xaai is absent or is S or a hyd rophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- FLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASA [SEQ ID NO: 58], (yy) 8 or more contiguous a mino acid residues from the seq uence
- Xaa iXaa2Xaa3Xaa4LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLL [SEQ ID NO: 59], wherein Xaa i is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids, (zz) 8 or more contiguous a mino acid residues from the seq uence
- XaaiXaa2Xaa 3 SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIG FA [SEQ ID NO:65], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids, (fff) 8 or more contiguous amino acid residues from the sequence
- XaaiXaa 2 SGNRTYGPVFM(C)(S)LGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFA [SEQ ID NO:66], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa2 is absent or is from one to four hydrophilic amino acids,
- Xaa iXaa 2 SNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGN DGLPP [SEQ ID NO: 71 ], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- Xaa iXaa2Xaa 3 GNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO: 75], wherein Xaa i is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa iXaa2GNDGLPPPPYSPRDDSSQHIYEEAGRGSM NPVCLPVIVAPYLFWLAAIAAS [SEQ ID NO: 76], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- Xaa iXaa2Xaa 3 Xaa4AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO: 79], wherein Xaa i is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- Xaa iXaa2Xaa 3 AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO: 80], wherein Xaai is absent or is S or a hydrophilic amino acid, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- Xaa iXaa 2 AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO: 81 ], wherein Xaai is absent or is S or a hydrophilic amino acid, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids, (vvv) 8 or more contiguous a mino acid residues from the seq uence
- AAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLT [SEQ ID NO: 83], (xxx) the sequence of any one of SEQ ID NOs: 9 to 83,
- LGTQDQSLY [SEQ ID NO: 89]
- GLPPPPYSP [SEQ ID NO: 97]
- GLPPPPYSPR [SEQ ID NO: 98]
- the peptide comprises one or more epitopes derived from Latent Membrane Protein 2 (LMP2), for example, from full-length EBV LMP2 (amino acids 1-497).
- LMP2 Latent Membrane Protein 2
- the peptide comprises, consists essentia lly of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentia lly of, or consists of an amino acid sequence selected from the group consisting of 12 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentia lly of, or consists of an amino acid sequence selected from the group consisting of 15 or more, 18 or more, 20 or more, or 25 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentially of, or consists of a n amino acid seq uence selected from the group consisting of any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentia lly of, or consists of an amino acid sequence selected from the group consisting of 15 or more, 18 or more, 20 or more, or 25 or more contiguous amino acid residues from any one of SEQ ID NOs: 9 to 83.
- the peptide comprises, consists essentially of, or consists of a n amino acid seq uence selected from the group consisting of any one of SEQ ID NOs: 9 to 83.
- the peptide comprises an amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 84 to 109. In one example, the peptide comprises a n amino acid sequence selected from the group consisting of a ny one of SEQ ID NOs: 84 to 101.
- the peptide comprises an amino acid sequence selected from the group consisting of any two or more of SEQ ID NOs : 84 to 109. In one example, the peptide comprises an a mino acid sequence selected from the group consisting of any two or more of SEQ ID NOs: 84 to 101.
- the peptide comprises, consists of, or consists essentially of a n amino acid seq uence selected from the group consisting of
- Xaa3 is absent or is a hydrophilic amino acid
- Xaa4 is absent or is one or more hyd rophilic amino acids
- XaaiXaa2Xaa 3 GARGPESRLLEFYLAMPFATPM EAELARRSLAQDAPPL [SEQ ID NO: l l l ], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
- XaaiXaa 2 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO: 112], wherein Xaai is absent or is S, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 Xaa4VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO: 117], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hyd rophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO: 118], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, a nd Xaa3 is absent or is from one to ten hydrophilic amino acids,
- XaaiXaa 2 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO: 119], wherein Xaai is absent or is S, and Xaa ⁇ is absent or is from one to four hyd rophilic amino acids,
- XaaiXaa2Xaa 3 Xaa4LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO: 123], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd Xaa4 is absent or is one or more hydrophilic amino acids
- XaaiXaa 2 LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO: 125], wherein Xaai is absent or is S, and Xaa ⁇ is absent or is from one to four hydrophilic amino acids,
- SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO: 126], (y) the sequence of a ny one of SEQ ID NOs: 123 to 126,
- the peptide epitope is derived from NY-ESO-1.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises, consists essentially of, or consists of a n amino acid seq uence selected from the group consisting of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises, consists essentially of, or consists of a n amino acid seq uence selected from the group consisting of any one of SEQ ID NO: 114, 121, and 127.
- the peptide comprises, consists essentially of, or consists of a n amino acid seq uence selected from the group consisting of any one of SEQ ID NO: 113, 120, and 126.
- the peptide comprises, consists essentially of, or consists of one or more ovalbumin protein epitopes.
- the one or more ovalbumin protein are M HCI epitopes.
- the one or more ovalbumin protein are M HCII epitopes.
- the peptide comprises, consists essentially of, or consists of: (a) 8 or more contig uous amino acid residues from the sequence
- XaaiXaa2Xaa 3 Xaa4KISQAVHAAHAEINEAGRESIIN FEKLTEWT [SEQ ID NO: 130], wherein Xaai is absent or is S, Xaa ⁇ is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, a nd Xaa4 is absent or is one or more hydrophilic amino acids (b) 8 or more contig uous amino acid residues from the sequence XaaiXaa2Xaa3
- KISQAVHAAHAEINEAGRESIINFEKLTEWT [SEQ ID NO: 131], wherein Xaai is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hyd rophilic amino acids,
- KISQAVHAAHAEINEAGRESIINFEKLTEWT [SEQ ID NO: 132], wherein Xaai is absent or is S, and Xaa2 is absent or is from one to four hydrophilic amino acids,
- the peptide comprises one or more ovalbumin protein epitopes selected from the g roup consisting of any one of SEQ ID NOs 130 - 136.
- the peptide comprises a peptide comprising or consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 130 - 136.
- the peptide comprises, consists of, or consists essentially of an amino acid seq uence selected from the group consisting of any one of SEQ ID NOs 130 - 136.
- the peptide comprises one or more immunodominant A*0200 restricted epitopes derived from the cytomeglovirus (CMV) ppUL83 protein ('N LV peptide') consisting of
- the peptide comprises, consists essentially of, or consists of an amino acid seq uence selected from the group consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 129.
- the peptide comprises, consists essentially of, or consists of one or more amino acid sequences selected from the group consisting of those defined in proviso (1) of the first aspect.
- Xaa4 in the sequences referred to herein is absent or is from 1 to 17 hydrophilic amino acids, for example, from 1 to 16, 1 to 15, 1 to 14, 1 to 13, 1 to 12, 1 to 11, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2 hydrophilic amino acids, or is a hydrophilic amino acid.
- the peptide conjugate comprises two or more epitopes, such as two or more peptide epitopes.
- the peptide conjugate comprises an antigenic peptide.
- the peptide is a synthetic peptide.
- the compound of formula (I) is an isolated compound of formula (I).
- the compound of formula (I) is a pure, purified or substantially pure compound of formula (I).
- the compound of formula (I) of the invention is a compound selected from the group consisting of compounds 910, 911, 912, 913, 930, 931, and 932 of the Examples herein.
- the present invention broadly consists in a method of making a peptide conjugate of the formula (IF) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising :
- X10 is L1-Z1-, -OH, -SH, -NHR, HNRC(0)0-, P10-O-, P11-S-, P12-NR-, or P12-NRC(0)0-;
- Xll is X10 or -OH, -SH, -NHR, or HNRC(0)0- when X10 is P10-O-, P11-S-, P12- NR-, or P12-NRC(0)0- and said conditions are effective to remove P10, Pll, or P12;
- P10, Pll, and P12 are each independently a protecting group
- m, n, LI, Zl, R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al are as defined in the compound of formula (IF) of the invention (including provisos (1) and/or (2) of the first aspect); and
- X10 is L1-Z1-, -OH, -SH, -N HR, HN RC(0)0-, P10-O-, P11-S-, P12-N R-, or P12-N RC(0)0-;
- Xl l is X10 or -OH, -SH, -N HR, or HNRC(0)0- when X10 is P10-O-, P11-S-, P12- NR-, or P12-NRC(0)0- and said cond itions are effective to remove P10, Pl l, or P12;
- P10, Pl l, and P12 a re each independently a protecting group
- n is from 2 to 5, 2 to 4, or 2 to 3. In exemplary embodiments, m is 2. In other exemplary embodiments, m is from 3 to 5.
- X10 is Ll-Zl- or -OH, -SH, -NHR, P10-O-, P11-S-, or P12- NR-; and Xl l is X10 or -OH, -SH, or -NHR.
- X10 is L1-Z1-, -OH, or P10-O-; and Xl l is X10 or -OH .
- X10 is L1-C(0)0-, OH, or P10-O-; and Xl l is L1-C(0)0-, P10-O-, or OH . In various embodiments, X10 is L1-C(0)0- or P10-O-; and Xll is L1-C(0)0-, P10-O-, or OH.
- X10 is P10-O-; and Xll is PIO-O- or OH.
- R9 is not hydrogen and/or Al is not OH.
- the amino acid-comprising conjugation partner is a peptide containing conjugation partner comprising 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, or 3 or less amino acid residues.
- the C-terminus of the amino acid comprising conjugation partner is protected with a carboxyl protecting group or a carboxamide protecting group and/or the Na-amino group of the amino acid comprising conjugation partner is protected with an amino protecting group.
- R9 is an amino protecting group.
- Al is OPl or NHP2. In certain embodiments, Al is OPl.
- R9 is an amino protecting group and Al is OPl in the amino acid comprising conjugation partner.
- the method comprises reacting the epoxide and amino acid- comprising conjugation partner in the presence of an acid, for example a strong acid.
- the acid comprises hydrochloric acid, sulfuric acid, or a mixture thereof.
- the acid comprises a lewis acid, for example BF3.
- the method comprises reacting the epoxide and amino acid- comprising conjugation partner under neutral conditions.
- the neutral conditions comprise a protic solvent, such as an alcohol, for example ethanol.
- the method comprises reacting the epoxide and amino acid- comprising conjugation partner in the presence of a base, for example a mild base.
- the base is an organic amine, for example triethylamine.
- the method comprises providing the epoxide by reacting an alkene of the formula (XVII) :
- the oxida nt is a peroxide, such as an organic peroxide, for example m-chloro peroxybenzoic acid, or a n organic N-oxide, for example pyridine N- oxide.
- a peroxide such as an organic peroxide, for example m-chloro peroxybenzoic acid, or a n organic N-oxide, for example pyridine N- oxide.
- the method comprises providing the epoxide by reacting an compound of the formula (XVII-A) wherein LG is a leaving group:
- the compound of formula (XVII-A) is prepared from L-aspartic acid .
- the method further comprises providing a single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI).
- providing the single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI) comprises resolving a racemic mixture of the epoxide.
- the method comprises provid ing a single stereoisomer or a stereoisomerically enriched mixture of the compound of formula (XVII-A).
- the method comprises converting the compound of formula (XV) to an amino acid- or peptide conjugate of the formula (IF-1) or a pharmaceutically acceptable salt or solvate thereof by one or more additional synthetic steps:
- the one or more synthetic steps comprises converting the hydroxyl group bound to the carbon to which R3 is attached to L2-Z2-.
- the one or more synthetic steps comprises acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(0)-.
- Xl l is PIO-O- or OH; and the one or more synthetic steps comprise acylating the compound of formula (XV) so as to replace P10 or the hydrogen atom of the hydroxyl group of Xl l with Ll-C(O)-; and/or acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(0)-.
- the present invention broadly consists in a compound of the formula
- Xll is L1-Z1-, -OH, -SH, -NHR, HNRC(0)0-, P10-O-, P11-S-, P12-N R-, or P12-NRC(0)0-;
- P10, Pll, and P12 are each independently a protecting group
- n is an integer from 2 to 6;
- n, LI, Zl, R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al are as defined in the compound of formula (I) of the invention (including provisos (1) and/or (2) of the first aspect) or any embodiment thereof; or a salt or solvate thereof.
- the present invention broadly consists in a method of making a compound of the formula (XV) or a salt or solvate thereof, the method comprising: reacting
- X10 is L1-Z1-, -OH, -SH, -NHR, HNRC(0)0-, P10-O-, P11-S-, P12-NR-, or P12-NRC(0)0-;
- Xll is X10 or -OH, -SH, -NHR, or HNRC(0)0- when X10 is P10-O-, P11-S-, P12- NR-, or P12-NRC(0)0- and said conditions are effective to remove P10, Pll, or P12;
- P10, Pll, and P12 are each independently a protecting group
- the present invention broadly consists in the use of a compound of the formula (XV) or (XVI) in the synthesis of a peptide-conjugate of the formula (IF) of the present invention (including provisos (1) and/or (2) of the first aspect) or a
- the present invention broadly consists in a method of making a peptide-conjugate of the formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising:
- Rm and Rn are each independently hydrogen, Cl-6alkyl, aryl, or heteroaryl;
- LG is a leaving group
- Rm a nd Rn are each independently hydrogen, Cl-6alkyl, aryl, or heteroaryl; LG is a leaving group; and
- n Rx, Ry, Rl, R2, R3, R4, R5, R6, R7, R8, R9, a nd Al are as defined in the compound of formula (I) but exclud ing provisos (1) and (2) of the first aspect; and converting the compound of formula (XX) to an amino acid- or peptide conj ugate of the formula (I) but excluding provisos (1) a nd (2) of the first aspect or a salt or solvate thereof by one or more additional synthetic steps:
- Rm and Rn a re each independently selected from hydrogen, Cl-6alkyl, or aryl.
- Rm is hydrogen, Cl-6alkyl, or aryl ; and Rn is Cl-6alkyl or a ryl .
- the leaving group is a ha lo (for example chloro, bromo, or iodo) or sulfonate (for example a tosylate or mesylate).
- m and v are such that the compound of formula (XXI) comprises a 5-7-membered cyclic aceta l.
- the cyclic aceta l is a 6-membered cyclic acetal.
- the cyclic aceta l is a 5-membered cyclic acetal and w is an integer greater than 1.
- m is 2 and v is 1.
- R9 is not hydrogen and/or Al is not OH .
- the amino acid-comprising conjugation partner is a peptide containing conjugation partner comprising 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, or 3 or less amino acid residues.
- the C-terminus of the amino acid comprising conjugation partner is protected with a carboxyl protecting group or a carboxamide protecting group and/or the Na-amino group of the amino acid comprising conjugation partner is protected with an amino protecting group.
- R9 is an amino protecting group.
- Al is OPl or NHP2. In certain embodiments, Al is OPl.
- R9 is an amino protecting group and Al is OPl in the amino acid comprising conjugation partner.
- the method comprises reacting the compound of formula (XXI) and the amino acid-comprising conjugation partner of formula (III) in the presence of a base.
- the base comprises an organic amine, for example
- the cyclic acetal of formula (XXI) is provided in the form of a single stereoisomer or a stereoisomerically enriched mixture.
- the method comprises converting the compound of formula (XX) to an amino acid- or peptide conjugate of the formula (IA) or a pharmaceutically acceptable salt or solvate thereof by one or more synthetic steps:
- the one or more synthetic steps comprises removing the acetal in the compound of formula (XX) to provide a compound of the formula (XXIII-1):
- the method comprises removing the acetal in the compound of formula (XX) to provide a compound of the formula (XXIII-2) or (XXIII-3):
- the one or more synthetic steps comprise converting the hydroxyl group bound to the carbon to which Rl and R2 are attached in the compound of formula (XXIII-1) to L1-Z1-, and/or converting the hydroxyl group bound to the carbon to which Rx and Ry are attached to L2-Z2.
- the one or more synthetic steps comprise
- converting said hydroxyl group to Ll-Zl- or L2-Z2- comprises acylating so as to replace the hydrogen atom of the hydroxyl group with Ll-C(0)-or L2- C(O)-.
- the present invention broadly consists in a compound of the formula (XX) :
- Rm a nd Rn are each independently hydrogen, Cl-6alkyl, aryl, or heteroaryl; m and w are each independently a n integer from 0 to 7 and v is an integer from 0 to 5,
- the present invention broadly consists in a method of making a compound of the formula (XX) or a salt or solvate thereof, the method comprising :
- Rm a nd Rn are each independently hydrogen, Cl-6alkyl, aryl, or heteroaryl;
- LG is a leaving group
- the present invention broadly consists in the use of a compound of the formula (XX) or (XXI) in the synthesis of a peptide-conjugate of the formula (IA) of the present invention (including provisos (1) and/or (2) of the first aspect) or a
- the present invention broadly consists in a method of making a peptide conjugate of the formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising : (A) reacting
- a first lipid-containing conj ugation partner comprising a carbon-carbon double bond
- lipid-containing conj ugation partner comprising a carbon-carbon double bond
- an amino acid-comprising conjugation partner comprising a thiol
- a first lipid-containing conjugation partner comprising a carbon-carbon double bond
- lipid-containing conj ugation partner comprising a carbon-carbon double bond
- an amino acid-comprising conjugation partner comprising a thiol
- the amino acid-comprising conjuation partner is a peptide- containing conjugation partner
- a nd the lipid-containing conjugation partners are coupled to the peptide of the peptide-conta ining conjugation partner.
- the lipid-containing conjugation partners are conjugated to the or an amino acid of the amino acid-comprising conjugation partner or the peptide of the peptide-containing conjugation partner.
- the lipid-containing conjugation pa rtners are conjugated to the or a n amino acid of the amino acid-comprising conj ugation partner.
- the present invention broad ly consists in a method of making a peptide conj ugate of formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising reacting
- a first lipid-containing conj ugation partner comprising a carbon-carbon double bond
- a second lipid-containing conj ugation partner comprising a carbon-carbon double bond
- peptide-containing conj ugation partner comprising a thiol under conditions effective to conjugate the first lipid-containing conj ugation partner and the second lipid-conta ining conj ugation partner to the peptide-containing conjugation partner and provide the peptide conj ugate of formula (I) or salt or solvate thereof
- the conjugate is a lipopeptide, such that the method is for making a lipopeptide.
- the first and second lipid-containing conj ugation partners have the same structure (that is, the first a nd second lipid-conta ining conj ugation partners are identical).
- the method comprises conjugating the sulfur atom of the thiol to a carbon atom of the carbon-carbon double bond of the first lipid containing conjugation partner and then conj ugating a carbon atom from the carbon-carbon double bond to which the thiol is conjugated to a carbon atom of the carbon-carbon double bond of the second lipid-containing conjugation pa rtner.
- the first lipid-containing conj ugation partner is a compound of the formula (IIA) :
- the second lipid-containing conjugation pa rtner is a compound of the formula
- Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IB) of the present invention (including provisos (1) and/or (2) of the first aspect); and
- Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IB) but excluding provisos (1) and (2) of the first aspect.
- the amino acid- or peptide conjugate is a compound of the formula (IB):
- Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IB) of the present invention (including provisos (1) and/or (2) of the first aspect); and
- Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IB) but excluding provisos (1) and (2) of the first aspect.
- the lipid containing conjugation partners are in stoichiometric excess to the amino acid-comprising conjugation partner.
- the mole ratio of the lipid containing conjugation partners (combined) to amino acid-comprising conjugation partner is at least 7: 1.
- the first lipid-containing conjugation partner is a compound of the formula (IIA-1):
- the second lipid-containing conjugation partner is a compound of the formula
- amino acid-comprising conjugation partner comprises a structure of the formula (III):
- the conjugate is a compound of the formula (IC) :
- Ra, Rb, Rc, LI, L2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IC) of the present invention (including provisos (1) and/or (2) of the first aspect); and
- LI is Cll-21alkyl; k is 0-3, preferably 0; and Ra, Rb, and Rc are each hydrogen.
- LI is Cl l-21alkyl; k is 1-3; and Ra, Rb, a nd Rc are each hyd rogen.
- L2 is Cl l-21alkyl; v is 0-3, preferably 0; and R3, R4, and R5 are each hydrogen. In various embodiments, n is 1 ; R6, R7, and R8 are each hydrogen ; and R9 is hydrogen, an amino protecting group, L3-C(0), or A2.
- n is 1 ; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(0), wherein L3 is linear C15alkyl or methyl .
- the compounds of formula (IIA) a nd (IIB) a re each vinyl palmitate.
- the amino-acid comprising conj ugation partner is cysteine, a protected cysteine (including Na-amine a nd/or carboxyl protected cysteine), or a peptide comprising a cysteine residue (including an ⁇ -amine or carboxyl protected cysteine residue), for example, a n N-terminal cysteine residue (including an ⁇ -amine protected cysteine residue).
- the method comprises reacting vinyl pa lmitate and an Na-amino protected cysteine, such as Fmoc-Cys-OH, Boc-Cys-OH, Fmoc-Cys-OPl, or Boc-Cys-OPl .
- an Na-amino protected cysteine such as Fmoc-Cys-OH, Boc-Cys-OH, Fmoc-Cys-OPl, or Boc-Cys-OPl .
- the carboxyl group of the Na-amino protected cysteine is protected .
- the conditions effective to conjugate the lipid-containing conjugation partners to the amino acid-comprising conjugation pa rtner comprises the generation of one or more free radicals.
- the cond itions effective to conj ugate the lipid-containing conj ugation partners to the peptide-conta ining conjugation partner comprises the generation of one or more free radicals.
- the generation of one or more free radica ls is initiated therma lly and/or photochemica lly.
- the generation of one or more free radicals is initiated by the thermal and/or photochemica l degradation of a free radical initiator.
- the generation of one or more free radicals is initiated by the thermal degradation of a therma l initiator or the photochemical degradation of a photochemical initiator.
- thermal degradation of the free radica l initiator comprises heating the reaction mixture at a suitable temperature.
- the reaction mixture is heated at a temperature is from about 40 °C to about 200 °C, from about 50 °C to about 180 °C, from about 60 °C to about 150 °C, from about 65 °C to about 120 °C, from about 70 °C to about 115 °C, from about 75 °C to about 110 °C, or from about 80 °C to about 100 °C.
- the reaction mixture is heated at a temperature of at least about 40 °C, at least about 50 °C, at least about 60 °C, or at least about 65 °C. In one specifically contemplated embodiment, the reaction mixture is heated at a temperature of about 90 °C.
- photochemical degradation of the free rad ical initiator comprises irrad iation with ultraviolet light, preferably having a frequency compatiable with the side chains of naturally occurring amino acids.
- the ultraviolet light has a wavelength of about 365 nm.
- photochemical degradation of the free radical initiator is carried out at a bout ambient temperature.
- the thermal initiator is 2,2'- azobisisobutyronitrile (AIBN) .
- AIBN 2,2'- azobisisobutyronitrile
- the photoinitiator is 2,2-dimethoxy-2-phenylacetophenone (DMPA).
- the reaction is carried out in a liquid med ium.
- the liq uid medium comprises a solvent.
- the solvent is selected from the g roup consisting of N-methylpyrrolidone (N MP), dimethylsulfoxide (DMSO), ⁇ , ⁇ -dimethylformamide (DMF), dichloromethane (DCM), 1,2-dichloroethane, and mixtures thereof.
- the solvent comprises N MP, DMF, DMSO, or a mixture thereof.
- the solvent comprises DMSO or N MP. In exemplary embodiments, the solvent comprises NMP.
- the reaction is carried out in the presence of one or more additives that inhibit the formation of by-products and/or that improve the yield of or conversion to the desired conj ugate.
- the one or more additive is an extra neous thiol, an acid, an orga nosilane, or a combination of a ny two or more thereof.
- the extraneous or exogenous thiol is selected from the group consisting of reduced glutathione (GSH), 2,2'-(ethylened ioxy)diethanethiol
- the extra neous or exogenous thiol is DTT.
- the extraneous or exogenous thiol is a sterically hindered thiol, for example terf-butyl mercaptan.
- the acid additive is a strong inorganic or organic acid .
- the acid is a strong organic acid .
- the acid is TFA.
- the organosilane is a trialkylsilane, for example TIPS.
- the one or more additive is selected from the group consisting of TFA, terf-butyl mercaptan, TIPS, and combinations of any two or more thereof.
- the one or more add itive is a combination of a n acid and an extraneous thiol, for example TFA and terf-butyl mercaptan.
- the one or more add itive is a combination of an acid and an orga nosilane, for example TFA a nd TIPS.
- the one or more add itive is a combination of an extraneous thiol and a n organosila ne, and optionally a n acid, for example a combination of t-BuSH and TIPS, and TFA.
- the reaction is carried out for a period of time from about 5 minutes to about 48 h, 5 minutes to about 24 h, from about 5 minutes to about 12 hours, from about 5 minutes to about 6 hours, from about 5 minutes to about 3 hours, 5 minutes to 2 hours, or form about 5 minutes to about 1 hour.
- the reaction is carried out for a period of time from about 5 minutes to about 48 h, 5 minutes to about 24 h, from about 5 minutes to about 12 hours, from about 5 minutes to about 6 hours, from about 5 minutes to about 3 hours, 5 minutes to 2 hours, or form about 5 minutes to about 1 hour.
- the reaction is carried out for a period of time from about 5 minutes to about 1 h. In some embodiments, the reaction is carried out until one of the conj ugation partners is at least about 70%, 80%, 90%, 95%, 97%, 99%, or 100% consumed.
- the reaction is carried out under substantially oxygen free conditions.
- the amino acid-comprising conjugation partner is a peptide- containing conjugation partner.
- the amino acid-comprising conjugation pa rtner comprises an epitope.
- the peptide-conta ining conj ugation partner comprises an epitope, such as a peptide epitope.
- the amino acid-comprising conjugation partner comprises two or more epitopes. In one embodiment, the peptide-containing conjugation partner comprises two or more epitopes.
- the amino acid-comprising conjugation partner consists of a peptide. In one embodiment, the amino acid-comprising conjugation partner consists of a peptide comprising a peptide epitope. In one embod iment, the peptide-containing conjugation partner consists of a peptide. In one embodiment, the peptide-containing conjugation partner consists of a peptide comprising a peptide epitope. In some embod iments, the amino acid-comprising conj ugation partner comprises an epitope bound to the or an amino acid of the conjugation partner. In some embodiment, the amino acid-comprising conj ugation partner comprises an epitope bound to the or an amino acid of the conjugation partner. In some
- the peptide-containing conj ugation partner comprises a n epitope bound to the peptide of the peptide containing conjugation partner. In some embodiments, the epitope is bound to the peptide via linker group. In some embod iments, the amino acid-comprising conj ugation pa rtner comprises a peptide epitope bound to the or an amino acid of the conj ugation partner via a linker group. In some embodiments, the peptide-containing conj ugation partner comprises a peptide epitope bound to the peptide via a linker group.
- the amino acid-comprising conj ugation partner and/or the peptide-containing conjugation partner comprises an antigenic peptide.
- the amino acid-comprising conjugation pa rtner a nd/or peptide conjugate comprises a synthetic peptide.
- the synthetic peptide is a peptide prepared by a method comprising solid phase peptide synthesis (SPPS).
- the method comprises coupling the amino acid of the amino acid conjugate or a n amino acid of the peptide conjugate to an amino acid or an amino acid of a peptide to provide a peptide conjugate.
- the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or an amino acid of a peptide to provide a peptide conjugate of the present invention .
- the peptide comprises an epitope.
- the epitope is a peptide epitope.
- the method further comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate of the present invention.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conj ugate to an a mino acid or a peptide so as to provide a peptide conj ugate of the invention comprising a linker group or one or more amino acids thereof.
- the method further comprises coupling an amino acid of the peptide conjugate comprising a linker group or one or more amino acids thereof to an amino acid or a peptide so as to provide a peptide conjugate of the invention comprising a peptide epitope bound to the amino acid to which lipid moieties are conj ugated via a linker g roup.
- the amino acid of the peptide conjugate to which the lipid moeities are conjugated is a n N-termina l amino acid residue.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conj ugate to an a mino acid or a peptide so as to provide a peptide conj ugate of the invention comprising a peptide epitope.
- the method further comprises coupling an epitope to the amino acid of the amino acid conj ugate or an amino acid of the peptide conjugate.
- the method further comprises coupling a peptide epitope to the amino acid of the amino acid conjugate or an a mino acid of the peptide conjugate.
- the epitope is coupled or bound via a linker group.
- the method further comprises coupling an epitope to the peptide of the peptide conj ugate.
- the method further comprises coupling a peptide epitope to the peptide of the peptide conj ugate.
- the epitope is bound to the peptide via a linker group.
- the method is (B) and the amino acid-comprising conjugation partner consists of a n amino acid, for example cysteine (including Na-amino and/or C- terminus protected cysteines).
- cysteine including Na-amino and/or C- terminus protected cysteines
- the amino acid- or peptide-conjugate compound of formula (I) but exclud ing provisos ( 1) and (2) of the first aspect is an amino acid-conjugate.
- Al is OH, OP1, N H2, or NHP2 and/or R9 is hydrogen, Cl-6alkyl, C3-6cycloalkyl, an amino protecting group, or L3-C(0) in the amino acid- or peptide- conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- Al is OP1 or OH and/or R9 is hydrogen, an a mino protecting group or L3-C(0) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- Al is OH, OP1, N H2, or NHP2 a nd R9 is hydrogen, Cl- 6alkyl, C3-6cycloalkyl, an amino protecting group, or L3-C(0) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- Al is OH, or OP1
- R9 is hydrogen, an amino protecting group, or L3-C(0) in the amino acid- or peptide-conj ugate compound of formula (I) but excluding provisos (1) a nd (2) of the first aspect.
- the C-terminus of the amino acid comprising conjugation partner is protected with a protecting group and/or the Na-amino group of the amino acid comprising conjugation partner is protected with a protecting group.
- the carboxyl g roup of the C-terminus of the a mino acid is protected with a carboxyl protecting group or a carboxamide protecting group and/or the ⁇ -amino group of the amino acid is protected with an amino protecting group.
- the carboxyl g roup of the C-terminus of the a mino acid is protected with a carboxyl protecting group and/or the ⁇ -amino group of the amino acid is protected with an amino protecting group.
- the carboxyl group of the C-terminus of the peptide is protected with a carboxyl protecting group a nd/or the ⁇ -amino g roup of the peptide is protected with an amino protecting group.
- the amino acid residue comprising the thiol is a terminal amino acid residue. In some embodiments, the amino acid residue comprising the thiol is an N- termina l residue.
- Al and/or R9 is a group other than an amino acid or a peptide, and the method comprises coupling an amino acid or a peptide so as to replace Al and/or R9 with the amino acid or peptide.
- Al a group other than an amino acid or a peptide, and the method comprises coupling an amino acid or a peptide so as to replace Al with the amino acid or peptide.
- Al is a OH, OP1, NH2, or N HP2 and/or R9 is hydrogen, an amino protecting group or L3-C(0), a nd the method comprises coupling an a mino acid or a peptide so as to replace Al and/or R9 with the amino acid or peptide.
- Al is a OH, OP1, NH2, or N HP2 and R9 is hyd rogen, an amino protecting group or L3-C(0) and the method further comprises coupling an amino acid or a peptide so as to replace Al and/or R9 with the amino acid or peptide.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- coupling the amino acid or peptide provides a peptide conjugate comprising a peptide epitope.
- the coupling the amino acid or peptide provides a peptide conj ugate comprising a linker group or one or more amino acids thereof.
- coupling the amino acid or peptide provides a peptide conj ugate comprising a peptide epitope bound to the amino acid to which the lipid moieties are conjugated via a linker group.
- the Na-amino group of the amino acid comprising the thiol to which the lipid moieties are conj ugated is acylated .
- R9 in the amino acid comprising conjugation pa rtner comprising the thiol is L3-C(0)-, for example Me-C(O)-.
- the method further comprises acylating the ⁇ -amino group of the amino acid of the amino acid conj ugate or the amino acid resid ue of the peptide conjugate to which the lipid moeities are conj ugated .
- the method further comprises acylating the ⁇ -amino group with a C2-20 fatty acid, such as acetyl.
- R9 is hydrogen or an amino protecting g roup
- the method further comprises acylating the amino acid conj ugate or peptide conjugate so as to replace the hydrogen or amino protecting group at R9 with L3-C(0).
- acylating the amino acid conjugate or peptide conjugate so as to replace the amino protecting group at R9 with L3-C(0) comprises removing the amino protecting group at R9 to provide a hydrogen at R9.
- the or an amino acid of the amino acid-comprising conjugation partner comprises the thiol.
- an amino acid residue of the peptide of the peptide-conta ining conj ugation partner comprises the thiol .
- the thiol is the thiol of a cysteine residue.
- the cysteine residue is a terminal resid ue.
- the cysteine residue is an N-termina l residue.
- the amino group of the cysteine residue is acylated.
- the amino group is acylated with a C2-20 fatty acid .
- the C2-20 fatty acid is acetyl or palmitoyl. In another exemplary embod iment, the C2-20 fatty acid is acetyl .
- the amino acid-comprising conj ugation pa rtner and/or peptide conjugate comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the peptide-containing conj ugation partner comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the amino acid-comprising conj ugation partner and/or peptide conj ugate comprises a peptide comprising from 8 to 60 amino acids. In one exemplary embod iment, the peptide comprises from 8 to 60 amino acids. In other embodiments, the amino acid-comprising conj ugation partner and/or peptide conjugate comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the peptide-conta ining conj ugation partner comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the amino acid comprising conjugation pa rtner and/or peptide conjugate comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the peptide-containing conjugation partner comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the amino acid comprising conjugation partner is a short peptide. In some embodiments, the short peptide comprises less than 10, 9, 8, 7, 6, 5, 4, or 3 amino acids.
- the amino acid-comprising conjugation pa rtner a nd/or peptide conjugate comprises one or more solubilising groups.
- the peptide- containing conjugation partner comprises one or more solubilising groups.
- the solubilising group is an amino acid seq uence comprising two or more hydrophilic amino acid residues in the peptide chain. In certain embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. In one embodiment, the hydrophilic amino acid residues are cationic amino acid residues. In one
- the cationic amino acid residues are arginine or lysine residues. In one specifically contemplated embodiment, the cationic amino acid residues are lysine residues. In one embod iment, the seq uence comprises from 2 to 20, 2 to 15, 2 to 10, 3 to 7, or 3 to 5 amino acids. In one embodiment, the solubilising group is a tri-, tetra-, penta-, hexa-, or hepta- lysine sequence. In one specifically contemplated embodiment, the solubilising group is a tetralysine sequence.
- the peptide conj ugate and/or amino-acid comprising conjugation partner comprises a serine residue adjacent to the amino acid resid ue to which the lipid moeities are conjugated .
- the peptide of the peptide-containing conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid moeities are conjugated .
- the amino acid residue to which the lipid moeities are conjugated is N-termina l.
- the peptide further comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino-acid comprising conjugation partner comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino acid-comprising conjugation partner comprises only naturally occuring amino acids.
- the peptide-containing conj ugation partner comprises only naturally occuring amino acids.
- 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide are naturally occuring a mino acids.
- the peptide conjugate and/or amino acid-comprising conjugation partner comprises a peptide comprising a peptide epitope.
- the peptide of the peptide-conta ining conjugation partner comprises one or more peptide epitopes.
- the peptide comprises, consists essentially of, or consists of an amino acid seq uence selected from the group consisting of those defined in proviso (1) of the first aspect.
- the peptide comprises, consists essentially of, or consists of one or more EBV LM P2 epitopes.
- the one or more EBV LMP2 epitopes a re MHCI epitopes.
- the peptide comprises one or more EBV LMP2 epitopes selected from the group consisting of a ny one of SEQ ID NOs 84- 109.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83, or comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the peptide comprises a recombina nt peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the recombinant peptide comprises or consists of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83, or comprises or consists of 20 or more contig uous amino acids from the amino acid sequence of any one of SEQ ID NOs 9 - 83.
- the peptide epitope is derived from NY-ESO-1.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, a nd 129.
- the peptide comprises, consists essentially of, or consists of one or more NY-ESO-1 epitopes. In various embodiments, the one or more NY-ESO-1 epitopes a re MHCI epitopes. In various embodiments, the the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contig uous amino acid resid ues from any one of SEQ ID NO : 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, a nd 129. In various embodiments, the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NO:
- the reactive functional groups of the amino acids of the peptide-containing conj ugation partner a re unprotected .
- one or more reactive functiona l groups of the amino acid of the amino acid conjugate are unprotected.
- one or more reactive functiona l groups of one or more amino acids of the amino acid-comprising conj ugation partner are unprotected.
- the amino acid-comprising conjugation partner comprises a peptide, wherein the reactive functional groups of the side chains of the amino acids of the peptide are unprotected, with the exception of any thiols other than the thiol to be reacted .
- the reactive functional g roups of the amino acids of the peptide of the peptide-containing conjugation partner are
- the reactive functional g roups of the amino acids of the peptide of the peptide-containing conjugation partner are
- peptide of the peptide conj ugate and/or peptide-containing conjugation partner may, as described herein, be optionally substituted, modified, or bound to various other moieties as described herein to provide the peptide conj ugate a nd/or peptide containing conjugation partner.
- the method comprises synthesising the amino acid sequence of a peptide by solid phase peptide synthesis (SPPS);
- SPPS solid phase peptide synthesis
- the method comprises
- SPPS solid phase peptide synthesis
- the method further comprises acylating the Na-amino group of the amino acid of the amino acid conj ugate or the amino acid to which the lipid-moieties are conjugated of any one of the peptide conj ugates.
- the method comprises cleaving the peptide conj ugate from the solid phase support.
- the method comprises
- SPPS solid phase peptide synthesis
- the method comprises
- the peptide-containing conjugation partner is not purified prior to reaction with the lipid-containing conjugation partners.
- one or more protecting groups are removed on cleaving the peptide from the solid phase support. In certain embodiments, a ll of the protecting groups present in the peptide are removed.
- the SPPS is Fmoc-SPPS.
- the amino acid residue in the peptide of the peptide-containing conjugation partner bea ring the thiol to be reacted is an N-terminal amino acid residue and the method comprises acylating the N -terminal amino g roup prior to cleaving the peptide from the solid phase.
- the N-terminal residue is a cysteine resid ue.
- the method further comprises separating the peptide conj ugate from the reaction medium and optionally purifying the peptide conjugate.
- the present invention broadly consists in a method of making a peptide conj ugate, the method comprising
- the product peptide conjugate is a compound of the formula (I) or a pharmaceutically acceptable salt thereof of the present invention .
- the amino acid of the amino acid conjugate is coupled under conditions that reduce epimerisation at the a-carbon of the amino acid .
- the conditions are such that less than about 35, 30, 25, 20, 15, 10, 5, 3, 2, or 1% by mol of the amino acid is epimerised .
- the conditions that reduce epimerisation comprise the use of PyBOP or BOP as the coupling reagent.
- the conditions that reduce epimerisation comprise the use of PyBOP as the coupling reagent.
- the conditions comprise the use of PyBOP or BOP; and 2,4,6-trimethylpyridine.
- the conditions comprise the use of PyBOP and 2,4,6-trimethylpyridine.
- the present invention broadly consists in use of an amino acid- or peptide-conjugate of the formula (I) of the present invention (including provisos (1) and/or (2) of the first aspect) or a salt or solvate thereof in the synthesis of an immunogenic peptide-conj ugate.
- the immunogenic peptide conj ugate is a compound of the formula (I) of the present invention or a pharmaceutically acceptable salt thereof.
- the present invention broadly consists in a peptide conj ugate of the present invention produced by a method of the present invention.
- the present invention broadly consists in a composition comprising a peptide conjugate of formula (I) of the present invention or a salt or solvate thereof.
- the composition comprises isolated, pure, purified or substantially purified compound of formula (I) of the present invention or a salt or solvate thereof. In various embodiments, the composition comprises at least about 60, 70, 75, 80, 85, 90, 95, 97, 98, or 99% by weight compound of formula (I) of the present invention or a salt or solvate thereof.
- the composition is free of substantially free of amino acid- or peptide containing compounds other than compounds of formula (I) of the present invention.
- the present invention broadly consists in a pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of a peptide conjugate compound of the formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pha rmaceutically acceptable carrier.
- the pharmaceutical composition comprises an effective amount of two or more peptide conjugate compounds of the formula (I) of the present invention.
- the pha rmaceutical composition is a n immunogenic composition.
- the pha rmaceutical composition does not include an extrinsic adj uvant.
- the pharmaceutical composition is a vaccine.
- the pha rmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention, for example the pharmaceutical composition comprises an effective amount of three or more peptide conjugates of the present invention. In one embodiment, the pha rmaceutical composition comprises an effective amount of one or more peptide conjugates of the present invention together with one or more peptides described herein, or any combination thereof. For example, the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention a nd one or more peptides described herein, or an effective amount of one or more peptide conjugates of the present invention and two or more peptides described herein.
- the present invention broadly consists in a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of one or more peptide conjugate compounds of the formula (I) of the invention or a pha rmaceutically acceptable salt or solvate thereof, or a n effective amount of a pharmaceutical composition of of the present invention.
- the present invention broadly consists in use of one or more peptide conjugate compounds of formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof or a pha rmaceutica l composition of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention broadly consists in one or more peptide conjugate compounds of the formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof or a pha rmaceutica l composition of the present invention for vaccinating or eliciting a n immune response in a subject.
- the present invention broadly consists in use of one or more peptide conjugate compounds of the formula (I) of the invention or a pharmaceutica lly acceptable salt or solvate thereof or a pha rmaceutica l composition of the present invention for vaccinating or eliciting a n immune response in a subject.
- the present invention broadly consists in a method of activating TLR2 in a subject, the method comprising administering to the subject an effective amount of one or more peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof, or a n effective amount of a pharmaceutical composition of the invention.
- One or more peptide conjugate compounds of the invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the invention for activating TLR2 in a subject is for eliciting an immune response in a subject.
- the method, use, one or more compounds, or pharmaceutical composition is for vaccinating a subject.
- the method comprises the administration of one or more peptides described herein and one or more peptide conjugates of the present invention or two or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates to the subject.
- one or more peptides described herein and one or more peptide conjugates of the present invention or two or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates, are used for vaccinating or eliciting an immune response in the subject or in the manufacture of a medicament for vaccinating or eliciting an immune response in the subject.
- two or more peptide conjugates are used or administered.
- the two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered simultaneously, sequentially, or separately.
- Asymmetric centers may exist in the compounds described herein.
- the asymmetric centers may be designated as (R) or (S), depending on the configuration of substituents in three dimensional space at the chiral carbon atom.
- All stereochemical isomeric forms of the compounds, including diastereomeric, enantiomeric, and epimeric forms, as well as d-isomers and l-isomers, and mixtures thereof, including enantiomerically enriched and diastereomerically enriched mixtures of stereochemical isomers, are within the scope of the invention.
- Individual enantiomers can be prepared synthetically from commercially available enantiopure starting materials or by preparing enantiomeric mixtures and resolving the mixture into individual enantiomers. Resolution methods include conversion of the enantiomeric mixture into a mixture of diastereomers and separation of the
- tautomeric isomers or mixtures thereof of the compounds described are any tautomeric isomers or mixtures thereof of the compounds described .
- a wide variety of functiona l groups and other structures may exhibit tautomerism. Exa mples include, but are not limited to, keto/enol, imine/enamine, and thioketone/enethiol tautomerism.
- the compounds described herein may also exist as isotopologues a nd isotopomers, wherein one or more atoms in the compounds are replaced with different isotopes.
- Suitable isotopes include, for example, H 2 H (D), 3 H (T), 12 C, 13 C, 14 C, 1S 0, and 18 0. Proced ures for incorporating such isotopes into the compounds described herein will be apparent to those skilled in the art.
- Acid addition salts can be prepa red by reacting compounds, in free base form, with inorganic or organic acids.
- inorganic acids include, but a re not limited to, hydrochloric, hydrobromic, nitric, sulfuric, and phosphoric acid .
- Examples of orga nic acids include, but are not limited to, acetic, trifluoroacetic, propionic, succinic, glycolic, lactic, malic, tartaric, citric, ascorbic, maleic, fumaric, pyruvic, aspartic, glutamic, stearic, salicylic, metha nesulfonic, benzenesulfonic, isethionic, sulfanilic, adipic, butyric, and pivalic.
- Base addition salts can be prepa red by reacting compounds, in free acid form, with inorganic or organic bases.
- inorganic base addition salts include alkali metal salts, alkaline earth metal salts, and other physiologically acceptable metal salts, for example, aluminium, calcium, lithium, magnesium, potassium, sodium, or zinc salts.
- organic base addition salts include amine salts, for example, sa lts of trimethylamine, diethylamine, ethanolamine, d iethanolamine, and ethylenediamine.
- Quaterna ry salts of basic nitrogen-containing groups in the compounds may be may be prepared by, for example, reacting the compounds with alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides, dia lkyl sulfates such as dimethyl, diethyl, dibutyl, a nd d iamyl sulfates, and the like.
- the compounds described herein may form or exist as solvates with various solvents. If the solvent is water, the solvate may be referred to as a hyd rate, for example, a mono- hydrate, a d i- hydrate, or a tri-hydrate. All solvated forms and unsolvated forms of the compounds described herein are within the scope of the invention.
- the general chemical terms used in the formulae herein have their usual mea ning .
- aliphatic is intended to include saturated and unsaturated, nonaromatic, straight cha in, branched, acyclic, and cyclic hydrocarbons.
- aliphatic groups include, for example, alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups, and hybrids thereof such as (cycloalkyl)alkyl, (cycloa lkenyl)alkyl and (cycloalkyl)alkenyl groups.
- a liphatic groups comprise from 1-12, 1-8, 1-6, or 1-4 carbon atoms.
- a liphatic groups comprise 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- the aliphatic group is saturated .
- heteroaliphatic is intended to include a liphatic groups, wherein one or more chain and/or ring carbon atoms are independently replaced with a heteroatom, preferably a heteroatom selected from oxygen, nitrogen and sulfur. In some embodiments, the heteroa liphatic is saturated .
- heteroaliphatic groups include linear or branched, heteroalkyl, heteroalkenyl, and heteroalkynyl groups.
- alkyl is intended to include saturated straight cha in and branched chain hydrocarbon groups.
- alkyl groups have from 1 to 12, 1 to 10, 1 to 8, 1 to 6, or from 1 to 4 carbon atoms.
- a lkyl groups have from 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- straight chain alkyl groups include, but a re not limited to, methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl.
- branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, tert-butyl, neopentyl, isopentyl, a nd 2,2-dimethylpropyl.
- alkenyl is intended to include stra ight and branched chain alkyl groups having at least one double bond between two carbon atoms.
- alkenyl groups have from 2 to 12, from 2 to 10, from 2 to 8, from 2 to 6, or from 2 to 4 carbon atoms.
- a lkenyl g roups have from 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- alkenyl groups have one, two, or three carbon-carbon double bonds.
- alkynyl is intended to include straight and branched chain alkyl groups having at least one triple bond between two carbon atoms. In some embodiments, the alkynyl group have from 2 to 12, from 2 to 10, from 2 to 8, from 2 to 6, or from 2 to 4 carbon atoms. In some embodiments, a lkynyl groups have one, two, or three carbon-carbon triple bonds. Examples include, but are not limited to, -C ⁇ CH, -C ⁇ CH3, -CH2C ⁇ CH 3, and -C ⁇ CH 2 CH(CH 2 CH 3 )2.
- heteroalkyl is intended to include alkyl groups, wherein one or more cha in carbon atoms are replaced with a heteroatom, preferably a heteroatom selected from the group consisting of oxygen, nitrogen, a nd sulfur. In some embodiments, the heteroalkyl is saturated . Heteroalkyl groups include, for example, polyethylene glycol groups and polyethylene glycol ether groups, and the like.
- cycloalkyi is intended to include mono-, bi- or tricyclic alkyl groups.
- cycloalkyi g roups have from 3 to 12, from 3 to 10, from 3 to 8, from 3 to 6, from 3 to 5 carbon atoms in the ring(s).
- cycloalkyi g roups have 5 or 6 ring ca rbon atoms.
- monocyclic cycloalkyi g roups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
- the cycloalkyi group has from 3 to 8, from 3 to 7, from 3 to 6, from 4 to 6, from 3 to 5, or from 4 to 5 ring carbon atoms.
- Bi- and tricyclic ring systems include bridged, spiro, and fused cycloalkyi ring systems. Examples of bi- and tricyclic ring cycloalkyi systems include, but are not limited to, bicyclo[2.1.1]hexanyl, bicyclo[2.2.1 ]heptanyl, adamantyl, and decalinyl.
- cycloalkenyl is intended to include non-a romatic cycloalkyi groups having at least one double bond between two carbon atoms.
- cycloa lkenyl groups have one, two or three double bonds.
- cycloalkenyl groups have from 4 to 14, from 5 to 14, from 5 to 10, from 5 to 8, or from 5 to 6 carbon atoms in the ring(s).
- cycloalkenyl groups have 5, 6, 7, or 8 ring carbon atoms.
- cycloalkenyl groups include cyclohexenyl, cyclopentenyl, cyclohexad ienyl, butad ienyl, pentadienyl, a nd hexadienyl .
- aryl is intended to include cyclic aromatic hydrocarbon groups that do not contain any ring heteroatoms.
- Aryl groups include monocyclic, bicyclic and tricyclic ring systems. Examples of aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, fluorenyl, phena nthrenyl, anthracenyl, indenyl, indanyl, pentalenyl, and naphthyl .
- aryl groups have from 6 to 14, from 6 to 12, or from 6 to 10 carbon atoms in the ring(s) .
- the aryl groups are phenyl or naphthyl.
- Aryl g roups include a romatic-aliphatic fused ring systems. Examples include, but are not limited to, indanyl and tetrahydronaphthyl .
- the term "heterocyclyl" is intended to include non-aromatic ring systems containing 3 or more ring atoms, of which one or more is a heteroatom . In some embodiments, the heteroatom is nitrogen, oxygen, or sulfur. In some embodiments, the heterocyclyl group contains one, two, three, or four heteroatoms.
- heterocyclyl groups include mono-, bi- a nd tricyclic rings having from 3 to 16, from 3 to 14, from 3 to 12, from 3 to 10, from 3 to 8, or from 3 to 6 ring atoms.
- Heterocyclyl groups include partially unsaturated and saturated ring systems, for example, imidazolinyl and imidazolidinyl.
- Heterocyclyl groups include fused and bridged ring systems conta ining a heteroatom, for example, quinuclidyl.
- Heterocyclyl groups include, but are not limited to, azirid inyl, azetidinyl, azepanyl, diazepa nyl, 1,3-dioxanyl, 1,3-d ioxolanyl, isoxazolid inyl, morpholinyl, piperazinyl, piperidinyl, pyranyl, pyrazolid inyl, pyrrolinyl, pyrrolidinyl, tetra hydrofuranyl, tetrahydrothienyl, thiad iazolidinyl, and trithia nyl.
- heteroaryl is intended to include aromatic ring systems containing 5 or more ring atoms, of which, one or more is a heteroatom.
- the heteroatom is nitrogen, oxygen, or sulfur.
- heteroaryl groups include mono-, bi- and tricyclic ring systems having from 5 to 16, from 5 to 14, from 5 to 12, from 5 to 10, from 5 to 8, or from 5 to 6 ring atoms.
- Heteroaryl groups include, but are not limited to, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, thiophenyl, benzothiophenyl, furanyl, benzofuranyl, indolyl, azaindolyl (pyrrolopyridinyl), indazolyl, benzimidazolyl,
- pyrazolopyridinyl triazolopyridinyl, benzotriazolyl, benzoxazolyl, benzothiazolyl, imidazopyridinyl, isoxazolopyridinylxanthinyl, gua ninyl, q uinolinyl, isoq uinolinyl, tetra hydroquinolinyl, q uinoxalinyl, and q uinazolinyl.
- Heteroaryl groups include fused ring systems in which all of the rings are a romatic, for example, indolyl, and fused ring systems in which only one of the rings is aromatic, for example, 2,3-dihyd roindolyl.
- halo or halogen is intended to include F, CI, Br, and I.
- heteroatom is intended to include oxygen, nitrogen, sulfur, or phosphorus. In some embodiments, the heteroatom is selected from the group consisting of oxygen, nitrogen, and sulfur.
- substituted is intended to mea n that one or more hyd rogen atoms in the group indicated is replaced with one or more independently selected suitable substituents, provided that the normal valency of each atom to which the substituent/s are attached is not exceeded, and that the substitution results in a stable compound.
- optional substituents in the compounds described herein include but are not limited to halo, CN, N0 2 , OH, N H 2 , N HR10, N R10R20, Cl-
- carboxyl protecting group is mea ns a group that is capable of readily removed to provide the OH group of a carboxyl group and protects the carboxyl group aga inst undesirable reaction during synthetic proceed ures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et a l. (John Wiley & Sons, 1999) and 'Amino Acid-Protecting Groups' by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alva rez) Chemical Reviews 2009 (109) 2455- 2504.
- Examples include, but a re not limited to, a lkyl a nd silyl g roups, for example methyl, ethyl, terf-butyl, methoxymethyl, 2,2,2-trichloroethyl, benzyl, diphenylmethyl, trimethylsilyl, and terf-butyldimethylsilyl, and the like.
- amine protecting group means a group that is capable of being readily removed to provide the N H2 group of an amine group and protects the amine group aga inst undesirable reaction during synthetic proceed ures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et a l. (John Wiley & Sons, 1999) and 'Amino Acid-Protecting Groups' by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alva rez) Chemical Reviews 2009 (109) 2455- 2504.
- Examples include, but a re not limited to, acyl and acyloxy groups, for example acetyl, chloroacetyl, trichloroacetyl, o-nitrophenylacetyl, o-nitrophenoxy-acetyl, trifluoroacetyl, acetoacetyl, 4-chlorobutyryl, isobutyryl, picolinoyi, aminocaproyi, benzoyl, methoxy-carbonyl, 9-fluorenylmethoxycarbonyl, 2,2,2-trifluoroethoxycarbonyl, 2- trimethylsilylethoxy-carbonyl, terf-butyloxycarbonyl, benzyloxycarbonyl, p- nitrobenzyloxycarbonyl, 2,4-dichloro-benzyloxycarbonyl, and the like.
- acyl and acyloxy groups for example acetyl, chloroacetyl, trichloroacety
- Cbz carboxybenzyl
- Nosyl (0- or p-nitrophenylsulfonyl
- Bpoc (2-(4- biphenyl)isopropoxycarbonyl)
- Dde l-(4,4-dimethyl-2,6-dioxohexylidene)ethyl
- carboxamide protecting group means a group that is capable of being read ily removed to provide the N H2 group of a carboxamide g roup and protects the carboxamide g roup against undesirable reaction during synthetic procedures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al . (John Wiley & Sons, 1999) and 'Amino Acid-Protecting Groups' by Ferna ndo Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504.
- Examples include, but are not limited to, 9-xa nthenyl (Xan), trityl (Trt), methyltrityl (Mtt), cyclopropyldimethylcarbinyl (Cpd), and dimethylcyclopropylmethyl (Dmcp) .
- Xan 9-xa nthenyl
- Trt trityl
- Mtt methyltrityl
- Cpd cyclopropyldimethylcarbinyl
- Dmcp dimethylcyclopropylmethyl
- the invention may also be said broadly to consist in the pa rts, elements and features referred to or indicated in the specification of the application, individ ua lly or collectively, in a ny or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equiva lents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth.
- Figure 1 is a graph showing the results of a representative TLR agonism assay in HEK- BlueTM-hTLR2 cells using titrated concentrations of agonist constructs : 910 (dotted white bars); 930 (g rey bars) ; 931 (striped bars) ; 932 (square hatched bars); and (R)- Pam2Cys-SK4-SLLMWITQV (black bars). Data presented as mean +/- SD ABS (635nm) values for triplicate wells following background subtraction. Dotted lines ind icate ABS in PBS-only wells.
- Figure 2A is a ba r graph showing the results of a huma n TLR2 agonism assay in HEK- BlueTM-hTLR2 cells using titrated concentrations of the following agonist constructs: A) (from left to right) : 45a, 45b, 46a, 46b, 47b, 910, 911, 912 and 913 (structures depicted in Table 3); B) (from left to right): 45b, 910 and chain elongated structures 930, 931, and 932 (structures depicted in Table 4).
- Figure 3 is a bar graph showing the results of a murine TLR2 agonism assay using titrated concentrations of the following agonist constructs: A) (from left to right): 45a, 45b, 46a, 46b, 47b, 910, 911, 912 and 913 (structures depicted in Table 3); B) (from left to right): 45b, 910 and chain elongated structures 930, 931, and 932 (structures depicted in Table 4).
- the present invention provides peptide conjugate compounds of the formula (I) as defined herein in the first aspect.
- the inventors have advantageously found that such conjugates have surprising immunogenic activity.
- the peptide conjugate compounds of formula (I) may be prepared using the methods and procedures described herein.
- Starting materials and/or intermediates useful in the methods may be prepared using known synthetic chemistry techniques (for example, the methods generally described in Louis F Fieser and Mary F, Reagents for Organic Synthesis v. 1-19, Wiley, New York (1967-1999 ed.) or Beilsteins Handbuch der organischen Chemie, 4, Aufl. Ed. Springer- Verlag Berlin, including supplements (also available via the Beilstein online database)) or, in some embodiments, may be commercially available.
- Preparation of the compounds may involve the protection and deprotection of various chemical groups. The need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by a person skilled in the art.
- compounds of formula (IF) that are compounds of formula (I) wherein w is 1, v is 0, and m is from 2 to 6, preferably 2 or 3 to 5, may be prepared via a method of the present invention involving the conjugation of an epoxide to an amino acid-comprising conjugation partner.
- Scheme Al Preparation of compounds of formula (IF) via conj ugation to an epoxide.
- the method comprises reacting an epoxide of the formula (XVI) and an amino acid- comprising conjugation partner comprising a thiol of the formula (III) under conditions effective to provide the compound of formula (XV) by conjugation of the thiol to the epoxide.
- the variables m, n, LI, Zl, R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al in the compound of formula (XV) are as defined in the compound of formula (IF) of the invention (including provisos (1) and/or (2) of the first aspect); and the method further comprises converting the compound of formula (XV) to the compound of formula (IF) of the invention by one or more additional synthetic steps.
- the amino acid-comprising conjugation partner may comprise a peptide that corresponds the peptide present in the compound of the formula (IF) of the invention produced by the method.
- the variables m, n, LI, Zl, R, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al in the compound of formula (XV) are as defined in the compound of formula (IB) but exclud ing provisos (1) and (2) of the first aspect; and the method further comprises converting the compound of formula (XV) to a compound of formula (IF) but exclud ing provisos (1) and (2) of the first aspect by one or more additional synthetic steps; and coupling the compound to an amino acid or peptide to provide the compound of formula (IF) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conjugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (IF) of the invention produced by the method .
- the amino acid comprising conjugation pa rtner reacted with the epoxide consists of an amino acid, for example an Na-amine protected and/or C-terminus protected cysteine.
- the amino acid comprising conj ugation partner comprises a peptide, for example a short peptide.
- the amino acid comprising conjugation partner may comprise about 15 amino acid resid ues or less, for example 5, 4, or 3 amino acid residues.
- the Na-amino group of the amino acid comprising conjugation partner is preferably protected or otherwise substituted (i.e. is not in the form of a free amine -N H2 group) to prevent reaction d uring the conjugation reaction.
- the C-terminus of the amino acid comprising conjugation partner may a lso be protected .
- X10 in the compound of formula (XVI) may be a protected hyd roxyl, thiol, amine, or carbamate group (P10-O-, P11-S-, P12-N R-, or P12-N RC(0)0-, respectively) from which Ll-Zl- a nd L2-Z2- may subsequently be formed .
- the protecting group may be removed in the conjugation reaction to provide a compound of the formula (XV) wherein Xl l is the correspond ing deprotected group.
- X10 is a PIO-O- group conjugation may provide the corresponding hydroxyl group as Xl l in the compound of formula (XV).
- the epoxide of formula (XVI) comprises a stereogenic centre at the carbon atom to which R3 is attached .
- a sing le stereoisomer of the epoxide or a stereoisomerically enriched mixture of the epoxide may used in the reaction to control the stereochemistry of the carbon atom to which R3 is attached in the compound of formula (XV) and subsequent products formed, including the compound of formula (IF).
- Va rious methods for providing enantiopure or ena ntioenriched mixtures of epoxides are known in the a rt.
- providing the single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI) comprises resolving a racemic mixture of the epoxide.
- resolving a racemic epoxide mixture by kinetic hydrolysis as described by Jacobsen et al, Science, 1997, 277, 936-938.
- the epoxide of formula (XVI) may be provided by reacting an alkene of the formula (XVII) with an oxidant under conditions effective to epoxidise the alkene.
- an oxidant under conditions effective to epoxidise the alkene.
- Numerous methods for epoxidising alkenes are known in the art.
- the epoxidation is carried out by reacting the a lkene with a peroxide or an organic N-oxide as the oxida nt.
- suitable peroxides include organic peroxides, for example m- chloro peroxybenzoic acid .
- N-oxides include, for example, pyridine N-oxide and the like. Other suitable oxidants will be apparent to those skilled in the art.
- the reaction may be carried out in a liquid reaction medium comprising a suitable solvent, for example dichloromethane.
- a suitable solvent for example dichloromethane.
- Alkenes of the formula (XVII) may be commercially available or prepared from commercially ava ilable precursors using standard synthetic chemistry techniq ues.
- X10 groups may be susceptible to oxidation in the epoxidation reaction, for example when X10 comprises an amine group (which may form an N-oxide) or thioether group (which may form e.g . sulfoxides or sulfones). Such groups may be protected during the reaction to prevent oxidation or reduced back to the desired group at an appropriate point in the synthetic sequence after the epoxidation reaction has been carried out.
- the epoxide of formula (XVI) may be prepared by treating a compound of formula (XVII-A), wherein LG is a suitable leaving group such as a ha logen, with a base in a suitable solvent to displace the leaving group as shown in scheme A2.
- Compounds of the formula (XVII-A) may be commercia lly available or may be prepared from commercially available precursors.
- the compound of formula (XVII-A) may be prepared from a n enantiopure a-amino acid .
- the epoxidation reaction proceeds stereospecifically with inversion of stereochemistry at the carbon to which R3 is attached.
- the compound of formula (XVII-A1) which corresponds to a compound of formula (XVII-A) wherein m is 2 and Rl and R2, and R3, R4, and R5 are hyd rogen, X10 is -OH, and LG is bromo, may be prepared from L-aspartic acid (see Volkmann, R. A. et a l. J. Org. Chem., 1992, 57, 4352-4361).
- L-Aspartic acid may be converted to be bromosuccinic acid (AA-1) by, for example, treatment with sodium nitrite and a strong acid such as sulfuric acid, to generate nitrous acid in situ, in the presence of sodium bromide at a temperature from -10 to 0°C.
- the reaction proceeds stereospecifically with overall retention of stereochemistry.
- Reduction of bromosuccinic acid (AA-1) to bromodiol (XVII-A1) may be carried out using a suitable reductant, for example by treatment with borane or borane-dimethyl sulfide complex in THF at -78°C allowing the reaction mixture to warm to room temperature.
- Epoxidation to provide the compound of formula (XVI-la) may be carried out by reacting bromodiol (XVII-A1) with a base, for example cesium carbonate in dichloromethane at room temperature. As noted above, the reaction proceeds stereospecifcally with overall inversion of stereochemistry.
- the opposite enantiomer of epoxide (XVI-la) can be prepared from D-aspartic acid by the same procedure.
- the compound of formula (XV) may be subsequently converted by one or more synthetic steps to compound of the formula (IF) as defined in either method (A) or (B).
- the hydroxyl group bound to the carbon to which R3 is attached is converted to an L2-Z2- group.
- the one or more steps also comprises converting Xll to Ll-Zl- .
- the Ll-Zl- and L2-Z2- groups may be introduced simultaneously or sequentially in any order.
- the one or more steps comprises acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(0)-.
- X10 is PIO-O- or OH; and Xl l is PIO-O- or OH.
- Xl l is PIO-O- or OH; and the one or more synthetic steps comprise acylating the compound of formula (XV) so as to replace P10 or the hydrogen atom of the hydroxyl group of Xl l with Ll-C(O)-; and/or the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(0)-.
- the method comprises reacting an epoxide of formula (XVI-1) bearing a protected hydroxyl group with an amino acid comprising conjugation partner of the formula (III) to provide a compound of the formula (XV-la).
- Scheme A3 Preparation of bis-ester conj ugates via epoxide conj ugation.
- the conj ugation reaction may be carried out under acid ic cond itions by reacting the epoxide and thiol in the presence of an acid, for example hydrochloric acid, sulfuric acid, or a mixture thereof.
- the reaction may be carried out in a liquid reaction medium comprising a suitable solvent, such as dichlorometha ne, at a temperature from about -10 to about 50°C, for example from 0 to 40°C.
- the hydroxyl protecting group P10 is selected such that it is removable under the conditions effective for conjugation and is therefore removed during the conjugation reaction to provide the desired diol of formula (XV-la).
- Suitable protecting groups will be apparent to those skilled in the a rt a nd may include, for example, acid labile silyl protecting groups.
- the conj ugation reaction may be carried using an epoxide of the formula (XVI) wherein X10 is a hydroxyl group, such as the epoxide of formula (XVI-la).
- the diol of the formula (XV-la) may be converted to the compound of formula (IF-1) by reaction with the compounds of formula (VI-1) and (VI), wherein X is OH or a suitable leaving group (for example a ha lide, such as chloro or bromo), under cond itions effective for esterification.
- X is OH or a suitable leaving group (for example a ha lide, such as chloro or bromo), under cond itions effective for esterification.
- the cond itions effective for esterification depend on the nature of the compound of formula (IV) and/or (VI-1).
- the reaction may be carried out in the presence of a base, such as DMAP, and activating agent, such as ⁇ , ⁇ '- diisopropylcarbod iimide (DIC) in a liquid medium comprising a suitable solvent, such as THF.
- a base such as DMAP
- activating agent such as ⁇ , ⁇ '- diisopropylcarbod iimide (DIC)
- DIC ⁇ , ⁇ '- diisopropylcarbod iimide
- THF a suitable solvent
- the compound of formula (VI) and (VI-1) are identical.
- the compound of formula (VI) and (VI-1) may each be palmitic acid.
- conversion of the diol of formula (XV-la) to the compound of formula (IF- 1) may be accomplished in a single step.
- different LI and L2 groups may be introduced by reacting the diol with a stoichiometric amount of a compound of formula (VI-1) or (VI) to esterify the more reactive of the two alcohols, and then reacting the resultant ester with the other a compound of formula (VI) or (VI-1) to esterify the second alcohol of the diol.
- the method comprises reacting an epoxide of formula (XVI-1) and an amino acid comprising conjugation partner of the formula (III) to provide a compound of the formula (XV-lb) as shown in Scheme A4 below.
- the hydroxyl protecting group P10 is stable and is not removed under the conjugation reaction conditions.
- the protected alcohol of the formual (XV-lb) provides ready access to compounds of formula (IF-1) wherein LI and L2 are different.
- Using the compound of formula (XV-lb) to access such compounds, rather than the diol of formula (XV-la), may be more convenient in certain emboidments, for example where there is poor selectivity between the alcohols of the diol of formula (XV-la).
- the ⁇ -sulfanylhydroxyl group of the compound of formula (XV-lb) may be acylated with a compound of formula (VI) under conditions effective for esterification to provide protected ester (XVIII), then the protecting group P10 removed to provide the alcohol of formula (XIX).
- the conditions for removal of the protecting group depend on the protecting group used . For example, dilute HF may be used to remove silyl protecting groups, such as TBDMS, TBDPS, a nd the like.
- the alcohol of formula (XIX) may then be acylated with a compound of formula (VI-1) under conditions effective for esterification to provide the desired compound of formula (IF-1).
- hyd roxyl groups for example those in the compounds of formulae (XV-la), (XV-lb), and (XIX), may be converted to various other functiona l groups, such as thiols and amines, to provide access compounds of formula (I) bearing Ll-Zl- and L2-Z2- g roups other tha n esters.
- the compound of formula (XV-l b) can be used to prepare thioester and amide analogues of the compound of formula (IF-1), as shown below in Scheme A5.
- hydroxyl group in the compound of formula (XV-lb) may first be converted to an azide and then red uced to the corresponding amine.
- the reaction may be carried out under modified M itsunobu cond itions (e.g. L. Rokhum et al, J. Chem. Sci, 2012, 124, 687-691) using PPh 3 , I2, imidazole, and NaN 3 to provide the azide, and then PPh 3 to reduce azide to the amine.
- the azide may be obtained by first converting the hyd roxyl group to a suitable leaving group, for example a tosyl or mesyl g roup, and then treating with NaN 3 .
- a suitable leaving group for example a tosyl or mesyl g roup
- Acylation of the amine with a compound of formula (VI) provides the amide of formula (XVIII-2).
- the acylation reaction may be carried out by reacting a carboxylic acid of the formula (VI) in the presence of a base, for example DMAP, and an activating agent, for example DIC, in a suitable solvent such as THF.
- Deprotection of the protecting g roup P10 and esterification of the resulta nt alcohol (XIX-2) provides the compound of the formula (IF-3).
- XIX-2 (IF-3) Thioester analogue (IF-2) may be prepared by first reacting the compound of formula (XV-lb) under Mitsunobu conditions (e.g. PPh3, diethylazodicarboxylate (DEAD)) and trapping with the desired thioacid of formula (VI-2), for example thiopalmitic acid, to provide the compound of formula (XVIII-l)(see e.g. 0. Schulze et al, Carbohydrate Res., 2004, 339, 1787-1802). Deprotection of the protecting group P10 and esterification of the resultant alcohol (XIX-1) provides the compound of the formula (IF-2).
- Mitsunobu conditions e.g. PPh3, diethylazodicarboxylate (DEAD)
- VI-2 diethylazodicarboxylate
- thiopalmitic acid for example thiopalmitic acid
- Thioester and amide analgoues of bis-ester may also be prepared from the compound of formula (XIX), as shown in Scheme A6.
- the compound of formula (XIX) may be converted to the compound of formula (IF-4) by methods analogous to those described above for the conversion of the compound formula (XV-lb) to the compound of formula (XVIII-1).
- the compound of formula (XIX) may be converted to the compound of formula (IF-5) by methods analogous to those described above for the conversion of the compound of formula (XV-lb) to the compound of formula (XVIII-2).
- Scheme A6 Preparation of thioesters and amides via the compound of formula (XIX).
- analogues of bis-ester (IF-1) may be prepared by replacing the compound of formula (XIX) in Scheme A6 with a compound of formula (XIX-1) or (XIX-2) and then following the synthetic sequences described .
- the method comprises reacing an amino acid comprising conj ugation partner of the formula (III) and an acetal of the formula (XXI), wherein LG is a suitable leaving group, under conditions effective to provide a compound of the formula (XX).
- the variables m, w, v, n, Rx, Ry, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al in the compound of formula (XX) are as defined in the compound of formula (I) of the invention (includ ing provisos (1) and/or (2) of the first aspect); and the method further comprises converting the compound of formula (XX) to the compound of formula (I) of the invention by one or more additiona l synthetic steps.
- the amino acid-comprising conj ugation partner may comprise a peptide that corresponds the peptide present in the compound of the formula (I) of the invention produced by the method .
- the variables m, w, v, n, Rx, Ry, Rl, R2, R3, R4, R5, R6, R7, R8, R9, and Al in the compound of formula (XX) are as defined in the compound of formula (I) but excluding provisos (1) a nd (2) of the first aspect; and the method further comprises converting the compound of formula (XX) to a compound of formula (I) but excluding provisos (1) a nd (2) of the first aspect by one or more additional synthetic steps; and coupling the compound to an amino acid or peptide to provide the compound of formula (I) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conj ugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (I) of the invention produced by the method.
- the amino acid comprising conjugation pa rtner reacted with the acetal consists of an amino acid, for example a n ⁇ -amine protected a nd/or C-terminus protected cysteine.
- the amino acid comprising conjugation partner comprises a peptide, for example a short peptide.
- the amino acid comprising conjugation partner may comprise about 15 amino acid residues or less, for example 5, 4, or 3 amino acid residues.
- the Na-amino group of the amino acid comprising conjugation partner is preferably protected or otherwise substituted (i.e. is not in the form of a free amine -N H2 group) to prevent reaction d uring the conjugation reaction.
- the C-terminus of the amino acid comprising conjugation partner may a lso be protected .
- the thiol of the compound of formula (III) displaces the leaving group (LG) in the acetal of formula (XXI).
- Suitable leaving groups include but are not limited to halo (for example chloro, bromo, or iodo) or sulfonate (for example a tosylate or mesylate). Other suita ble leaving g roups will be apparent to those skilled in the art.
- the size of the aceta l ring in the compound of formula (XXI) may vary.
- the acetal ring may comprise from 5 to 7 ring atoms (i.e. may be a 5-7-membered cyclic acetal).
- the cyclic acetal is 6-membered . It will be appreciated that when the cyclic acetal is a 5-membered cyclic acetal, in order to provide a compound of the formula (I), w is at least 2 (such that the sum of m, v, and w is at least 3).
- the conj ugation reaction may be carried out in the presence of a base.
- the reaction may be carried out in the presence of organic amine, in a suitable solvent, for example DMF, at a temperature of about 50°C.
- Suitable organic amines include but a re not limited to triethylamine, N-methylmorpholine, collid ine, and the like.
- the compound of formula (XXI) may be provided in stereoisomerically pure form or a stereoisomerically enriched mixture by reacting stereoisomerically pure or a
- stereoisomerically pure compounds of formula (XXII) are readily commercially available, such as (4fi)- or (4S)-(2,2-dimethyl-l,3-dioxa n-4-yl)-methanol.
- a compound of formula (XXII-B), wherein Pg is a suitable hydroxyl protecting group may be reacted with a compound of the formula (XXII-Cl) to provide the aceta l of formula (XXII-D), which may then be converted to the compound of formula (XXII) by removal of the protecting group Pg .
- the compound of formula (XXII-B) may be reacted with an acyclic acetal of the formula (XXII-C2), wherein Ro a nd Rp a re each independently Cl-4alkyl.
- the acetylisation reaction may be carried out using an acid, such as camphorsulfonic acid, in a suitable solvent, such as dichloromethane.
- a silyl ether protecting group such as TBDMS
- TBDMS tetrabutylammonium fluoride
- suitable solvent such as THF
- compounds of formula (XXI) may be prepared from compounds of formula (XXII) by reaction with a suitable precursor of the leaving group.
- a suitable precursor of the leaving group For example, tosylate or mesylate leaving groups may be prepared by reaction with tosyl chloride or mesyl chloride in the presence of a base and a suitable solvent, and an iodo leaving group may be prepared by reaction with PPh3 and I2.
- the compound of formula (XX) may subseq uently be converted by one or more synthetic steps to a compound of the formula (I) as defined in either method (A) or (B), for example a compound of the formula (IA).
- the one or more synthetic steps may comprise removing the acetal to provide a d iol of the formula (XXIII-1).
- the hydroxyl group bound to the carbon to which Rl and R2 are attached in the compound of formula (XXIII-1) may be converted to L1-Z1-, and/or the hydroxyl group bound to the carbon to which Rx and Ry a re attached may be converted to L2-Z2.
- the aceta l in the compound of formula (XX) may be removed to provide the diol of formula (XXIII-1) by treatment with an acid such as p- toluene sulfonic acid in a solvent such as dichlorometha ne.
- the diol of formula (XXIII-1) may be converted to the bis-ester compound of formula (IA) via one or more acylation steps in a manner analogous to that described for the conversion of the compound of formula (XV-la) to the compound of formula (IF-1).
- the one or more synthetic steps may comprise removing the acetal to provide a compound of the formula (XXIII-2) or (XXIII- 3).
- the one or more steps may comprise converting the hydroxyl group bound to the carbon atom to which Rx and Ry are attached in the compound of formula (XXIII-2) to L2-Z2-, removing the RmRnCH- group to provide a hyd roxyl group, and converting the hydroxyl group to Ll-Zl ; or converting the hydroxyl group bound to the cabon to which Rx and Ry a re attached in the compound of formula (XXIII-2) to L1-Z1-, removing the RmRnCH- group to provide a hyd roxyl group, and converting the hydroxyl group to L2- Z2-.
- Such methods advantageously allows a llow the introduction of d ifferent Ll-Zl and L2-Z2- groups.
- the acetal in the compound of formula (XX) may be removed by, for example, treatment with a suitable reducing agent, for example
- the resulting compound of formula compound of formula (XXIII-2) may then be acylated with the compound of formula (VI) to introd uce the desired L2-C(0)0- group. Removal of the RmRnCH- group to provide the compound of formula (XXV-2) may be carried out by hydrogenolysis (e.g . for a benzyl or p- methoxybenzyl group) or any other suitable method having regard to the nature of RmRnCH- group.
- the compound of formula (XXV-2) may then be converted to the compound of formula (IA) by acylating with the compound of formula (IV-1).
- the acylation steps may be carried out as described herein with respect to the preparation of the compound of formula (IF-1).
- Hydroxyl groups produced on removal of the acetal or RmRnCH- group such as those in the compounds formulae (XXIII-1), (XXIII-2), (XXIII-3), and (XXV-2), may be converted to various other functional groups, such as thiols and amines, to provide access compounds of formula (I) bearing other Zl and Z2 groups.
- amide and thioester analogues of the bis-ester compound of formula (IA) may be prepared by methods analogous to those described above with respect to the amide and thioester analogues of the bis-ester compound of formula (IF- 1).
- the present invention also provides a method for preparing compounds of formula (I) of the invention via a thiol-ene reaction.
- the method comprises reacting a first lipid- containing conjugation partner comprising a carbon-carbon double bond, a second lipid- containing conjugation partner a carbon-carbon double bond, and an amino acid- comprising conjugation partner comprising a thiol, under conditions effective to conjugate the first and second lipid-conta ining conjugation partners to the amino acid- comprising conjugation partner.
- Each lipid containing conj ugation pa rtner comprises and therefore in the reaction provides to the compound of formula (I) a lipid moiety one comprising LI, the other comprising L2.
- the thiol-ene reaction involves the addition of a thiol across a non-aromatic carbon- carbon double bond (i.e. hydrothiolation of the carbon-carbon double bond).
- the reaction proceeds via a free radical mechanism.
- There are three distinct phases in the reaction initiation, coupling, a nd termination.
- radical generation gives rise to an electrophilic thiyl radical which propagates across the ene group of an a lkene, forming a carbon-centred radical and chain tra nsfer from an additional thiol molecule quenches the radica l on carbon to give the fina l prod uct.
- the inventors believe that in the method of the present invention, the thiol is conjugated to a carbon atom of the carbon-carbon double bond of the first lipid conta ining conjugation partner to form a carbon-centred radical, and that this carbon-centred radical, instead of being quenched, is then conjugated with a carbon atom of the ca rbon-carbon double bond of the second lipid-conta ining conjugation partner.
- the method thus provides amino acid- and peptide conj ugates in which the sulfur atom from the thiol is conjugated to a carbon atom from the carbon-carbon double bond of the first lipid-containing conj ugation partner, and a carbon atom from the carbon-carbon double bond of the first lipid-containing conj ugation partner is conjugated to a carbon atom from the carbon-carbon double bond of the second lipid-containing conjugation partner.
- method (A) conj ugation of the first and second lipid- containing conjugation partners to the amino acid-comprising conj ugation pa rtner provides the peptide conjugate of the formula (I) of the invention .
- the amino acid-comprising conjugation pa rtner may comprise a peptide that corresponds the peptide present in the peptide conj ugate of the formula (I) of the invention produced by the method .
- conjugation of the first and second lipid-containing conj ugation partners to the amino acid-comprising conj ugation partner provides an amino acid- or peptide-conj ugate (of the formula (I) but excluding provisos (1) and (2) of the first aspect); a nd the method further comprises coupling the amino acid- or peptide-conj ugate to an amino acid or peptide to provide the peptide conjugate of formula (I) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conjugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (I) of the invention produced by the method.
- the first and second lipid containing conjugation partners may be the same or different. Those skilled in the art will appreciate that reacting different lipid containing conj ugation partners at the same time may provide a mixture of (potentially up to four different) conjugates. Accordingly, in certa in exemplary embodiments, the first and second lipid containing conjugation partners are the same.
- the thiolene reaction may be regioselective with respect to which carbon atom of the carbon-carbon double bond of the first lipid-containing conj ugation partner is conj ugated to the thiol a nd also with respect to which carbon atom of the carbon-carbon double bond of the second lipid-containing conjugation pa rtner is conjugated to which carbon atom of the carbon-carbon double bond from the first lipid-conta ining conjugation pa rtner.
- Those skilled in the art will appreciate that various regioisomers may be formed in the reaction.
- the method comprises reacting a first lipid containing conjugation partner of the formula (IIA) and a second lipid containing conj ugation partner of the formula (IIB) with a thiol containing amino acid comprising conj ugation partner (III) under conditions effective to provide a compound of the formula (IB)
- Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n are as defined in the compound of formula (IB) of the present invention (including provisos (1) and/or (2) of the first aspect) ; and when the method is (B), Ra, Rb, Rc, LI, L2, Zl, Z2, Rl, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, Al, k, v, and n a re as defined in the compound of formula (IB) but excluding provisos (1) and (2) of the first aspect.
- the cond itions effective for formation of the compound of formula (IB) may vary.
- the conditions effective for formation of the compound of formula (IB) may comprise carrying out the reaction with a stoichiometric excess of lipid containing conjugation partner to thiol, such as a stoichiometric ratio of the lipid containing conjugation partners (IIA) and (IIB) (combined) to amino acid-comprising conjugation partner of at least 7 : 1, for example 8: 1, 9 : 1, 10 : 1, 20: 1, 30: 1, 40: 1, 50 : 1, 60: 1, or 70 : 1.
- the degree of conversion of the amino acid-comprising conjugation partner to the prod uct compound of formula (IB) may vary. Preferably, at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, or 70% of the amino acid-comprising conjugation partner is converted to the compound of formula (IB) . Conversion may be determined by HPLC.
- reaction of the a lkene of formula (IA) with the thiol of formula (III) results in the formation of a carbon-centred radical of the formula (X), which is trapped with the second alkene of the formula (IIB), rather than quenched by abstraction of a proton from the thiol of another molecule of the formula (III), to provide the desired amino acid- or peptide conj ugate.
- the reaction may result in the production of a mixture of stereoisomers as it may not be possible to control or influence the stereochemistry of bond formation between the carbon atom to which R3 is bound and the carbon atom to which Rb and Rc are bound owing to the radica l intermediate generated in the course of the reaction.
- the reaction typically produces a mixture of epimers with respect to the carbon atom to which R3 is bound.
- the Zl and Z2 in the lipid conta ining-conj ugation partners are each -C(0)0-, a nd the compound of formula (I) formed in the thiolene method is a compound of formula (IC) as defined herein.
- the thiolene method of the present invention comprises reacting a n amino acid-comprising conj ugation partner comprising a structure of the formula (III) with lipid containing-conjugation partners of the formula (IIA) and (IIB) that are vinyl esters to provide a compound of the formula (ID).
- the reaction may be carried out, for example as described herein, by irradiating a reaction mixture comprising the amino acid comprising conjugation partner; lipid containing-conjugation pa rtners; a photochemical initiator, such as DMPA.
- One or more add itives may be included that reduce the formation of by products, such as a sterically hindered thiol (for example tert- butylmercaptan), an acid (for example TFA), or an organosilane (for example
- reaction may be carried out in a suitable solvent, such as NM P, at ambient temperature for a suitable period of time, such as 30 minutes.
- a suitable solvent such as NM P
- the reaction is typically initiated by the generation of one or more free radicals in the reaction mixture.
- One or more free radicals may be generated in the method by any method known in the art.
- the free rad icals may be generated thermally and/or photochemically.
- One or more free radical initiators may be used to initiate the generation of free radicals. Suitable free radical initiators include thermal initiators and photoinitiators.
- Free radicals are generated from thermal initiators by heating .
- the rate of degradation of the thermal initiator and resulting free radical formation depends on the initiator a nd the temperature at which the initiator is heated . Higher temperatures genera lly result in faster decomposition. A person skilled in the art will be able to select an appropriate temperature for heating the initiator without undue experimentation.
- thermal initiators are commercia lly available.
- thermal initiators include but a re not limited to terf-amyl peroxybenzoate, 1, 1'- azobis(cyclohexanecarbonitrile), 2,2'-azobisisobutyronitrile (AIBN), benzoyl peroxide, tert-butyl hydroperoxide, tert-butyl peracetate, tert-butyl peroxide, tert-butyl peroxybenzoate, tert-butylperoxy isopropyl carbonate, lauroyl peroxide, peracetic acid, and potassium persulfate.
- terf-amyl peroxybenzoate 1, 1'- azobis(cyclohexanecarbonitrile), 2,2'-azobisisobutyronitrile (AIBN)
- benzoyl peroxide tert-butyl hydroperoxide, tert-butyl peracetate, tert-butyl
- Free radicals may be generated from photoinitiators by irrad iation with lig ht.
- the frequency of light necessary to induce degradation of the photoinitiators and free rad ical formation depends on the initiator.
- Many photoinitiators can be initiated with ultraviolet light.
- Light of a specific wavelength or wavelength ra nge may be used to selectively irrad iate the initiator, where the lipid-conta ining conjugation partners or amino acid-comprising conjugation partner, for example a peptide-containing conj ugation partner, comprises photosensitive groups.
- a freq uency of about 365 nm is used . Light of this frequency is generally compatible with the side chains of natura lly occurring amino acids.
- photoinitiators include but a re not limited to acetophenone, anisoin, anthraquinone, anthraquinone-2- sulfonic acid, benzil, benzoin, benzoin ethyl ether, benzoin isobutyl ether, benzoin methyl ether, benzophenone, 3,3',4,4'-benzophenonetetracarboxylic d ianhydride, 4- benzoylbiphenyl, 2-benzyl-2-(d imethylamino)-4'-morpholinobutyrophenone, 4'- bis(diethylamino)benzophenone, 4,4'-bis(dimethylamino)benzophenone,
- camphorquinone 2-chlorothioxanthen-9-one, dibenzosuberenone, 2,2- diethoxyacetophenone, 4,4'-dihyd roxybenzophenone, 2,2-d imethoxy-2- phenylacetophenone (DMPA), 4-(dimethylamino)benzophenone, 4,4'-dimethylbenzil, 2,5- dimethylbenzophenone, 3,4-dimethylbenzophenone, 4'-ethoxyacetophenone, 2- ethylanthraquinone, 3'-hydroxyacetophenone, 4'-hydroxyacetophenone, 3- hydroxybenzophenone, 4-hydroxybenzophenone, 1-hydroxycyclohexyl phenyl ketone, 2- hydroxy-2-methylpropiophenone, 2-methylbenzophenone, 3-methyl benzophenone, methybenzoylformate, 2-methyl-4'-(methylthio)-2-morpholinopropiophenone, phenanthrenequino
- the initiator is present in the reaction in a stoichiometric ratio relative to the starting material comprising the thiol of from about 20: 1 to about 0.05: 1, from about 10 : 1 to about 0.05 : 1, from about 5 : 1 to about 0.05: 1, from about 3: 1 to about 0.5: 1.
- the lipid-conta ining conjugation partners a nd amino acid-comprising conjugation partner may be prepared using known synthetic chemistry techniq ues (for example, the methods generally described in Louis F Fieser and Mary F, Reagents for Organic Synthesis v. 1-19, Wiley, New York (1967-1999 ed. ) or Beilsteins Handbuch der organischen Chemie, 4, Aufl. Ed. Springer-Verlag Berlin, including supplements (also ava ilable via the Beilstein online database)) or, in some embodiments, may be commercially ava ilable.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Analytical Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Medicinal Preparation (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020207009057A KR20200058424A (ko) | 2017-08-30 | 2018-08-30 | 펩티드 접합체, 접합 방법, 및 그의 용도 |
| CA3073314A CA3073314A1 (en) | 2017-08-30 | 2018-08-30 | Peptide conjugates, conjugation process, and uses thereof |
| AU2018323043A AU2018323043A1 (en) | 2017-08-30 | 2018-08-30 | Peptide conjugates, conjugation process, and uses thereof |
| EP18850403.9A EP3676250A4 (en) | 2017-08-30 | 2018-08-30 | PEPTIDE CONJUGATES, CONJUGATION METHODS AND USES THEREOF |
| BR112020003907-1A BR112020003907A2 (pt) | 2017-08-30 | 2018-08-30 | conjugados de peptídeos, processo de conjugação e usos do mesmo |
| US16/638,185 US20200361864A1 (en) | 2017-08-30 | 2018-08-30 | Peptide Conjugates, Conjugation Process, and Uses Thereof |
| JP2020512441A JP2020532534A (ja) | 2017-08-30 | 2018-08-30 | ペプチド接合体、接合プロセス及びそれらの使用 |
| SG11202001602QA SG11202001602QA (en) | 2017-08-30 | 2018-08-30 | Peptide conjugates, conjugation process, and uses thereof |
| EA202090319A EA202090319A1 (ru) | 2017-08-30 | 2018-08-30 | Пептидные конъюгаты, способ конъюгации и их использование |
| CN201880055703.0A CN111247123A (zh) | 2017-08-30 | 2018-08-30 | 肽共轭物、共轭过程及其用途 |
| MX2020002084A MX2020002084A (es) | 2017-08-30 | 2018-08-30 | Conjugados de peptido, proceso de conjugacion y usos de los mismos. |
| IL272931A IL272931A (en) | 2017-08-30 | 2020-02-26 | Peptide conjugates, conjugation process and their uses |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ73500817 | 2017-08-30 | ||
| NZ735008 | 2017-08-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019043604A1 true WO2019043604A1 (en) | 2019-03-07 |
Family
ID=65526296
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2018/056611 Ceased WO2019043604A1 (en) | 2017-08-30 | 2018-08-30 | PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US20200361864A1 (https=) |
| EP (1) | EP3676250A4 (https=) |
| JP (1) | JP2020532534A (https=) |
| KR (1) | KR20200058424A (https=) |
| CN (1) | CN111247123A (https=) |
| AU (1) | AU2018323043A1 (https=) |
| BR (1) | BR112020003907A2 (https=) |
| CA (1) | CA3073314A1 (https=) |
| EA (1) | EA202090319A1 (https=) |
| IL (1) | IL272931A (https=) |
| MX (1) | MX2020002084A (https=) |
| SG (1) | SG11202001602QA (https=) |
| TW (1) | TW201925240A (https=) |
| WO (1) | WO2019043604A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110681362A (zh) * | 2019-09-26 | 2020-01-14 | 浙江大学 | 以羧基和吲哚基为功能基团的混合模式层析介质 |
| WO2020257870A1 (en) * | 2019-06-26 | 2020-12-30 | Ena Therapeutics Pty Ltd | Novel molecules |
| WO2023028661A1 (en) * | 2021-09-02 | 2023-03-09 | Ena Respiratory Pty Ltd | Formulation |
| JP2023531387A (ja) * | 2020-06-26 | 2023-07-24 | イーナ レスパラトリー ピーティーワイ リミテッド | 分岐脂質化合物 |
| US12195557B2 (en) | 2017-12-21 | 2025-01-14 | Axelia Oncology Pty Ltd | Optimised compounds |
| US12569431B2 (en) | 2010-09-22 | 2026-03-10 | Ena Respiratory Pty Ltd | Immunostimulatory method |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111349054A (zh) * | 2020-01-21 | 2020-06-30 | 青岛科技大学 | 一种防锈剂2-(1,3-苯并噻唑-2-硫基)丁二酸的制备方法 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001036453A2 (en) * | 1999-11-15 | 2001-05-25 | Ludwig Institute For Cancer Research | Ny-eso-1 nanopeptide derivatives, and uses thereof |
| WO2010028246A2 (en) * | 2008-09-05 | 2010-03-11 | Id Biomedical Corporation Of Quebec | Novel compositions and adjuvants |
| WO2014207708A2 (en) * | 2013-06-28 | 2014-12-31 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| WO2017145097A2 (en) * | 2016-02-26 | 2017-08-31 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2012523379A (ja) * | 2009-04-09 | 2012-10-04 | ザ ユニバーシティー オブ メルボルン | 免疫原性組成物およびその使用 |
-
2018
- 2018-08-30 EP EP18850403.9A patent/EP3676250A4/en not_active Withdrawn
- 2018-08-30 MX MX2020002084A patent/MX2020002084A/es unknown
- 2018-08-30 WO PCT/IB2018/056611 patent/WO2019043604A1/en not_active Ceased
- 2018-08-30 SG SG11202001602QA patent/SG11202001602QA/en unknown
- 2018-08-30 BR BR112020003907-1A patent/BR112020003907A2/pt not_active Application Discontinuation
- 2018-08-30 US US16/638,185 patent/US20200361864A1/en not_active Abandoned
- 2018-08-30 CA CA3073314A patent/CA3073314A1/en active Pending
- 2018-08-30 TW TW107130372A patent/TW201925240A/zh unknown
- 2018-08-30 JP JP2020512441A patent/JP2020532534A/ja active Pending
- 2018-08-30 AU AU2018323043A patent/AU2018323043A1/en not_active Abandoned
- 2018-08-30 CN CN201880055703.0A patent/CN111247123A/zh active Pending
- 2018-08-30 EA EA202090319A patent/EA202090319A1/ru unknown
- 2018-08-30 KR KR1020207009057A patent/KR20200058424A/ko not_active Withdrawn
-
2020
- 2020-02-26 IL IL272931A patent/IL272931A/en unknown
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001036453A2 (en) * | 1999-11-15 | 2001-05-25 | Ludwig Institute For Cancer Research | Ny-eso-1 nanopeptide derivatives, and uses thereof |
| WO2010028246A2 (en) * | 2008-09-05 | 2010-03-11 | Id Biomedical Corporation Of Quebec | Novel compositions and adjuvants |
| WO2014207708A2 (en) * | 2013-06-28 | 2014-12-31 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| WO2017145097A2 (en) * | 2016-02-26 | 2017-08-31 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
Non-Patent Citations (3)
| Title |
|---|
| GEETANJALI AGNIHOTRI, BREANNA M. CRALL, TYLER C. LEWIS, TIMOTHY P. DAY, RAJALAKSHMI BALAKRISHNA, HEMAMALI J. WARSHAKOON, SUBBALAKS: "Structure–Activity Relationships in Toll-Like Receptor 2-Agonists Leading to Simplified Monoacyl Lipopeptides", JOURNAL OF MEDICINAL CHEMISTRY, vol. 54, no. 23, 8 October 2011 (2011-10-08), pages 8148 - 8160, XP055668308, ISSN: 0022-8160, DOI: 10.1021/jm201071e * |
| See also references of EP3676250A4 * |
| YANG, S.H. ET AL.: "Lipidation of Cysteine or Cysteine-Containing Peptides Usingthe Thiol-Ene Reaction (CLipPA)", EUROPEAN JOURNAL OF ORGANIC CHEMISTRY, vol. 2016, no. 15, 29 March 2016 (2016-03-29), pages 2608 - 2616, XP055426738, ISSN: 1434-193X, DOI: 10.1002/ejoc.201501375 * |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12569431B2 (en) | 2010-09-22 | 2026-03-10 | Ena Respiratory Pty Ltd | Immunostimulatory method |
| US12195557B2 (en) | 2017-12-21 | 2025-01-14 | Axelia Oncology Pty Ltd | Optimised compounds |
| US12017979B2 (en) | 2019-06-26 | 2024-06-25 | Ena Respiratory Pty Ltd | Molecules |
| JP2022539091A (ja) * | 2019-06-26 | 2022-09-07 | アクセリア オンコロジー ピーティーワイ リミテッド | 新規な分子 |
| CN114174260A (zh) * | 2019-06-26 | 2022-03-11 | 阿克塞利阿肿瘤学私人有限公司 | 新型分子 |
| AU2020302839B2 (en) * | 2019-06-26 | 2025-08-14 | Ena Respiratory Pty Ltd | Novel molecules |
| CN114174260B (zh) * | 2019-06-26 | 2025-09-05 | 艾娜呼吸私人有限公司 | 新型分子 |
| IL289266B1 (en) * | 2019-06-26 | 2026-03-01 | Axelia Oncology Pty Ltd | New molecules |
| WO2020257870A1 (en) * | 2019-06-26 | 2020-12-30 | Ena Therapeutics Pty Ltd | Novel molecules |
| CN110681362A (zh) * | 2019-09-26 | 2020-01-14 | 浙江大学 | 以羧基和吲哚基为功能基团的混合模式层析介质 |
| JP2023531387A (ja) * | 2020-06-26 | 2023-07-24 | イーナ レスパラトリー ピーティーワイ リミテッド | 分岐脂質化合物 |
| JP7744936B2 (ja) | 2020-06-26 | 2025-09-26 | イーナ レスパラトリー ピーティーワイ リミテッド | 分岐脂質化合物 |
| WO2023028661A1 (en) * | 2021-09-02 | 2023-03-09 | Ena Respiratory Pty Ltd | Formulation |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3676250A1 (en) | 2020-07-08 |
| IL272931A (en) | 2020-04-30 |
| CA3073314A1 (en) | 2019-03-07 |
| KR20200058424A (ko) | 2020-05-27 |
| MX2020002084A (es) | 2020-03-24 |
| JP2020532534A (ja) | 2020-11-12 |
| EP3676250A4 (en) | 2021-05-26 |
| CN111247123A (zh) | 2020-06-05 |
| SG11202001602QA (en) | 2020-03-30 |
| TW201925240A (zh) | 2019-07-01 |
| US20200361864A1 (en) | 2020-11-19 |
| AU2018323043A1 (en) | 2020-03-05 |
| EA202090319A1 (ru) | 2020-10-16 |
| BR112020003907A2 (pt) | 2020-09-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11464853B2 (en) | Amino acid and peptide conjugates and conjugation process | |
| WO2019043604A1 (en) | PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF | |
| US20200306370A1 (en) | Amino acid and peptide conjugates and conjugation process | |
| US11014960B2 (en) | Amino acid and peptide conjugates and uses thereof | |
| HK40013754A (en) | Peptides for amino acid and peptide conjugates and conjugation process | |
| HK1224279B (en) | Amino acid and peptide conjugates and conjugation process |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18850403 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3073314 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020512441 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018323043 Country of ref document: AU Date of ref document: 20180830 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020003907 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20207009057 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018850403 Country of ref document: EP Effective date: 20200330 |
|
| ENP | Entry into the national phase |
Ref document number: 112020003907 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200227 |