US20200361864A1 - Peptide Conjugates, Conjugation Process, and Uses Thereof - Google Patents
Peptide Conjugates, Conjugation Process, and Uses Thereof Download PDFInfo
- Publication number
- US20200361864A1 US20200361864A1 US16/638,185 US201816638185A US2020361864A1 US 20200361864 A1 US20200361864 A1 US 20200361864A1 US 201816638185 A US201816638185 A US 201816638185A US 2020361864 A1 US2020361864 A1 US 2020361864A1
- Authority
- US
- United States
- Prior art keywords
- amino acid
- compound
- peptide
- formula
- xaa
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 0 [1*]C([2*])(CC)C([3*])(C(C)(C)CC)C([4*])([5*])SC([6*])([7*])C(COC)N([8*])[9*] Chemical compound [1*]C([2*])(CC)C([3*])(C(C)(C)CC)C([4*])([5*])SC([6*])([7*])C(COC)N([8*])[9*] 0.000 description 115
- NXWFSPUGCZDKNU-AMAPPZPBSA-N *.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC NXWFSPUGCZDKNU-AMAPPZPBSA-N 0.000 description 3
- HWMHEUZQEVQSAL-ZFESHMOZSA-N *.CCCCCCCCCCCCCCCC(=O)OCCCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OCCCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC HWMHEUZQEVQSAL-ZFESHMOZSA-N 0.000 description 2
- UOGSJCYCQCWFGX-PVXQIPPMSA-N *.CCCCCCCCCCCCCCCC(=O)OCCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OCCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC UOGSJCYCQCWFGX-PVXQIPPMSA-N 0.000 description 2
- TZUOAHJJHVUPPS-RGULYWFUSA-N *.CCCCCCCCCCCCCCCC(=O)OCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OCCC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC TZUOAHJJHVUPPS-RGULYWFUSA-N 0.000 description 2
- WJVZELZMSUYTDX-PVXQIPPMSA-N *.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC WJVZELZMSUYTDX-PVXQIPPMSA-N 0.000 description 2
- QITVDQDCVOMCSY-AARKOHAPSA-N *.CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC QITVDQDCVOMCSY-AARKOHAPSA-N 0.000 description 2
- ALBDNCQJRRKRGS-VRJWYGQHSA-N CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S Chemical compound CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S ALBDNCQJRRKRGS-VRJWYGQHSA-N 0.000 description 2
- YAHHECNSEYZNGH-OFUZFLEOSA-N CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S Chemical compound CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S YAHHECNSEYZNGH-OFUZFLEOSA-N 0.000 description 2
- WCSQYSVYIFZKGI-CECLPTFUSA-N *.CCCCCCCCCCCCCCCC(=O)N[C@@H](CSC[C@@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(C)=O Chemical compound *.CCCCCCCCCCCCCCCC(=O)N[C@@H](CSC[C@@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(C)=O WCSQYSVYIFZKGI-CECLPTFUSA-N 0.000 description 1
- QPSWRXZODYCSNM-RGULYWFUSA-N *.CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC Chemical compound *.CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC QPSWRXZODYCSNM-RGULYWFUSA-N 0.000 description 1
- PXYGPWWLYXUQKP-UHFFFAOYSA-N C#CCCCC.C#CCCCO Chemical compound C#CCCCC.C#CCCCO PXYGPWWLYXUQKP-UHFFFAOYSA-N 0.000 description 1
- XAVSEJRPXJTTSJ-UHFFFAOYSA-N C#CCCCC.CCCCC=C(C)C Chemical compound C#CCCCC.CCCCC=C(C)C XAVSEJRPXJTTSJ-UHFFFAOYSA-N 0.000 description 1
- NFGUXSRQGKOTLE-UHFFFAOYSA-N C#CCCCCCC.C#CCCCCCO Chemical compound C#CCCCCCC.C#CCCCCCO NFGUXSRQGKOTLE-UHFFFAOYSA-N 0.000 description 1
- WHRCWZCVFDZRDI-UHFFFAOYSA-N C#CCCCCCC.CCCCCCC=C(C)C Chemical compound C#CCCCCCC.CCCCCCC=C(C)C WHRCWZCVFDZRDI-UHFFFAOYSA-N 0.000 description 1
- AKGYJPINMPZYBQ-UHFFFAOYSA-N C=CCCCC.CCCCC1CO1 Chemical compound C=CCCCC.CCCCC1CO1 AKGYJPINMPZYBQ-UHFFFAOYSA-N 0.000 description 1
- UDOSOZKSJZDLDB-UHFFFAOYSA-N C=CCCCCC.CCCCCC1CO1 Chemical compound C=CCCCCC.CCCCCC1CO1 UDOSOZKSJZDLDB-UHFFFAOYSA-N 0.000 description 1
- VKULUKCIWJQDRW-UHFFFAOYSA-N C=CCCCCCC.CCCCCCC1CO1 Chemical compound C=CCCCCCC.CCCCCCC1CO1 VKULUKCIWJQDRW-UHFFFAOYSA-N 0.000 description 1
- DCFQQXDJGHSOAZ-UHFFFAOYSA-N C=CCCCCCC.CCCCCCC=O Chemical compound C=CCCCCCC.CCCCCCC=O DCFQQXDJGHSOAZ-UHFFFAOYSA-N 0.000 description 1
- BUKXBPXGKMKYMV-UHFFFAOYSA-N C=CCCCCO.CCCCCC=C(C)C Chemical compound C=CCCCCO.CCCCCC=C(C)C BUKXBPXGKMKYMV-UHFFFAOYSA-N 0.000 description 1
- XJEWZSQABYHDJW-ZUYRYPHNSA-N CC(C)(C)OC(=O)[C@H](CSC[C@@H](O)CCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C.OCC[C@H]1CO1 Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@@H](O)CCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCC(=O)OCC[C@@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C.OCC[C@H]1CO1 XJEWZSQABYHDJW-ZUYRYPHNSA-N 0.000 description 1
- HYWQEOLEMYVKAO-QBKSSVGHSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC HYWQEOLEMYVKAO-QBKSSVGHSA-N 0.000 description 1
- GBESYMVTIFILHZ-XFKOCESPSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C GBESYMVTIFILHZ-XFKOCESPSA-N 0.000 description 1
- FKWFUMXCQHFRDX-HNVPFTRRSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC FKWFUMXCQHFRDX-HNVPFTRRSA-N 0.000 description 1
- KWCRXSHLQAKFDQ-HIRIPBJCSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C KWCRXSHLQAKFDQ-HIRIPBJCSA-N 0.000 description 1
- IIQGYVICQNNHRD-IAHPVQLNSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC IIQGYVICQNNHRD-IAHPVQLNSA-N 0.000 description 1
- MYQXKJKGVBRTJS-FRWQBDPYSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCC[C@@H]1CO1.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C MYQXKJKGVBRTJS-FRWQBDPYSA-N 0.000 description 1
- XJEWZSQABYHDJW-WCVFNZQTSA-N CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C.OCC[C@@H]1CO1 Chemical compound CC(C)(C)OC(=O)[C@H](CSC[C@H](O)CCO)NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O)OC(=O)CCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCC(=O)OCC[C@H](CSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)OC(=O)CCCCCCCCCCCCCCC.C[C@@H](CSSC[C@H](NC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C.OCC[C@@H]1CO1 XJEWZSQABYHDJW-WCVFNZQTSA-N 0.000 description 1
- WWJMHGBYKCDSLQ-UHFFFAOYSA-N CCC(=O)CCOC1=CC=C(COC(C)=O)C=C1.CN Chemical compound CCC(=O)CCOC1=CC=C(COC(C)=O)C=C1.CN WWJMHGBYKCDSLQ-UHFFFAOYSA-N 0.000 description 1
- NZUSKBJAPAMCEW-FYZOBXCZSA-N CCCCC1CO1.CCCC[C@@H]1CO1 Chemical compound CCCCC1CO1.CCCC[C@@H]1CO1 NZUSKBJAPAMCEW-FYZOBXCZSA-N 0.000 description 1
- JURBGJJQIHLCKQ-OGFXRTJISA-N CCCCCC1CO1.CCCCC[C@@H]1CO1 Chemical compound CCCCCC1CO1.CCCCC[C@@H]1CO1 JURBGJJQIHLCKQ-OGFXRTJISA-N 0.000 description 1
- NELQEHVHPJKZSS-DDWIOCJRSA-N CCCCCCC1CO1.CCCCCC[C@@H]1CO1 Chemical compound CCCCCCC1CO1.CCCCCC[C@@H]1CO1 NELQEHVHPJKZSS-DDWIOCJRSA-N 0.000 description 1
- IYRNGDHWTXJXJJ-UHFFFAOYSA-N CCCCCCC=O.CCCCCCCO Chemical compound CCCCCCC=O.CCCCCCCO IYRNGDHWTXJXJJ-UHFFFAOYSA-N 0.000 description 1
- CFPQKFCCIGIMEP-DHNOXFOTSA-N CCCCCCCCCCCCCCCC(=O)N[C@@H](CSC[C@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(C)=O.S Chemical compound CCCCCCCCCCCCCCCC(=O)N[C@@H](CSC[C@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(C)=O.S CFPQKFCCIGIMEP-DHNOXFOTSA-N 0.000 description 1
- OQRVYGUYBFBVRQ-GVGVJZOBSA-N CCCCCCCCCCCCCCCC(=O)OC[C@@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](CSC[C@H](N)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S OQRVYGUYBFBVRQ-GVGVJZOBSA-N 0.000 description 1
- COPFZHNLYGNCEY-JBMWTVJCSA-N CCCCCCCCCCCCCCCC(=O)OC[C@@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](CSC[C@H](NC(C)=O)C(C)=O)OC(=O)CCCCCCCCCCCCCCC.S COPFZHNLYGNCEY-JBMWTVJCSA-N 0.000 description 1
- DMWXGAOTUYVBCB-AMAPPZPBSA-N CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](N)C(=O)C(C)C)OC(=O)CCCCCCCCCCCCCCC Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](CSC[C@H](N)C(=O)C(C)C)OC(=O)CCCCCCCCCCCCCCC DMWXGAOTUYVBCB-AMAPPZPBSA-N 0.000 description 1
- DFWVATOPKKFVHM-UHFFFAOYSA-N CCCCCCCO.OCCCCCCO Chemical compound CCCCCCCO.OCCCCCCO DFWVATOPKKFVHM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/50—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton
- C07C323/51—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton
- C07C323/57—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups
- C07C323/58—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups with amino groups bound to the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/542—Carboxylic acids, e.g. a fatty acid or an amino acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/36—Extraction; Separation; Purification by a combination of two or more processes of different types
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6018—Lipids, e.g. in lipopeptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to peptide conjugates, methods for making peptide conjugates, conjugates produced by the methods, pharmaceutical compositions comprising the conjugates, methods of eliciting immune responses in a subject and methods of vaccinating a subject, uses of the conjugates for the same, and uses of the conjugates in the manufacture of medicaments for the same.
- the present invention also relates to methods of making compounds useful in the synthesis of peptide conjugates of the invention and to such compounds.
- Synthetic peptide vaccines generally comprise a synthetic copy of an immunogenic part of protein antigens. This approach to vaccine development has a number of advantages, including ease of synthesis, avoidance of potentially toxic biological by-products and straightforward characterisation.
- peptide vaccines A key issue in the development of peptide vaccines is the lack of immunogenicity displayed by peptides as sole vaccine components. It is usually necessary to include in the vaccine an adjuvant, designed to activate components of the innate immune system (e.g. Freund's adjuvant).
- an adjuvant designed to activate components of the innate immune system (e.g. Freund's adjuvant).
- An alternative strategy in peptide vaccine design is to create self-adjuvanting vaccines in which the peptide epitope of interest is covalently linked to an appropriate adjuvant.
- Such self-adjuvanting vaccines may have enhanced antigen uptake, presentation and dendritic cell maturation compared to simple co-formulation of the antigen with an external adjuvant.
- the present invention broadly consists in a peptide conjugate compound of the formula (I):
- the present invention broadly consists in a peptide conjugate compound of the formula (I):
- the present invention broadly consists in a peptide conjugate compound of the formula (I):
- Z1 and Z2 are each independently selected from the group consisting of —C(O)O—, —C(O)NR—, and —C(O)S—.
- the compound of the formula (I) is a compound of the formula (IA):
- v is from 0 to 4, 0 to 3, or 0 to 2, or v is 0 or 1, for example 0.
- v is from 0 to 3. In exemplary embodiments, v is 0.
- m and w are each independently from 0 to 6, 0 to 5, 0 to 4, 0 to 3, 0 to 2, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2.
- m and w are each independently from 0 to 5.
- m and w are each independently from 1 to 4.
- m is from 1 to 6, for example from 2 to 6, 1 to 5, or 2 to 5. In various embodiments, m is from 1 to 5. In various embodiments, m is from 1 to 3. In exemplary embodiments, m is 2.
- n is from 3 to 6. In certain embodiments, m is from 3 to 5.
- w is 1 or 2. In exemplary embodiments, w is 1.
- the sum of m and w is from 0 to 6, 0 to 5, 0 to 4, 0 to 3, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 2 to 7, 2 to 6, 2 to 5, 2 to 4, or 2 to 3.
- the sum of m and w is from 2 to 7.
- the sum of m and w is from 2 to 5.
- the sum of m and w is 3.
- v is from 0 to 3; m and w are each independently from 0 to 5;
- v is from 1 or 0; m and w are each independently from 0 to 5;
- n 1
- L1 and L2 are each independently C5-21aliphatic, for example C9-21aliphatic, C11-21aliphatic, or C11-, C13-, C15-, C17-, or C19-aliphatic.
- L1 and L2 are each independently C5-21alkyl.
- L1 and L2 are each independently C9-21alkyl. In yet another embodiment, L1 and L2 are each independently C11-21alkyl.
- L1 and L2 are each independently C11, C13, C15, C17, or C19alkyl, preferably n-alkyl.
- L1 and L2 are each independently C15alkyl.
- L1 and L2 each independently comprise a linear chain of 9-21 carbon atoms.
- L1 and L2 are each independently linear C15alkyl.
- L3 is C1-21alkyl.
- L3 is methyl or linear C15alkyl.
- L3 is methyl (that is, R9 is acetyl).
- the amino protecting group is Boc, Fmoc, Cbz (carboxybenzyl), Nosyl (o- or p-nitrophenylsulfonyl), Bpoc (2-(4-biphenyl)isopropoxycarbonyl) and Dde (1-(4,4-dimethyl-2,6-dioxohexylidene)ethyl).
- the amino protecting group is Boc or Fmoc.
- the amino protecting group is Fmoc.
- the carboxyl protecting group is tert-butyl, benzyl, or allyl.
- the carboxamide protecting group is Dmcp or Trityl.
- R1 and R2 at each instance of m are each independently C1-6alkyl or hydrogen. In various specifically contemplated embodiments, R1 and R2 at each instance of m are each hydrogen.
- R3 is C1-6alkyl or hydrogen. In various specifically contemplated embodiments, R3 is hydrogen.
- R4 and R5 at each instance of w are each independently C1-6alkyl or hydrogen, preferably hydrogen. In various specifically contemplated embodiments, R4 and R5 at each instance of w are each hydrogen.
- Rx and Ry at each instance of v are each independently C1-6alkyl or hydrogen. In various specifically contemplated embodiments, Rx and Ry at each instance of v are each hydrogen.
- R6 and R7 at each instance of n are each independently C1-6alkyl or hydrogen. In various specifically contemplated embodiments, R6 and R7 are each hydrogen.
- R8 is independently C1-6alkyl or hydrogen. In exemplary embodiments, R8 is hydrogen.
- R9 is C1-6alkyl, hydrogen, an amino protecting group, L3-C(O), or A2. In exemplary embodiments, R9 is hydrogen, an amino protecting group,
- R8 is hydrogen and R9 is hydrogen, an amino protecting group, L3-C(O), or A2.
- R8 and R9 are each hydrogen; or R9 is L3-C(O) or A2.
- R8 is hydrogen and R9 is L3-C(O). In various specifically contemplated embodiments, R9 is L3-C(O), wherein L3 is methyl.
- the compound of formula (I) is a compound of the formula (IF):
- the compound of formula (IF) is a compound of the formula (IF-1):
- the compound of formula (I) is a compound of the formula (IB):
- the compound of formula (IB) is a compound of the formula (IC):
- k is from 0 to 3, 0 to 2, 0 to 1, 1 to 4, 1 to 3, or 1 to 2, or k is 0 or 1.
- k is 0 to 3.
- k is 0 or 1.
- k 0.
- k is equal to v.
- k is from 1 to 3.
- Ra, Rb, and Rc are each independently hydrogen, C1-6alkyl, C2-6alkenyl, C2-6alkynyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently hydrogen, C1-6alkyl, C2-6alkenyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl.
- Ra, Rb, and Rc are each independently selected from hydrogen or C1-6alkyl, preferably hydrogen. In exemplary embodiments, Ra, Rb, and Rc are each hydrogen.
- the compound of formula (I) is a compound of the formula (ID-1):
- m in the compound of formula (ID-1) is from 3 to 5.
- the compound of the formula (I) is a compound of the formula (ID):
- the compound is a compound of the formula (ID) wherein L1 and L2 are each linear C15alkyl.
- L1 and L2 are each independently C11-21alkyl; m is 2-5; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- L1 and L2 are each independently C11-21alkyl; m is 3-5; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- L1 and L2 are each independently C11-21alkyl; m is 2; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; and R4 and R5 are each hydrogen.
- n 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, L3-C(O), or A2.
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(O), wherein L3 is linear C15alkyl or methyl.
- L1 and L2 are each independently C11-21alkyl; m is 2-5; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(O), wherein L3 is linear C15alkyl or methyl.
- L1 and L2 are each independently C11-21alkyl; m is 3-5; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(O), wherein L3 is linear C15alkyl or methyl.
- L1 and L2 are each independently C11-21alkyl; m is 2; v is 0; w is 1; R1 and R2 at each instance are each hydrogen; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(O), wherein L3 is linear C15alkyl or methyl.
- the compound of formula (I) has the formula (IE):
- the compound of formula (I) has the formula (IEE):
- the compound of formula (I) has the formula (IE-1):
- the compound of formula (I) has the formula (IEE-1):
- the compound of formula (I) has the formula (IE-2):
- the compound of formula (I) has the formula (IEE-2):
- the compound of formula (I) has the formula (IEE-3):
- the compound of formula (I) has the formula (IEE-4):
- the amino acid of the amino acid- or peptide conjugate to which the lipid moieties are conjugated is a cysteine residue.
- the moieties L1-Z1- and L2-Z2- may be fatty acid groups, for example fatty acid esters.
- the moieties may be saturated or unsaturated fatty acid esters.
- the fatty acid is saturated.
- the fatty acid is a C4-22 fatty acid. In some embodiments, the fatty acid is a C6-22 fatty acid.
- the fatty acid is a C10-22 fatty acid. In certain specifically contemplated embodiments, the fatty acid is a C12-22 fatty acid. In various exemplary embodiments, the fatty acid is a C12, C14, C16, C18, or C20 fatty acid.
- the fatty acid is lauric acid, myristic acid, palmitic acid, stearic acid, arachic acid, palmitoleic acid, oleic acid, elaidic acid, linoleic acid, ⁇ -linolenic acid, and arachidonic acid.
- the fatty acid is lauric acid, myristic acid, palmitic acid, or stearic acid.
- the fatty acid is palmitic acid (and the moieties L1-Z1- and L2-Z2- are each palmitoyl groups).
- A1 is OH, OP1, NH2, or NHP2 or R9 is hydrogen, C1-6alkyl, C3-6cycloalkyl, an amino protecting group, or L3-C(O).
- A1 is OP1 or OH or R9 is hydrogen, an amino protecting group or
- R9 is hydrogen, an amino protecting group or L3-C(O). In some embodiments, R9 is hydrogen or L3-C(O).
- the compound of formula (I) is a peptide conjugate.
- At least one of A1 and R9 is a peptide comprising, consisting essentially of, or consisting of an amino acid sequence selected from the group consisting of those defined in proviso (1) of the first aspect.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of:
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of:
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of:
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of:
- Xaa 22 in each sequence is independently V, I, or L (that is, each Xaa 22 is independently V, I, or L).
- Xaa 22 in each sequence is V (that is, each Xaa 22 is V).
- m is from 3 to 7 and at least one of A1 and R9 is an amino acid or peptide as defined in proviso (2) of the first aspect. In some embodiments, at least one of A1 and R9 is a peptide. In various embodiments, A1 and/or A2 is an amino acid or a peptide. That is, in various embodiments, A1 is an amino acid or a peptide and/or R9 is an amino acid or a peptide.
- A1 and/or A2 is a peptide. That is, in various embodiments, A1 is a peptide and/or R9 is a peptide.
- A1 and/or A2 is a peptide comprising an epitope.
- A1 and/or A2 is a peptide comprising a peptide epitope.
- A1 and/or A2 is a peptide, wherein the peptide comprises a peptide epitope.
- A1 and/or A2 is a peptide substituted with an epitope.
- the epitope is bound to the peptide via a linker group.
- A1 is a peptide
- A1 is a peptide and R9 is not A2 (that is, R9 is not an amino acid or a peptide).
- A1 is a peptide and R9 is hydrogen or L3-C(O), for example Me-C(O).
- the peptide comprises an epitope.
- the epitope is a peptide epitope.
- the epitope is coupled or bound via a linker group.
- the amino acid of the peptide conjugate to which the lipid moieties are conjugated is an N-terminal amino acid residue.
- A1 is serine or a peptide comprising serine as the first N-terminal amino acid residue.
- A1 is a peptide comprising serine as the first N-terminal amino acid residue.
- the peptide conjugate comprises one or more solubilising groups.
- the solubilising group comprises an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
- the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain.
- the two or more hydrophilic amino acid residues are adjacent to the serine residue.
- A1 and/or A2 is a peptide comprising a solubilising group.
- A1 and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
- A1 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
- A1 is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain adjacent to the serine.
- the compound comprises a linker or one or more amino acids thereof.
- the peptide comprises a linker or one or more amino acids thereof.
- the peptide comprises a peptide epitope bound via a linker to the amino acid to which the lipid moieties are bound.
- the peptide comprises two or more epitopes.
- the peptide comprises a peptide antigen.
- the linker is an amino acid sequence from about 2 to 20, 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, or 2 to 8 amino acids in length.
- the compound of formula (I) comprises 3 or more, 4 or more, or 5 or more contiguous amino acids.
- the peptide conjugate is a lipopeptide.
- the compound of formula (I) is a self adjuvanting peptide.
- A1 and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- A1 and A2 are each independently a peptide comprising from about 8 to 60 amino acids.
- A1 and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- A1 and/or A2 are each independently a peptide comprising from about 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- A1 and/or A2 are each independently a peptide, wherein the peptide comprises 8 to 60 amino acids.
- A1 and/or A2 are each independently a peptide comprising or substituted with a peptide epitope, wherein the peptide epitope comprises from 8 to 60 amino acids.
- Suitable peptide epitopes include without limitation those described in WO 2016/103192 filed 22 Dec. 2015, the entirety of which is incorporated herein by reference.
- the peptide comprises, consists essentially of, or consists of one or more EBV LMP2 epitopes.
- the one or more EBV LMP2 epitopes are MHCI epitopes.
- the peptide comprises one or more EBV LMP2 epitopes selected from the group consisting of any one of SEQ ID NOs 84-109.
- the peptide comprises a peptide comprising or consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83. In various embodiments, the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83, or comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide comprises a recombinant peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the recombinant peptide comprises or consists of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83, or comprises or consists of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs 9-83.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of
- Xaa 1 Xaa 2 Xaa 3 Xaa 4 LMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA [SEQ ID NO:34], wherein Xaa 1 is absent or is S or a hydrophilic amino acid, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids,
- the peptide comprises one or more epitopes derived from Latent Membrane Protein 2 (LMP2), for example, from full-length EBV LMP2 (amino acids 1-497).
- LMP2 Latent Membrane Protein 2
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 12 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 15 or more, 18 or more, 20 or more, or 25 or more contiguous amino acid residues from any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 12, 13, 17, 18, 22, 23, 27, 28, 32, 33, 37, 38, 42, 43, 47, 48, 52, 53, 57, 58, 62, 63, 67, 68, 72, 73, 77, 78, 82, or 83.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 15 or more, 18 or more, 20 or more, or 25 or more contiguous amino acid residues from any one of SEQ ID NOs: 9 to 83.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 9 to 83.
- the peptide comprises an amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 84 to 109. In one example, the peptide comprises an amino acid sequence selected from the group consisting of any one of SEQ
- the peptide comprises an amino acid sequence selected from the group consisting of any two or more of SEQ ID NOs: 84 to 109. In one example, the peptide comprises an amino acid sequence selected from the group consisting of any two or more of SEQ ID NOs: 84 to 101.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of
- the peptide epitope is derived from NY-ESO-1.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 114, 121, and 127.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 113, 120, and 126.
- the peptide comprises, consists essentially of, or consists of one or more ovalbumin protein epitopes.
- the one or more ovalbumin protein are MHCI epitopes.
- the one or more ovalbumin protein are MHCII epitopes.
- the peptide comprises, consists essentially of, or consists of:
- the peptide comprises one or more ovalbumin protein epitopes selected from the group consisting of any one of SEQ ID NOs 130-136. In various embodiments, the peptide comprises a peptide comprising or consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 130-136.
- the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs 130-136.
- the peptide comprises one or more immunodominant A*0200 restricted epitopes derived from the cytomeglovirus (CMV) ppUL83 protein (‘NLV peptide’) consisting of
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-129.
- the peptide comprises, consists essentially of, or consists of one or more amino acid sequences selected from the group consisting of those defined in proviso (1) of the first aspect.
- Xaa 4 in the sequences referred to herein is absent or is from 1 to 17 hydrophilic amino acids, for example, from 1 to 16, 1 to 15, 1 to 14, 1 to 13, 1 to 12, 1 to 11, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2 hydrophilic amino acids, or is a hydrophilic amino acid.
- the peptide conjugate comprises two or more epitopes, such as two or more peptide epitopes.
- the peptide conjugate comprises an antigenic peptide.
- the peptide is a synthetic peptide.
- the compound of formula (I) is an isolated compound of formula (I).
- the compound of formula (I) is a pure, purified or substantially pure compound of formula (I).
- the compound of formula (I) of the invention is a compound selected from the group consisting of compounds 910, 911, 912, 913, 930, 931, and 932 of the Examples herein.
- the present invention broadly consists in a method of making a peptide conjugate of the formula (IF) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising:
- n is from 2 to 5, 2 to 4, or 2 to 3. In exemplary embodiments, m is 2. In other exemplary embodiments, m is from 3 to 5.
- X10 is L1-Z1- or —OH, —SH, —NHR, P10-O—, P11-S—, or P12-NR—; and X11 is X10 or —OH, —SH, or —NHR.
- X10 is L1-Z1-, —OH, or P10-O—; and X11 is X10 or —OH.
- X10 is L1-C(O)O—, OH, or P10-O—; and X11 is L1-C(O)O—, P10-O—, or OH.
- X10 is L1-C(O)O— or P10-O—; and X11 is L1-C(O)O—, P10-O—, or OH.
- X10 is P10-O—; and X11 is P10-O— or OH.
- R9 is not hydrogen and/or A1 is not OH.
- the amino acid-comprising conjugation partner is a peptide containing conjugation partner comprising 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, or 3 or less amino acid residues.
- the C-terminus of the amino acid comprising conjugation partner is protected with a carboxyl protecting group or a carboxamide protecting group and/or the N ⁇ -amino group of the amino acid comprising conjugation partner is protected with an amino protecting group.
- R9 is an amino protecting group.
- A1 is OP1 or NHP2. In certain embodiments, A1 is OP1.
- R9 is an amino protecting group and A1 is OP1 in the amino acid comprising conjugation partner.
- the method comprises reacting the epoxide and amino acid-comprising conjugation partner in the presence of an acid, for example a strong acid.
- the acid comprises hydrochloric acid, sulfuric acid, or a mixture thereof.
- the acid comprises a lewis acid, for example BF 3 .
- the method comprises reacting the epoxide and amino acid-comprising conjugation partner under neutral conditions.
- the neutral conditions comprise a protic solvent, such as an alcohol, for example ethanol.
- the method comprises reacting the epoxide and amino acid-comprising conjugation partner in the presence of a base, for example a mild base.
- the base is an organic amine, for example triethylamine.
- the method comprises providing the epoxide by reacting an alkene of the formula (XVII):
- the oxidant is a peroxide, such as an organic peroxide, for example m-chloro peroxybenzoic acid, or an organic N-oxide, for example pyridine N-oxide.
- a peroxide such as an organic peroxide, for example m-chloro peroxybenzoic acid, or an organic N-oxide, for example pyridine N-oxide.
- the method comprises providing the epoxide by reacting an compound of the formula (XVII-A) wherein LG is a leaving group:
- the compound of formula (XVII-A) is prepared from L-aspartic acid.
- the method further comprises providing a single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI).
- providing the single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI) comprises resolving a racemic mixture of the epoxide.
- the method comprises providing a single stereoisomer or a stereoisomerically enriched mixture of the compound of formula (XVII-A).
- the method comprises converting the compound of formula (XV) to an amino acid- or peptide conjugate of the formula (IF-1) or a pharmaceutically acceptable salt or solvate thereof by one or more additional synthetic steps:
- the one or more synthetic steps comprises converting the hydroxyl group bound to the carbon to which R3 is attached to L2-Z2-.
- the one or more synthetic steps comprises acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(O)—.
- X11 is P10-O— or OH; and the one or more synthetic steps comprise acylating the compound of formula (XV) so as to replace P10 or the hydrogen atom of the hydroxyl group of X11 with L1-C(O)—; and/or acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(O)—.
- the present invention broadly consists in a compound of the formula (XV):
- the present invention broadly consists in a method of making a compound of the formula (XV) or a salt or solvate thereof, the method comprising:
- the present invention broadly consists in the use of a compound of the formula (XV) or (XVI) in the synthesis of a peptide-conjugate of the formula (IF) of the present invention (including provisos (1) and/or (2) of the first aspect) or a pharmaceutically acceptable salt or solvate thereof.
- the present invention broadly consists in a method of making a peptide-conjugate of the formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising:
- Rm and Rn are each independently selected from hydrogen, C1-6alkyl, or aryl.
- Rm is hydrogen, C1-6alkyl, or aryl; and Rn is C1-6alkyl or aryl.
- the leaving group is a halo (for example chloro, bromo, or iodo) or sulfonate (for example a tosylate or mesylate).
- halo for example chloro, bromo, or iodo
- sulfonate for example a tosylate or mesylate
- m and v are such that the compound of formula (XXI) comprises a 5-7-membered cyclic acetal.
- the cyclic acetal is a 6-membered cyclic acetal.
- the cyclic acetal is a 5-membered cyclic acetal and w is an integer greater than 1.
- m is 2 and v is 1.
- R9 is not hydrogen and/or A1 is not OH.
- the amino acid-comprising conjugation partner is a peptide containing conjugation partner comprising 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, or 3 or less amino acid residues.
- the C-terminus of the amino acid comprising conjugation partner is protected with a carboxyl protecting group or a carboxamide protecting group and/or the N ⁇ -amino group of the amino acid comprising conjugation partner is protected with an amino protecting group.
- R9 is an amino protecting group.
- A1 is OP1 or NHP2. In certain embodiments, A1 is OP1.
- R9 is an amino protecting group and A1 is OP1 in the amino acid comprising conjugation partner.
- the method comprises reacting the compound of formula (XXI) and the amino acid-comprising conjugation partner of formula (III) in the presence of a base.
- the base comprises an organic amine, for example triethylamine, N-methylmorpholine, or collidine.
- the cyclic acetal of formula (XXI) is provided in the form of a single stereoisomer or a stereoisomerically enriched mixture.
- the method comprises converting the compound of formula (XX) to an amino acid- or peptide conjugate of the formula (IA) or a pharmaceutically acceptable salt or solvate thereof by one or more synthetic steps:
- the one or more synthetic steps comprises removing the acetal in the compound of formula (XX) to provide a compound of the formula (XXIII-1):
- the method comprises removing the acetal in the compound of formula (XX) to provide a compound of the formula (XXIII-2) or (XXIII-3):
- the one or more synthetic steps comprise converting the hydroxyl group bound to the carbon to which R1 and R2 are attached in the compound of formula (XXIII-1) to L1-Z1-, and/or converting the hydroxyl group bound to the carbon to which Rx and Ry are attached to L2-Z2.
- the one or more synthetic steps comprise
- converting said hydroxyl group to L1-Z1- or L2-Z2- comprises acylating so as to replace the hydrogen atom of the hydroxyl group with L1-C(O)— or L2-C(O)—.
- the present invention broadly consists in a compound of the formula (XX):
- the present invention broadly consists in a method of making a compound of the formula (XX) or a salt or solvate thereof, the method comprising:
- the present invention broadly consists in the use of a compound of the formula (XX) or (XXI) in the synthesis of a peptide-conjugate of the formula (IA) of the present invention (including provisos (1) and/or (2) of the first aspect) or a pharmaceutically acceptable salt or solvate thereof.
- the present invention broadly consists in a method of making a peptide conjugate of the formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising:
- the amino acid-comprising conjugation partner is a peptide-containing conjugation partner
- the lipid-containing conjugation partners are coupled to the peptide of the peptide-containing conjugation partner.
- the lipid-containing conjugation partners are conjugated to the or an amino acid of the amino acid-comprising conjugation partner or the peptide of the peptide-containing conjugation partner.
- the lipid-containing conjugation partners are conjugated to the or an amino acid of the amino acid-comprising conjugation partner.
- the present invention broadly consists in a method of making a peptide conjugate of formula (I) or a pharmaceutically acceptable salt or solvate thereof of the present invention, the method comprising reacting
- the conjugate is a lipopeptide, such that the method is for making a lipopeptide.
- the first and second lipid-containing conjugation partners have the same structure (that is, the first and second lipid-containing conjugation partners are identical).
- the method comprises conjugating the sulfur atom of the thiol to a carbon atom of the carbon-carbon double bond of the first lipid containing conjugation partner and then conjugating a carbon atom from the carbon-carbon double bond to which the thiol is conjugated to a carbon atom of the carbon-carbon double bond of the second lipid-containing conjugation partner.
- the first lipid-containing conjugation partner is a compound of the formula (IIA):
- the amino acid- or peptide conjugate is a compound of the formula (IB):
- the lipid containing conjugation partners are in stoichiometric excess to the amino acid-comprising conjugation partner.
- the mole ratio of the lipid containing conjugation partners (combined) to amino acid-comprising conjugation partner is at least 7:1.
- the first lipid-containing conjugation partner is a compound of the formula (IIA-1):
- L1 is C11-21alkyl
- k is 0-3, preferably 0
- Ra, Rb, and Rc are each hydrogen.
- L1 is C11-21alkyl
- k is 1-3
- Ra, Rb, and Rc are each hydrogen.
- L2 is C11-21alkyl
- v is 0-3, preferably 0
- R3, R4, and R5 are each hydrogen.
- n 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, L3-C(O), or A2.
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, an amino protecting group, or L3-C(O), wherein L3 is linear C15alkyl or methyl.
- the compounds of formula (IIA) and (IIB) are each vinyl palmitate.
- the amino-acid comprising conjugation partner is cysteine, a protected cysteine (including N ⁇ -amine and/or carboxyl protected cysteine), or a peptide comprising a cysteine residue (including an N ⁇ -amine or carboxyl protected cysteine residue), for example, an N-terminal cysteine residue (including an N ⁇ -amine protected cysteine residue).
- the method comprises reacting vinyl palmitate and an N ⁇ -amino protected cysteine, such as Fmoc-Cys-OH, Boc-Cys-OH, Fmoc-Cys-OP1, or Boc-Cys-OP1.
- an N ⁇ -amino protected cysteine such as Fmoc-Cys-OH, Boc-Cys-OH, Fmoc-Cys-OP1, or Boc-Cys-OP1.
- the carboxyl group of the N ⁇ -amino protected cysteine is protected.
- the conditions effective to conjugate the lipid-containing conjugation partners to the amino acid-comprising conjugation partner comprises the generation of one or more free radicals. In one embodiment, the conditions effective to conjugate the lipid-containing conjugation partners to the peptide-containing conjugation partner comprises the generation of one or more free radicals.
- the generation of one or more free radicals is initiated thermally and/or photochemically. In certain embodiments, the generation of one or more free radicals is initiated by the thermal and/or photochemical degradation of a free radical initiator. In exemplary embodiments, the generation of one or more free radicals is initiated by the thermal degradation of a thermal initiator or the photochemical degradation of a photochemical initiator.
- thermal degradation of the free radical initiator comprises heating the reaction mixture at a suitable temperature.
- the reaction mixture is heated at a temperature is from about 40° C. to about 200° C., from about 50° C. to about 180° C., from about 60° C. to about 150° C., from about 65° C. to about 120° C., from about 70° C. to about 115° C., from about 75° C. to about 110° C., or from about 80° C. to about 100° C.
- the reaction mixture is heated at a temperature of at least about 40° C., at least about 50° C., at least about 60° C., or at least about 65° C.
- the reaction mixture is heated at a temperature of about 90° C.
- photochemical degradation of the free radical initiator comprises irradiation with ultraviolet light, preferably having a frequency compatible with the side chains of naturally occurring amino acids.
- the ultraviolet light has a wavelength of about 365 nm.
- photochemical degradation of the free radical initiator is carried out at about ambient temperature.
- the thermal initiator is 2,2′-azobisisobutyronitrile (AIBN).
- AIBN 2,2′-azobisisobutyronitrile
- the photoinitiator is 2,2-dimethoxy-2-phenylacetophenone (DMPA).
- the reaction is carried out in a liquid medium.
- the liquid medium comprises a solvent.
- the solvent is selected from the group consisting of N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), N,N-dimethylformamide (DMF), dichloromethane (DCM), 1,2-dichloroethane, and mixtures thereof.
- NMP N-methylpyrrolidone
- DMSO dimethylsulfoxide
- DMF N,N-dimethylformamide
- DCM dichloromethane
- 1,2-dichloroethane 1,2-dichloroethane, and mixtures thereof.
- the solvent comprises NMP, DMF, DMSO, or a mixture thereof.
- the solvent comprises DMSO or NMP. In exemplary embodiments, the solvent comprises NMP.
- the reaction is carried out in the presence of one or more additives that inhibit the formation of by-products and/or that improve the yield of or conversion to the desired conjugate.
- the one or more additive is an extraneous thiol, an acid, an organosilane, or a combination of any two or more thereof.
- the extraneous or exogenous thiol is selected from the group consisting of reduced glutathione (GSH), 2,2′-(ethylenedioxy)diethanethiol (DODT), 1,4-dithiothreitol (DTT), protein, and sterically hindered thiols.
- GSH reduced glutathione
- DODT 2,2′-(ethylenedioxy)diethanethiol
- DTT 1,4-dithiothreitol
- protein protein
- sterically hindered thiols sterically hindered thiols.
- the extraneous or exogenous thiol is DTT.
- the extraneous or exogenous thiol is a sterically hindered thiol, for example tert-butyl mercaptan.
- the acid additive is a strong inorganic or organic acid. In various embodiments, the acid is a strong organic acid. In various embodiments, the acid is TFA.
- the organosilane is a trialkylsilane, for example TIPS.
- the one or more additive is selected from the group consisting of TFA, tert-butyl mercaptan, TIPS, and combinations of any two or more thereof.
- the one or more additive is a combination of an acid and an extraneous thiol, for example TFA and tert-butyl mercaptan.
- the one or more additive is a combination of an acid and an organosilane, for example TFA and TIPS.
- the one or more additive is a combination of an extraneous thiol and an organosilane, and optionally an acid, for example a combination of t-BuSH and TIPS, and TFA.
- the reaction is carried out for a period of time from about 5 minutes to about 48 h, 5 minutes to about 24 h, from about 5 minutes to about 12 hours, from about 5 minutes to about 6 hours, from about 5 minutes to about 3 hours, 5 minutes to 2 hours, or form about 5 minutes to about 1 hour. In exemplary embodiments, the reaction is carried out for a period of time from about 5 minutes to about 1 h. In some embodiments, the reaction is carried out until one of the conjugation partners is at least about 70%, 80%, 90%, 95%, 97%, 99%, or 100% consumed.
- the reaction is carried out under substantially oxygen free conditions.
- the amino acid-comprising conjugation partner is a peptide-containing conjugation partner.
- the amino acid-comprising conjugation partner comprises an epitope.
- the peptide-containing conjugation partner comprises an epitope, such as a peptide epitope.
- the amino acid-comprising conjugation partner comprises two or more epitopes. In one embodiment, the peptide-containing conjugation partner comprises two or more epitopes.
- the amino acid-comprising conjugation partner consists of a peptide.
- the amino acid-comprising conjugation partner consists of a peptide comprising a peptide epitope. In one embodiment, the peptide-containing conjugation partner consists of a peptide. In one embodiment, the peptide-containing conjugation partner consists of a peptide comprising a peptide epitope.
- the amino acid-comprising conjugation partner comprises an epitope bound to the or an amino acid of the conjugation partner.
- the peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide containing conjugation partner.
- the epitope is bound to the peptide via linker group.
- the amino acid-comprising conjugation partner comprises a peptide epitope bound to the or an amino acid of the conjugation partner via a linker group. In some embodiments, the peptide-containing conjugation partner comprises a peptide epitope bound to the peptide via a linker group.
- the amino acid-comprising conjugation partner and/or the peptide-containing conjugation partner comprises an antigenic peptide.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises a synthetic peptide.
- the synthetic peptide is a peptide prepared by a method comprising solid phase peptide synthesis (SPPS).
- the method comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or an amino acid of a peptide to provide a peptide conjugate.
- the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or an amino acid of a peptide to provide a peptide conjugate of the present invention.
- the peptide comprises an epitope.
- the epitope is a peptide epitope.
- the method further comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate of the present invention.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate of the invention comprising a linker group or one or more amino acids thereof.
- the method further comprises coupling an amino acid of the peptide conjugate comprising a linker group or one or more amino acids thereof to an amino acid or a peptide so as to provide a peptide conjugate of the invention comprising a peptide epitope bound to the amino acid to which lipid moieties are conjugated via a linker group.
- the amino acid of the peptide conjugate to which the lipid moeities are conjugated is an N-terminal amino acid residue.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate of the invention comprising a peptide epitope.
- the method further comprises coupling an epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate.
- the method further comprises coupling a peptide epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate.
- the epitope is coupled or bound via a linker group.
- the method further comprises coupling an epitope to the peptide of the peptide conjugate.
- the method further comprises coupling a peptide epitope to the peptide of the peptide conjugate.
- the epitope is bound to the peptide via a linker group.
- the method is (B) and the amino acid-comprising conjugation partner consists of an amino acid, for example cysteine (including N ⁇ -amino and/or C-terminus protected cysteines).
- cysteine including N ⁇ -amino and/or C-terminus protected cysteines
- the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect is an amino acid-conjugate.
- A1 is OH, OP1, NH2, or NHP2 and/or R9 is hydrogen, C1-6alkyl, C3-6cycloalkyl, an amino protecting group, or L3-C(O) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- A1 is OP1 or OH and/or R9 is hydrogen, an amino protecting group or L3-C(O) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- A1 is OH, OP1, NH2, or NHP2 and R9 is hydrogen, C1-6alkyl, C3-6cycloalkyl, an amino protecting group, or L3-C(O) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- A1 is OH, or OP1
- R9 is hydrogen, an amino protecting group, or L3-C(O) in the amino acid- or peptide-conjugate compound of formula (I) but excluding provisos (1) and (2) of the first aspect.
- the C-terminus of the amino acid comprising conjugation partner is protected with a protecting group and/or the N ⁇ -amino group of the amino acid comprising conjugation partner is protected with a protecting group.
- the carboxyl group of the C-terminus of the amino acid is protected with a carboxyl protecting group or a carboxamide protecting group and/or the N ⁇ -amino group of the amino acid is protected with an amino protecting group.
- the carboxyl group of the C-terminus of the amino acid is protected with a carboxyl protecting group and/or the N ⁇ -amino group of the amino acid is protected with an amino protecting group.
- the carboxyl group of the C-terminus of the peptide is protected with a carboxyl protecting group and/or the N ⁇ -amino group of the peptide is protected with an amino protecting group.
- the amino acid residue comprising the thiol is a terminal amino acid residue. In some embodiments, the amino acid residue comprising the thiol is an N-terminal residue.
- A1 and/or R9 is a group other than an amino acid or a peptide
- the method comprises coupling an amino acid or a peptide so as to replace A1 and/or R9 with the amino acid or peptide.
- A1 a group other than an amino acid or a peptide
- the method comprises coupling an amino acid or a peptide so as to replace A1 with the amino acid or peptide.
- A1 is a OH, OP1, NH2, or NHP2 and/or R9 is hydrogen, an amino protecting group or L3-C(O), and the method comprises coupling an amino acid or a peptide so as to replace A1 and/or R9 with the amino acid or peptide.
- A1 is a OH, OP1, NH2, or NHP2 and R9 is hydrogen, an amino protecting group or L3-C(O) and the method further comprises coupling an amino acid or a peptide so as to replace A1 and/or R9 with the amino acid or peptide.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- coupling the amino acid or peptide provides a peptide conjugate comprising a peptide epitope. In some embodiments, the coupling the amino acid or peptide provides a peptide conjugate comprising a linker group or one or more amino acids thereof. In some embodiments, coupling the amino acid or peptide provides a peptide conjugate comprising a peptide epitope bound to the amino acid to which the lipid moieties are conjugated via a linker group.
- the N ⁇ -amino group of the amino acid comprising the thiol to which the lipid moieties are conjugated is acylated.
- R9 in the amino acid comprising conjugation partner comprising the thiol is L3-C(O)—, for example Me-C(O)—.
- the method further comprises acylating the N ⁇ -amino group of the amino acid of the amino acid conjugate or the amino acid residue of the peptide conjugate to which the lipid moeities are conjugated. In certain embodiments, the method further comprises acylating the N ⁇ -amino group with a C2-20 fatty acid, such as acetyl.
- R9 is hydrogen or an amino protecting group
- the method further comprises acylating the amino acid conjugate or peptide conjugate so as to replace the hydrogen or amino protecting group at R9 with L3-C(O).
- acylating the amino acid conjugate or peptide conjugate so as to replace the amino protecting group at R9 with L3-C(O) comprises removing the amino protecting group at R9 to provide a hydrogen at R9.
- the or an amino acid of the amino acid-comprising conjugation partner comprises the thiol. In certain embodiments, an amino acid residue of the peptide of the peptide-containing conjugation partner comprises the thiol.
- the thiol is the thiol of a cysteine residue.
- the cysteine residue is a terminal residue. In certain embodiments, the cysteine residue is an N-terminal residue.
- the amino group of the cysteine residue is acylated.
- the amino group is acylated with a C2-20 fatty acid.
- the C2-20 fatty acid is acetyl or palmitoyl. In another exemplary embodiment, the C2-20 fatty acid is acetyl.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the peptide-containing conjugation partner comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises a peptide comprising from 8 to 60 amino acids. In one exemplary embodiment, the peptide comprises from 8 to 60 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the peptide-containing conjugation partner comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the amino acid comprising conjugation partner and/or peptide conjugate comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the peptide-containing conjugation partner comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the amino acid comprising conjugation partner is a short peptide.
- the short peptide comprises less than 10, 9, 8, 7, 6, 5, 4, or 3 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises one or more solubilising groups.
- the peptide-containing conjugation partner comprises one or more solubilising groups.
- the solubilising group is an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In certain embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. In one embodiment, the hydrophilic amino acid residues are cationic amino acid residues. In one embodiment, the cationic amino acid residues are arginine or lysine residues. In one specifically contemplated embodiment, the cationic amino acid residues are lysine residues. In one embodiment, the sequence comprises from 2 to 20, 2 to 15, 2 to 10, 3 to 7, or 3 to 5 amino acids.
- the solubilising group is a tri-, tetra-, penta-, hexa-, or hepta- lysine sequence. In one specifically contemplated embodiment, the solubilising group is a tetralysine sequence.
- the peptide conjugate and/or amino-acid comprising conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid moeities are conjugated.
- the peptide of the peptide-containing conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid moeities are conjugated.
- the amino acid residue to which the lipid moeities are conjugated is N-terminal.
- the peptide further comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino-acid comprising conjugation partner comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino acid-comprising conjugation partner comprises only naturally occurring amino acids. In certain embodiments, the peptide-containing conjugation partner comprises only naturally occurring amino acids. In other embodiments, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide are naturally occurring amino acids.
- 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide conjugate and/or amino acid-comprising conjugation partner are naturally occurring amino acids.
- the peptide conjugate and/or amino acid-comprising conjugation partner comprises a peptide comprising a peptide epitope.
- the peptide of the peptide-containing conjugation partner comprises one or more peptide epitopes.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of those defined in proviso (1) of the first aspect.
- the peptide comprises, consists essentially of, or consists of one or more EBV LMP2 epitopes.
- the one or more EBV LMP2 epitopes are MHCI epitopes.
- the peptide comprises one or more EBV LMP2 epitopes selected from the group consisting of any one of SEQ ID NOs 84-109.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83, or comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide comprises a recombinant peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the recombinant peptide comprises or consists of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83, or comprises or consists of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 9-83.
- the peptide epitope is derived from NY-ESO-1.
- the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises, consists essentially of, or consists of one or more NY-ESO-1 epitopes.
- the one or more NY-ESO-1 epitopes are MHCI epitopes.
- the the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the peptide comprises a peptide comprising or consisting of 12 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129. In various embodiments, the peptide comprises a peptide comprising or consisting of 15 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129, or comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NO: 114, 115, 116, 121, 122, 127, 128, and 129.
- the reactive functional groups of the amino acids of the peptide-containing conjugation partner are unprotected.
- one or more reactive functional groups of one or more amino acids of the peptide conjugate are unprotected.
- one or more reactive functional groups of the amino acid of the amino acid conjugate are unprotected.
- one or more reactive functional groups of one or more amino acids of the amino acid-comprising conjugation partner are unprotected.
- the amino acid-comprising conjugation partner comprises a peptide, wherein the reactive functional groups of the side chains of the amino acids of the peptide are unprotected, with the exception of any thiols other than the thiol to be reacted.
- the reactive functional groups of the amino acids of the peptide of the peptide-containing conjugation partner are unprotected.
- the reactive functional groups of the amino acids of the peptide of the peptide-containing conjugation partner are unprotected, with the exception of any thiols other than the thiol to be reacted.
- peptide of the peptide conjugate and/or peptide-containing conjugation partner may, as described herein, be optionally substituted, modified, or bound to various other moieties as described herein to provide the peptide conjugate and/or peptide containing conjugation partner.
- the method comprises
- the method comprises
- the method further comprises acylating the N ⁇ -amino group of the amino acid of the amino acid conjugate or the amino acid to which the lipid-moieties are conjugated of any one of the peptide conjugates.
- the method comprises cleaving the peptide conjugate from the solid phase support.
- the method comprises
- the method comprises
- the peptide-containing conjugation partner is not purified prior to reaction with the lipid-containing conjugation partners.
- one or more protecting groups are removed on cleaving the peptide from the solid phase support. In certain embodiments, all of the protecting groups present in the peptide are removed.
- the SPPS is Fmoc-SPPS.
- the amino acid residue in the peptide of the peptide-containing conjugation partner bearing the thiol to be reacted is an N-terminal amino acid residue and the method comprises acylating the N-terminal amino group prior to cleaving the peptide from the solid phase.
- the N-terminal residue is a cysteine residue.
- the method further comprises separating the peptide conjugate from the reaction medium and optionally purifying the peptide conjugate.
- the present invention broadly consists in a method of making a peptide conjugate, the method comprising
- the product peptide conjugate is a compound of the formula (I) or a pharmaceutically acceptable salt thereof of the present invention.
- the amino acid of the amino acid conjugate is coupled under conditions that reduce epimerisation at the ⁇ -carbon of the amino acid.
- the conditions are such that less than about 35, 30, 25, 20, 15, 10, 5, 3, 2, or 1% by mol of the amino acid is epimerised.
- the conditions that reduce epimerisation comprise the use of PyBOP or BOP as the coupling reagent.
- the conditions that reduce epimerisation comprise the use of PyBOP as the coupling reagent.
- the conditions comprise the use of PyBOP or BOP; and 2,4,6-trimethylpyridine.
- the conditions comprise the use of PyBOP and 2,4,6-trimethylpyridine.
- the present invention broadly consists in use of an amino acid- or peptide-conjugate of the formula (I) of the present invention (including provisos (1) and/or (2) of the first aspect) or a salt or solvate thereof in the synthesis of an immunogenic peptide-conjugate.
- the immunogenic peptide conjugate is a compound of the formula (I) of the present invention or a pharmaceutically acceptable salt thereof.
- the present invention broadly consists in a peptide conjugate of the present invention produced by a method of the present invention.
- the present invention broadly consists in a composition comprising a peptide conjugate of formula (I) of the present invention or a salt or solvate thereof.
- the composition comprises isolated, pure, purified or substantially purified compound of formula (I) of the present invention or a salt or solvate thereof.
- the composition comprises at least about 60, 70, 75, 80, 85, 90, 95, 97, 98, or 99% by weight compound of formula (I) of the present invention or a salt or solvate thereof.
- the composition is free of substantially free of amino acid- or peptide containing compounds other than compounds of formula (I) of the present invention.
- the present invention broadly consists in a pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of a peptide conjugate compound of the formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition comprises an effective amount of two or more peptide conjugate compounds of the formula (I) of the present invention.
- the pharmaceutical composition is an immunogenic composition.
- the pharmaceutical composition does not include an extrinsic adjuvant.
- the pharmaceutical composition is a vaccine.
- the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention, for example the pharmaceutical composition comprises an effective amount of three or more peptide conjugates of the present invention.
- the pharmaceutical composition comprises an effective amount of one or more peptide conjugates of the present invention together with one or more peptides described herein, or any combination thereof.
- the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention and one or more peptides described herein, or an effective amount of one or more peptide conjugates of the present invention and two or more peptides described herein.
- the present invention broadly consists in a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of one or more peptide conjugate compounds of the formula (I) of the invention or a pharmaceutically acceptable salt or solvate thereof, or an effective amount of a pharmaceutical composition of of the present invention.
- the present invention broadly consists in use of one or more peptide conjugate compounds of formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention broadly consists in one or more peptide conjugate compounds of the formula (I) of the present invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the present invention for vaccinating or eliciting an immune response in a subject.
- the present invention broadly consists in use of one or more peptide conjugate compounds of the formula (I) of the invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the present invention for vaccinating or eliciting an immune response in a subject.
- the present invention broadly consists in a method of activating TLR2 in a subject, the method comprising administering to the subject an effective amount of one or more peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof, or an effective amount of a pharmaceutical composition of the invention.
- One or more peptide conjugate compounds of the invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the invention for activating TLR2 in a subject are provided.
- the method, use, one or more compounds, or pharmaceutical composition is for eliciting an immune response in a subject.
- the method, use, one or more compounds, or pharmaceutical composition is for vaccinating a subject.
- the method comprises the administration of one or more peptides described herein and one or more peptide conjugates of the present invention or two or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates to the subject.
- one or more peptides described herein and one or more peptide conjugates of the present invention or two or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates, are used for vaccinating or eliciting an immune response in the subject or in the manufacture of a medicament for vaccinating or eliciting an immune response in the subject.
- two or more peptide conjugates are used or administered.
- the two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered simultaneously, sequentially, or separately.
- the subject is in need thereof.
- Asymmetric centers may exist in the compounds described herein.
- the asymmetric centers may be designated as (R) or (S), depending on the configuration of substituents in three dimensional space at the chiral carbon atom.
- All stereochemical isomeric forms of the compounds, including diastereomeric, enantiomeric, and epimeric forms, as well as d-isomers and I-isomers, and mixtures thereof, including enantiomerically enriched and diastereomerically enriched mixtures of stereochemical isomers, are within the scope of the invention.
- Individual enantiomers can be prepared synthetically from commercially available enantiopure starting materials or by preparing enantiomeric mixtures and resolving the mixture into individual enantiomers.
- Resolution methods include conversion of the enantiomeric mixture into a mixture of diastereomers and separation of the diastereomers by, for example, recrystallization or chromatography, and any other appropriate methods known in the art.
- Starting materials of defined stereochemistry may be commercially available or made and, if necessary, resolved by techniques well known in the art.
- the compounds described herein may also exist as conformational or geometric isomers, including cis, trans, syn, anti,
- E
- Z
- All such isomers and any mixtures thereof are within the scope of the invention.
- tautomeric isomers or mixtures thereof of the compounds described are any tautomeric isomers or mixtures thereof of the compounds described.
- a wide variety of functional groups and other structures may exhibit tautomerism. Examples include, but are not limited to, keto/enol, imine/enamine, and thioketone/enethiol tautomerism.
- the compounds described herein may also exist as isotopologues and isotopomers, wherein one or more atoms in the compounds are replaced with different isotopes.
- Suitable isotopes include, for example, 1 H, 2 H (D), 3 H (T), 12 C, 13 C, 14 C, 16 O, and 18 O. Procedures for incorporating such isotopes into the compounds described herein will be apparent to those skilled in the art. Isotopologues and isotopomers of the compounds described herein are also within the scope of the invention.
- salts of the compounds described herein including pharmaceutically acceptable salts.
- Such salts include, acid addition salts, base addition salts, and quaternary salts of basic nitrogen-containing groups.
- Acid addition salts can be prepared by reacting compounds, in free base form, with inorganic or organic acids.
- inorganic acids include, but are not limited to, hydrochloric, hydrobromic, nitric, sulfuric, and phosphoric acid.
- organic acids include, but are not limited to, acetic, trifluoroacetic, propionic, succinic, glycolic, lactic, malic, tartaric, citric, ascorbic, maleic, fumaric, pyruvic, aspartic, glutamic, stearic, salicylic, methanesulfonic, benzenesulfonic, isethionic, sulfanilic, adipic, butyric, and pivalic.
- Base addition salts can be prepared by reacting compounds, in free acid form, with inorganic or organic bases.
- inorganic base addition salts include alkali metal salts, alkaline earth metal salts, and other physiologically acceptable metal salts, for example, aluminium, calcium, lithium, magnesium, potassium, sodium, or zinc salts.
- organic base addition salts include amine salts, for example, salts of trimethylamine, diethylamine, ethanolamine, diethanolamine, and ethylenediamine.
- Quaternary salts of basic nitrogen-containing groups in the compounds may be may be prepared by, for example, reacting the compounds with alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides, dialkyl sulfates such as dimethyl, diethyl, dibutyl, and diamyl sulfates, and the like.
- alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides
- dialkyl sulfates such as dimethyl, diethyl, dibutyl, and diamyl sulfates, and the like.
- the compounds described herein may form or exist as solvates with various solvents. If the solvent is water, the solvate may be referred to as a hydrate, for example, a mono-hydrate, a di-hydrate, or a tri-hydrate. All solvated forms and unsolvated forms of the compounds described herein are within the scope of the invention.
- aliphatic is intended to include saturated and unsaturated, nonaromatic, straight chain, branched, acyclic, and cyclic hydrocarbons.
- aliphatic groups include, for example, alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups, and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl and (cycloalkyl)alkenyl groups.
- aliphatic groups comprise from 1-12, 1-8, 1-6, or 1-4 carbon atoms.
- aliphatic groups comprise 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- the aliphatic group is saturated.
- heteroaliphatic is intended to include aliphatic groups, wherein one or more chain and/or ring carbon atoms are independently replaced with a heteroatom, preferably a heteroatom selected from oxygen, nitrogen and sulfur. In some embodiments, the heteroaliphatic is saturated. Examples of heteroaliphatic groups include linear or branched, heteroalkyl, heteroalkenyl, and heteroalkynyl groups.
- alkyl is intended to include saturated straight chain and branched chain hydrocarbon groups.
- alkyl groups have from 1 to 12, 1 to 10, 1 to 8, 1 to 6, or from 1 to 4 carbon atoms.
- alkyl groups have from 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl.
- branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, tert-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl.
- alkenyl is intended to include straight and branched chain alkyl groups having at least one double bond between two carbon atoms.
- alkenyl groups have from 2 to 12, from 2 to 10, from 2 to 8, from 2 to 6, or from 2 to 4 carbon atoms.
- alkenyl groups have from 5-21, from 9-21, or from 11-21 carbon atoms, such as from 11, 13, 15, 17, or 19 carbon atoms.
- alkenyl groups have one, two, or three carbon-carbon double bonds.
- alkenyl groups include, but are not limited to, vinyl, allyl, —CH ⁇ CH(CH 3 ), —CH ⁇ C(CH 3 ) 2 , —C(CH 3 ) ⁇ CH 2 , and —C(CH 3 ) ⁇ CH(CH 3 ).
- alkynyl is intended to include straight and branched chain alkyl groups having at least one triple bond between two carbon atoms.
- the alkynyl group have from 2 to 12, from 2 to 10, from 2 to 8, from 2 to 6, or from 2 to 4 carbon atoms.
- alkynyl groups have one, two, or three carbon-carbon triple bonds. Examples include, but are not limited to, —C ⁇ CH, —C ⁇ CH 3 , —CH 2 C ⁇ CH 3 , and —C ⁇ CH 2 CH(CH 2 CH 3 ) 2 .
- heteroalkyl is intended to include alkyl groups, wherein one or more chain carbon atoms are replaced with a heteroatom, preferably a heteroatom selected from the group consisting of oxygen, nitrogen, and sulfur. In some embodiments, the heteroalkyl is saturated. Heteroalkyl groups include, for example, polyethylene glycol groups and polyethylene glycol ether groups, and the like.
- cycloalkyl is intended to include mono-, bi- or tricyclic alkyl groups.
- cycloalkyl groups have from 3 to 12, from 3 to 10, from 3 to 8, from 3 to 6, from 3 to 5 carbon atoms in the ring(s).
- cycloalkyl groups have 5 or 6 ring carbon atoms.
- monocyclic cycloalkyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
- the cycloalkyl group has from 3 to 8, from 3 to 7, from 3 to 6, from 4 to 6, from 3 to 5, or from 4 to 5 ring carbon atoms.
- Bi- and tricyclic ring systems include bridged, spiro, and fused cycloalkyl ring systems. Examples of bi- and tricyclic ring cycloalkyl systems include, but are not limited to, bicyclo[2.1.1]hexanyl, bicyclo[2.2.1]heptanyl, adamantyl, and decalinyl.
- cycloalkenyl is intended to include non-aromatic cycloalkyl groups having at least one double bond between two carbon atoms. In some embodiments, cycloalkenyl groups have one, two or three double bonds. In some embodiments, cycloalkenyl groups have from 4 to 14, from 5 to 14, from 5 to 10, from 5 to 8, or from 5 to 6 carbon atoms in the ring(s). In some embodiments, cycloalkenyl groups have 5, 6, 7, or 8 ring carbon atoms. Examples of cycloalkenyl groups include cyclohexenyl, cyclopentenyl, cyclohexadienyl, butadienyl, pentadienyl, and hexadienyl.
- aryl is intended to include cyclic aromatic hydrocarbon groups that do not contain any ring heteroatoms.
- Aryl groups include monocyclic, bicyclic and tricyclic ring systems. Examples of aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, fluorenyl, phenanthrenyl, anthracenyl, indenyl, indanyl, pentalenyl, and naphthyl. In some embodiments, aryl groups have from 6 to 14, from 6 to 12, or from 6 to 10 carbon atoms in the ring(s). In some embodiments, the aryl groups are phenyl or naphthyl.
- Aryl groups include aromatic-aliphatic fused ring systems. Examples include, but are not limited to, indanyl and tetrahydronaphthyl.
- heterocyclyl is intended to include non-aromatic ring systems containing 3 or more ring atoms, of which one or more is a heteroatom.
- the heteroatom is nitrogen, oxygen, or sulfur.
- the heterocyclyl group contains one, two, three, or four heteroatoms.
- heterocyclyl groups include mono-, bi- and tricyclic rings having from 3 to 16, from 3 to 14, from 3 to 12, from 3 to 10, from 3 to 8, or from 3 to 6 ring atoms.
- Heterocyclyl groups include partially unsaturated and saturated ring systems, for example, imidazolinyl and imidazolidinyl.
- Heterocyclyl groups include fused and bridged ring systems containing a heteroatom, for example, quinuclidyl.
- Heterocyclyl groups include, but are not limited to, aziridinyl, azetidinyl, azepanyl, diazepanyl, 1,3-dioxanyl, 1,3-dioxolanyl, isoxazolidinyl, morpholinyl, piperazinyl, piperidinyl, pyranyl, pyrazolidinyl, pyrrolinyl, pyrrolidinyl, tetrahydrofuranyl, tetrahydrothienyl, thiadiazolidinyl, and trithianyl.
- heteroaryl is intended to include aromatic ring systems containing 5 or more ring atoms, of which, one or more is a heteroatom.
- the heteroatom is nitrogen, oxygen, or sulfur.
- heteroaryl groups include mono-, bi- and tricyclic ring systems having from 5 to 16, from 5 to 14, from 5 to 12, from 5 to 10, from 5 to 8, or from 5 to 6 ring atoms.
- Heteroaryl groups include, but are not limited to, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, thiophenyl, benzothiophenyl, furanyl, benzofuranyl, indolyl, azaindolyl (pyrrolopyridinyl), indazolyl, benzimidazolyl, pyrazolopyridinyl, triazolopyridinyl, benzotriazolyl, benzoxazolyl, benzothiazolyl, imidazopyridinyl, isoxazolopyridinylxanthinyl, guaninyl, quinolinyl, isoquinolinyl, tetrahydroquinolinyl, quinoxaliny
- halo or halogen is intended to include F, Cl, Br, and I.
- heteroatom is intended to include oxygen, nitrogen, sulfur, or phosphorus. In some embodiments, the heteroatom is selected from the group consisting of oxygen, nitrogen, and sulfur.
- substituted is intended to mean that one or more hydrogen atoms in the group indicated is replaced with one or more independently selected suitable substituents, provided that the normal valency of each atom to which the substituent/s are attached is not exceeded, and that the substitution results in a stable compound.
- optional substituents in the compounds described herein include but are not limited to halo, CN, NO 2 , OH, NH 2 , NHR10, NR10R20, C1-6haloalkyl, C1-6haloalkoxy, C(O)NH 2 , C(O)NHR10, C(O)NR10R20, SO 2 R10, OR10, SR10, S(O)R10, C(O)R10, and C1-6aliphatic; wherein R10 and R20 are each independently C1-6aliphatic, for example C1-6alkyl.
- carboxyl protecting group as used herein is means a group that is capable of readily removed to provide the OH group of a carboxyl group and protects the carboxyl group against undesirable reaction during synthetic procedures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and ‘Amino Acid-Protecting Groups’ by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504.
- Examples include, but are not limited to, alkyl and silyl groups, for example methyl, ethyl, tert-butyl, methoxymethyl, 2,2,2-trichloroethyl, benzyl, diphenylmethyl, trimethylsilyl, and tert-butyldimethylsilyl, and the like.
- amine protecting group means a group that is capable of being readily removed to provide the NH 2 group of an amine group and protects the amine group against undesirable reaction during synthetic procedures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and ‘Amino Acid-Protecting Groups’ by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504.
- Examples include, but are not limited to, acyl and acyloxy groups, for example acetyl, chloroacetyl, trichloroacetyl, o-nitrophenylacetyl, o-nitrophenoxy-acetyl, trifluoroacetyl, acetoacetyl, 4-chlorobutyryl, isobutyryl, picolinoyl, aminocaproyl, benzoyl, methoxy-carbonyl, 9-fluorenylmethoxycarbonyl, 2,2,2-trifluoroethoxycarbonyl, 2-trimethylsilylethoxy-carbonyl, tert-butyloxycarbonyl, benzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2,4-dichloro-benzyloxycarbonyl, and the like.
- acyl and acyloxy groups for example acetyl, chloroacetyl, trichloroacetyl, o
- Cbz carboxybenzyl
- Nosyl o- or p-nitrophenylsulfonyl
- Bpoc (2-(4-biphenyl)isopropoxycarbonyl)
- Dde (1-(4,4-dimethyl-2,6-dioxohexylidene)ethyl).
- carboxamide protecting group means a group that is capable of being readily removed to provide the NH 2 group of a carboxamide group and protects the carboxamide group against undesirable reaction during synthetic procedures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and ‘Amino Acid-Protecting Groups’ by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504.
- Examples include, but are not limited to, 9-xanthenyl (Xan), trityl (Trt), methyltrityl (Mtt), cyclopropyldimethylcarbinyl (Cpd), and dimethylcyclopropylmethyl (Dmcp).
- Xan 9-xanthenyl
- Trt trityl
- Mtt methyltrityl
- Cpd cyclopropyldimethylcarbinyl
- Dmcp dimethylcyclopropylmethyl
- the invention may also be said broadly to consist in the parts, elements and features referred to or indicated in the specification of the application, individually or collectively, in any or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equivalents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth.
- FIG. 1 is a graph showing the results of a representative TLR agonism assay in HEK-BlueTM-hTLR2 cells using titrated concentrations of agonist constructs: 910 (dotted white bars); 930 (grey bars); 931 (striped bars); 932 (square hatched bars); and (R)-Pam2Cys-SK 4 -SLLMWITQV (black bars). Data presented as mean+/ ⁇ SD ABS (635 nm) values for triplicate wells following background subtraction. Dotted lines indicate ABS in PBS-only wells.
- FIG. 2A is a bar graph showing the results of a human TLR2 agonism assay in HEK-BlueTM-hTLR2 cells using titrated concentrations of the following agonist constructs: A) (from left to right): 45a, 45b, 46a, 46b, 47b, 910, 911, 912 and 913 (structures depicted in Table 3); B) (from left to right): 45b, 910 and chain elongated structures 930, 931, and 932 (structures depicted in Table 4).
- FIG. 3 is a bar graph showing the results of a murine TLR2 agonism assay using titrated concentrations of the following agonist constructs: A) (from left to right): 45a, 45b, 46a, 46b, 47b, 910, 911, 912 and 913 (structures depicted in Table 3); B) (from left to right): 45b, 910 and chain elongated structures 930, 931, and 932 (structures depicted in Table 4).
- the present invention provides peptide conjugate compounds of the formula (I) as defined herein in the first aspect.
- the inventors have advantageously found that such conjugates have surprising immunogenic activity.
- the peptide conjugate compounds of formula (I) may be prepared using the methods and procedures described herein.
- Starting materials and/or intermediates useful in the methods may be prepared using known synthetic chemistry techniques (for example, the methods generally described in Louis F Fieser and Mary F, Reagents for Organic Synthesis v. 1-19, Wiley, New York (1967-1999 ed.) or Beilsteins Handbuch der organischen Chemie, 4, Aufl. Ed. Springer-Verlag Berlin, including supplements (also available via the Beilstein online database)) or, in some embodiments, may be commercially available.
- Preparation of the compounds may involve the protection and deprotection of various chemical groups.
- the need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by a person skilled in the art.
- Protecting groups and methods for protection and deprotection are well known in the art (see e.g. T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 3 rd Ed., Wiley & Sons, Inc., New York (1999)).
- compounds of formula (IF) that are compounds of formula (I) wherein w is 1, v is 0, and m is from 2 to 6, preferably 2 or 3 to 5, may be prepared via a method of the present invention involving the conjugation of an epoxide to an amino acid-comprising conjugation partner.
- the method comprises reacting an epoxide of the formula (XVI) and an amino acid-comprising conjugation partner comprising a thiol of the formula (III) under conditions effective to provide the compound of formula (XV) by conjugation of the thiol to the epoxide.
- the variables m, n, L1, Z1, R, R1, R2, R3, R4, R5, R6, R7, R8, R9, and A1 in the compound of formula (XV) are as defined in the compound of formula (IF) of the invention (including provisos (1) and/or (2) of the first aspect); and the method further comprises converting the compound of formula (XV) to the compound of formula (IF) of the invention by one or more additional synthetic steps.
- the amino acid-comprising conjugation partner may comprise a peptide that corresponds the peptide present in the compound of the formula (IF) of the invention produced by the method.
- the variables m, n, L1, Z1, R, R1, R2, R3, R4, R5, R6, R7, R8, R9, and A1 in the compound of formula (XV) are as defined in the compound of formula (IB) but excluding provisos (1) and (2) of the first aspect; and the method further comprises converting the compound of formula (XV) to a compound of formula (IF) but excluding provisos (1) and (2) of the first aspect by one or more additional synthetic steps; and coupling the compound to an amino acid or peptide to provide the compound of formula (IF) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conjugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (IF) of the invention produced by the method.
- the amino acid comprising conjugation partner reacted with the epoxide consists of an amino acid, for example an N ⁇ -amine protected and/or C-terminus protected cysteine.
- the amino acid comprising conjugation partner comprises a peptide, for example a short peptide.
- the amino acid comprising conjugation partner may comprise about 15 amino acid residues or less, for example 5, 4, or 3 amino acid residues.
- the N ⁇ -amino group of the amino acid comprising conjugation partner is preferably protected or otherwise substituted (i.e. is not in the form of a free amine —NH2 group) to prevent reaction during the conjugation reaction.
- the C-terminus of the amino acid comprising conjugation partner may also be protected.
- X10 in the compound of formula (XVI) may be a protected hydroxyl, thiol, amine, or carbamate group (P10-O—, P11-S—, P12-NR—, or P12-NRC(O)O—, respectively) from which L1-Z1- and L2-Z2- may subsequently be formed.
- the protecting group may be removed in the conjugation reaction to provide a compound of the formula (XV) wherein X11 is the corresponding deprotected group.
- X10 is a P10-O— group conjugation may provide the corresponding hydroxyl group as X11 in the compound of formula (XV).
- the epoxide of formula (XVI) comprises a stereogenic centre at the carbon atom to which R3 is attached.
- a single stereoisomer of the epoxide or a stereoisomerically enriched mixture of the epoxide may used in the reaction to control the stereochemistry of the carbon atom to which R3 is attached in the compound of formula (XV) and subsequent products formed, including the compound of formula (IF).
- Various methods for providing enantiopure or enantioenriched mixtures of epoxides are known in the art.
- providing the single stereoisomer or a stereoisomerically enriched mixture of the epoxide of formula (XVI) comprises resolving a racemic mixture of the epoxide.
- resolving a racemic epoxide mixture by kinetic hydrolysis as described by Jacobsen et al, Science, 1997, 277, 936-938.
- the epoxide of formula (XVI) may be provided by reacting an alkene of the formula (XVII) with an oxidant under conditions effective to epoxidise the alkene.
- an oxidant under conditions effective to epoxidise the alkene.
- Numerous methods for epoxidising alkenes are known in the art.
- the epoxidation is carried out by reacting the alkene with a peroxide or an organic N-oxide as the oxidant.
- suitable peroxides include organic peroxides, for example m-chloro peroxybenzoic acid.
- N-oxides include, for example, pyridine N-oxide and the like.
- Other suitable oxidants will be apparent to those skilled in the art.
- the reaction may be carried out in a liquid reaction medium comprising a suitable solvent, for example dichloromethane.
- Alkenes of the formula (XVII) may be commercially available or prepared from commercially available precursors
- X10 groups may be susceptible to oxidation in the epoxidation reaction, for example when X10 comprises an amine group (which may form an N-oxide) or thioether group (which may form e.g. sulfoxides or sulfones). Such groups may be protected during the reaction to prevent oxidation or reduced back to the desired group at an appropriate point in the synthetic sequence after the epoxidation reaction has been carried out.
- the epoxide of formula (XVI) may be prepared by treating a compound of formula (XVII-A), wherein LG is a suitable leaving group such as a halogen, with a base in a suitable solvent to displace the leaving group as shown in scheme A2.
- Compounds of the formula (XVII-A) may be commercially available or may be prepared from commercially available precursors.
- the compound of formula (XVII-A) may be prepared from an enantiopure ⁇ -amino acid. The epoxidation reaction proceeds stereospecifically with inversion of stereochemistry at the carbon to which R3 is attached.
- the compound of formula (XVII-A1) which corresponds to a compound of formula (XVII-A) wherein m is 2 and R1 and R2, and R3, R4, and R5 are hydrogen, X10 is —OH, and LG is bromo, may be prepared from L-aspartic acid (see Volkmann, R. A. et al. J. Org. Chem., 1992, 57, 4352-4361).
- L-Aspartic acid may be converted to be bromosuccinic acid (AA-1) by, for example, treatment with sodium nitrite and a strong acid such as sulfuric acid, to generate nitrous acid in situ, in the presence of sodium bromide at a temperature from ⁇ 10 to 0° C.
- the reaction proceeds stereospecifically with overall retention of stereochemistry.
- Reduction of bromosuccinic acid (AA-1) to bromodiol (XVII-A1) may be carried out using a suitable reductant, for example by treatment with borane or borane-dimethyl sulfide complex in THF at ⁇ 78° C. allowing the reaction mixture to warm to room temperature.
- Epoxidation to provide the compound of formula (XVI-1a) may be carried out by reacting bromodiol (XVII-A1) with a base, for example cesium carbonate in dichloromethane at room temperature. As noted above, the reaction proceeds stereospecifcally with overall inversion of stereochemistry.
- the opposite enantiomer of epoxide (XVI-1a) can be prepared from D-aspartic acid by the same procedure.
- the compound of formula (XV) may be subsequently converted by one or more synthetic steps to compound of the formula (IF) as defined in either method (A) or (B).
- the hydroxyl group bound to the carbon to which R3 is attached is converted to an L2-Z2- group.
- the one or more steps also comprises converting X11 to L1-Z1-.
- the L1-Z1- and L2-Z2- groups may be introduced simultaneously or sequentially in any order.
- the one or more steps comprises acylating the compound of formula (XV) so as to replace the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(O)—.
- X10 is P10-O— or OH; and X11 is P10-O— or OH.
- X11 is P10-O— or OH; and the one or more synthetic steps comprise acylating the compound of formula (XV) so as to replace P10 or the hydrogen atom of the hydroxyl group of X11 with L1-C(O)—; and/or the hydrogen atom of the hydroxyl group bound to the carbon to which R3 is attached with L2-C(O)—.
- the method comprises reacting an epoxide of formula (XVI-1) bearing a protected hydroxyl group with an amino acid comprising conjugation partner of the formula (III) to provide a compound of the formula (XV-1a).
- the conjugation reaction may be carried out under acidic conditions by reacting the epoxide and thiol in the presence of an acid, for example hydrochloric acid, sulfuric acid, or a mixture thereof.
- the reaction may be carried out in a liquid reaction medium comprising a suitable solvent, such as dichloromethane, at a temperature from about ⁇ 10 to about 50° C., for example from 0 to 40° C.
- the hydroxyl protecting group P10 is selected such that it is removable under the conditions effective for conjugation and is therefore removed during the conjugation reaction to provide the desired diol of formula (XV-1a).
- Suitable protecting groups will be apparent to those skilled in the art and may include, for example, acid labile silyl protecting groups.
- the conjugation reaction may be carried using an epoxide of the formula (XVI) wherein X10 is a hydroxyl group, such as the epoxide of formula (XVI-1a).
- the diol of the formula (XV-1a) may be converted to the compound of formula (IF-1) by reaction with the compounds of formula (VI-1) and (VI), wherein X is OH or a suitable leaving group (for example a halide, such as chloro or bromo), under conditions effective for esterification.
- X is OH or a suitable leaving group (for example a halide, such as chloro or bromo), under conditions effective for esterification.
- the conditions effective for esterification depend on the nature of the compound of formula (IV) and/or (VI-1).
- a base such as DMAP
- activating agent such as N,N′-diisopropylcarbodiinnide (DIC) in a liquid medium comprising a suitable solvent, such as THF.
- the compound of formula (VI) and (VI-1) are identical.
- the compound of formula (VI) and (VI-1) may each be palmitic acid.
- conversion of the diol of formula (XV-1a) to the compound of formula (IF-1) may be accomplished in a single step.
- different L1 and L2 groups may be introduced by reacting the diol with a stoichiometric amount of a compound of formula (VI-1) or (VI) to esterify the more reactive of the two alcohols, and then reacting the resultant ester with the other a compound of formula (VI) or (VI-1) to esterify the second alcohol of the diol.
- the method comprises reacting an epoxide of formula (XVI-1) and an amino acid comprising conjugation partner of the formula (III) to provide a compound of the formula (XV-1b) as shown in Scheme A4 below.
- the hydroxyl protecting group P10 is stable and is not removed under the conjugation reaction conditions.
- the protected alcohol of the formula (XV-1b) provides ready access to compounds of formula (IF-1) wherein L1 and L2 are different.
- Using the compound of formula (XV-1b) to access such compounds, rather than the diol of formula (XV-1a), may be more convenient in certain embodiments, for example where there is poor selectivity between the alcohols of the diol of formula (XV-1a).
- the ⁇ -sulfanylhydroxyl group of the compound of formula (XV-1b) may be acylated with a compound of formula (VI) under conditions effective for esterification to provide protected ester (XVIII), then the protecting group P10 removed to provide the alcohol of formula (XIX).
- the conditions for removal of the protecting group depend on the protecting group used. For example, dilute HF may be used to remove silyl protecting groups, such as TBDMS, TBDPS, and the like.
- the alcohol of formula (XIX) may then be acylated with a compound of formula (VI-1) under conditions effective for esterification to provide the desired compound of formula (IF-1).
- hydroxyl groups for example those in the compounds of formulae (XV-1a), (XV-1b), and (XIX), may be converted to various other functional groups, such as thiols and amines, to provide access compounds of formula (I) bearing L1-Z1- and L2-Z2- groups other than esters.
- the compound of formula (XV-1b) can be used to prepare thioester and amide analogues of the compound of formula (IF-1), as shown below in Scheme A5.
- amide analogue (IF-3) the hydroxyl group in the compound of formula (XV-1b) may first be converted to an azide and then reduced to the corresponding amine.
- the reaction may be carried out under modified Mitsunobu conditions (e.g. L. Rokhum et al, J. Chem. Sci, 2012, 124, 687-691) using PPh 3 , I 2 , imidazole, and NaN 3 to provide the azide, and then PPh 3 to reduce azide to the amine.
- the azide may be obtained by first converting the hydroxyl group to a suitable leaving group, for example a tosyl or mesyl group, and then treating with NaN 3 .
- acylation reaction may be carried out by reacting a carboxylic acid of the formula (VI) in the presence of a base, for example DMAP, and an activating agent, for example DIC, in a suitable solvent such as THF.
- a base for example DMAP
- an activating agent for example DIC
- a suitable solvent such as THF
- Thioester analogue may be prepared by first reacting the compound of formula (XV-1b) under Mitsunobu conditions (e.g. PPh 3 , diethylazodicarboxylate (DEAD)) and trapping with the desired thioacid of formula (VI-2), for example thiopalmitic acid, to provide the compound of formula (XVIII-1)(see e.g. O. Schulze et al, Carbohydrate Res., 2004, 339, 1787-1802). Deprotection of the protecting group P10 and esterification of the resultant alcohol (XIX-1) provides the compound of the formula (IF-2).
- Mitsunobu conditions e.g. PPh 3 , diethylazodicarboxylate (DEAD)
- VEAD diethylazodicarboxylate
- VI-2 thiopalmitic acid
- Thioester and amide analgoues of bis-ester may also be prepared from the compound of formula (XIX), as shown in Scheme A6.
- the compound of formula (XIX) may be converted to the compound of formula (IF-4) by methods analogous to those described above for the conversion of the compound formula (XV-1b) to the compound of formula (XVIII-1).
- the compound of formula (XIX) may be converted to the compound of formula (IF-5) by methods analogous to those described above for the conversion of the compound of formula (XV-1b) to the compound of formula (XVIII-2).
- analogues of bis-ester (IF-1) may be prepared by replacing the compound of formula (XIX) in Scheme A6 with a compound of formula (XIX-1) or (XIX-2) and then following the synthetic sequences described.
- Compounds of formula (VI), (VI-1), (VI-2), and (VI-3) may be commercially available or prepared from commercially available precursors using standard synthetic chemistry techniques.
- the method comprises reacting an amino acid comprising conjugation partner of the formula (III) and an acetal of the formula (XXI), wherein LG is a suitable leaving group, under conditions effective to provide a compound of the formula (XX).
- the variables m, w, v, n, Rx, Ry, R1, R2, R3, R4, R5, R6, R7, R8, R9, and A1 in the compound of formula (XX) are as defined in the compound of formula (I) of the invention (including provisos (1) and/or (2) of the first aspect); and the method further comprises converting the compound of formula (XX) to the compound of formula (I) of the invention by one or more additional synthetic steps.
- the amino acid-comprising conjugation partner may comprise a peptide that corresponds the peptide present in the compound of the formula (I) of the invention produced by the method.
- the variables m, w, v, n, Rx, Ry, R1, R2, R3, R4, R5, R6, R7, R8, R9, and A1 in the compound of formula (XX) are as defined in the compound of formula (I) but excluding provisos (1) and (2) of the first aspect; and the method further comprises converting the compound of formula (XX) to a compound of formula (I) but excluding provisos (1) and (2) of the first aspect by one or more additional synthetic steps; and coupling the compound to an amino acid or peptide to provide the compound of formula (I) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conjugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (I) of the invention produced by the method.
- the amino acid comprising conjugation partner reacted with the acetal consists of an amino acid, for example an N ⁇ -amine protected and/or C-terminus protected cysteine.
- the amino acid comprising conjugation partner comprises a peptide, for example a short peptide.
- the amino acid comprising conjugation partner may comprise about 15 amino acid residues or less, for example 5, 4, or 3 amino acid residues.
- the N ⁇ -amino group of the amino acid comprising conjugation partner is preferably protected or otherwise substituted (i.e. is not in the form of a free amine —NH2 group) to prevent reaction during the conjugation reaction.
- the C-terminus of the amino acid comprising conjugation partner may also be protected.
- Suitable leaving groups include but are not limited to halo (for example chloro, bromo, or iodo) or sulfonate (for example a tosylate or mesylate). Other suitable leaving groups will be apparent to those skilled in the art.
- the size of the acetal ring in the compound of formula (XXI) may vary.
- the acetal ring may comprise from 5 to 7 ring atoms (i.e. may be a 5-7-membered cyclic acetal).
- the cyclic acetal is 6-membered. It will be appreciated that when the cyclic acetal is a 5-membered cyclic acetal, in order to provide a compound of the formula (I), w is at least 2 (such that the sum of m, v, and w is at least 3).
- the conjugation reaction may be carried out in the presence of a base.
- the reaction may be carried out in the presence of organic amine, in a suitable solvent, for example DMF, at a temperature of about 50° C.
- suitable organic amines include but are not limited to triethylamine, N-methylmorpholine, collidine, and the like.
- the compound of formula (XXI) may be provided in stereoisomerically pure form or a stereoisomerically enriched mixture by reacting stereoisomerically pure or a stereoisomerically enriched mixture of the compound of the compound of formula (XXII).
- stereoisomerically pure compounds of formula (XXII) are readily commercially available, such as (4R)- or (4S)-(2,2-dimethyl-1,3-dioxan-4-yl)-methanol.
- a compound of formula (XXII-B), wherein Pg is a suitable hydroxyl protecting group may be reacted with a compound of the formula (XXII-C1) to provide the acetal of formula (XXII-D), which may then be converted to the compound of formula (XXII) by removal of the protecting group Pg.
- the compound of formula (XXII-B) may be reacted with an acyclic acetal of the formula (XXII-C2), wherein Ro and Rp are each independently C1-4alkyl.
- the acetylisation reaction may be carried out using an acid, such as camphorsulfonic acid, in a suitable solvent, such as dichloromethane.
- a silyl ether protecting group such as TBDMS
- TBDMS tetrabutylammonium fluoride
- suitable solvent such as THF
- compounds of formula (XXI) may be prepared from compounds of formula (XXII) by reaction with a suitable precursor of the leaving group.
- a suitable precursor of the leaving group For example, tosylate or mesylate leaving groups may be prepared by reaction with tosyl chloride or mesyl chloride in the presence of a base and a suitable solvent, and an iodo leaving group may be prepared by reaction with PPh 3 and I 2 .
- the compound of formula (XX) may subsequently be converted by one or more synthetic steps to a compound of the formula (I) as defined in either method (A) or (B), for example a compound of the formula (IA).
- the one or more synthetic steps may comprise removing the acetal to provide a diol of the formula (XXIII-1).
- the hydroxyl group bound to the carbon to which R1 and R2 are attached in the compound of formula (XXIII-1) may be converted to L1-Z1-, and/or the hydroxyl group bound to the carbon to which Rx and Ry are attached may be converted to L2-Z2.
- the acetal in the compound of formula (XX) may be removed to provide the diol of formula (XXIII-1) by treatment with an acid such as p-toluene sulfonic acid in a solvent such as dichloromethane.
- the diol of formula (XXIII-1) may be converted to the bis-ester compound of formula (IA) via one or more acylation steps in a manner analogous to that described for the conversion of the compound of formula (XV-1a) to the compound of formula (IF-1).
- the one or more synthetic steps may comprise removing the acetal to provide a compound of the formula (XXIII-2) or (XXIII-3).
- the one or more steps may comprise converting the hydroxyl group bound to the carbon atom to which Rx and Ry are attached in the compound of formula (XXIII-2) to L2-Z2-, removing the RmRnCH- group to provide a hydroxyl group, and converting the hydroxyl group to L1-Z1; or converting the hydroxyl group bound to the carbon to which Rx and Ry are attached in the compound of formula (XXIII-2) to L1-Z1-, removing the RmRnCH- group to provide a hydroxyl group, and converting the hydroxyl group to L2-Z2-.
- Such methods advantageously allows allow the introduction of different L1-Z1 and L2-Z2- groups.
- the acetal in the compound of formula (XX) may be removed by, for example, treatment with a suitable reducing agent, for example diisobutylaluminium hydride (DIBAL).
- DIBAL diisobutylaluminium hydride
- the resulting compound of formula compound of formula (XXIII-2) may then be acylated with the compound of formula (VI) to introduce the desired L2-C(O)O— group.
- Removal of the RmRnCH- group to provide the compound of formula (XXV-2) may be carried out by hydrogenolysis (e.g. for a benzyl or p-methoxybenzyl group) or any other suitable method having regard to the nature of RmRnCH- group.
- the compound of formula (XXV-2) may then be converted to the compound of formula (IA) by acylating with the compound of formula (IV-1).
- the acylation steps may be carried out as described herein with respect to the preparation of the compound of formula (IF-1).
- Hydroxyl groups produced on removal of the acetal or RmRnCH- group such as those in the compounds formulae (XXIII-1), (XXIII-2), (XXIII-3), and (XXV-2), may be converted to various other functional groups, such as thiols and amines, to provide access compounds of formula (I) bearing other Z1 and Z2 groups.
- amide and thioester analogues of the bis-ester compound of formula (IA) may be prepared by methods analogous to those described above with respect to the amide and thioester analogues of the bis-ester compound of formula (IF-1).
- the present invention also provides a method for preparing compounds of formula (I) of the invention via a thiol-ene reaction.
- the method comprises reacting a first lipid-containing conjugation partner comprising a carbon-carbon double bond, a second lipid-containing conjugation partner a carbon-carbon double bond, and an amino acid-comprising conjugation partner comprising a thiol, under conditions effective to conjugate the first and second lipid-containing conjugation partners to the amino acid-comprising conjugation partner.
- Each lipid containing conjugation partner comprises and therefore in the reaction provides to the compound of formula (I) a lipid moiety one comprising L1, the other comprising L2.
- the thiol-ene reaction involves the addition of a thiol across a non-aromatic carbon-carbon double bond (i.e. hydrothiolation of the carbon-carbon double bond).
- the reaction proceeds via a free radical mechanism.
- radical generation gives rise to an electrophilic thiyl radical which propagates across the ene group of an alkene, forming a carbon-centred radical and chain transfer from an additional thiol molecule quenches the radical on carbon to give the final product.
- the inventors believe that in the method of the present invention, the thiol is conjugated to a carbon atom of the carbon-carbon double bond of the first lipid containing conjugation partner to form a carbon-centred radical, and that this carbon-centred radical, instead of being quenched, is then conjugated with a carbon atom of the carbon-carbon double bond of the second lipid-containing conjugation partner.
- the method thus provides amino acid- and peptide conjugates in which the sulfur atom from the thiol is conjugated to a carbon atom from the carbon-carbon double bond of the first lipid-containing conjugation partner, and a carbon atom from the carbon-carbon double bond of the first lipid-containing conjugation partner is conjugated to a carbon atom from the carbon-carbon double bond of the second lipid-containing conjugation partner.
- conjugation of the first and second lipid-containing conjugation partners to the amino acid-comprising conjugation partner provides the peptide conjugate of the formula (I) of the invention.
- the amino acid-comprising conjugation partner may comprise a peptide that corresponds the peptide present in the peptide conjugate of the formula (I) of the invention produced by the method.
- conjugation of the first and second lipid-containing conjugation partners to the amino acid-comprising conjugation partner provides an amino acid- or peptide-conjugate (of the formula (I) but excluding provisos (1) and (2) of the first aspect); and the method further comprises coupling the amino acid- or peptide-conjugate to an amino acid or peptide to provide the peptide conjugate of formula (I) of the invention (including proviso (1) and/or (2) of the first aspect).
- the amino acid-comprising conjugation partner may consist of an amino acid or may comprise a peptide that corresponds to a portion of the peptide present in the compound of formula (I) of the invention produced by the method.
- the first and second lipid containing conjugation partners may be the same or different. Those skilled in the art will appreciate that reacting different lipid containing conjugation partners at the same time may provide a mixture of (potentially up to four different) conjugates. Accordingly, in certain exemplary embodiments, the first and second lipid containing conjugation partners are the same.
- the thiolene reaction may be regioselective with respect to which carbon atom of the carbon-carbon double bond of the first lipid-containing conjugation partner is conjugated to the thiol and also with respect to which carbon atom of the carbon-carbon double bond of the second lipid-containing conjugation partner is conjugated to which carbon atom of the carbon-carbon double bond from the first lipid-containing conjugation partner.
- Those skilled in the art will appreciate that various regioisomers may be formed in the reaction.
- the method comprises reacting a first lipid containing conjugation partner of the formula (IIA) and a second lipid containing conjugation partner of the formula (IIB) with a thiol containing amino acid comprising conjugation partner (III) under conditions effective to provide a compound of the formula (IB) (Scheme C1).
- Ra, Rb, Rc, L1, L2, Z1, Z2, R1, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, A1, k, v, and n are as defined in the compound of formula (IB) of the present invention (including provisos (1) and/or (2) of the first aspect); and when the method is (B), Ra, Rb, Rc, L1, L2, Z1, Z2, R1, R2, Rx, Ry, R3, R4, R5, R6, R7, R8, R9, A1, k, v, and n are as defined in the compound of formula (IB) but excluding provisos (1) and (2) of the first aspect.
- the conditions effective for formation of the compound of formula (IB) may vary.
- the conditions effective for formation of the compound of formula (IB) may comprise carrying out the reaction with a stoichiometric excess of lipid containing conjugation partner to thiol, such as a stoichiometric ratio of the lipid containing conjugation partners (IIA) and (IIB) (combined) to amino acid-comprising conjugation partner of at least 7:1, for example 8:1, 9:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, or 70:1.
- the degree of conversion of the amino acid-comprising conjugation partner to the product compound of formula (IB) may vary. Preferably, at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, or 70% of the amino acid-comprising conjugation partner is converted to the compound of formula (IB). Conversion may be determined by HPLC.
- reaction of the alkene of formula (IA) with the thiol of formula (III) results in the formation of a carbon-centred radical of the formula (X), which is trapped with the second alkene of the formula (IIB), rather than quenched by abstraction of a proton from the thiol of another molecule of the formula (III), to provide the desired amino acid- or peptide conjugate.
- the reaction may result in the production of a mixture of stereoisomers as it may not be possible to control or influence the stereochemistry of bond formation between the carbon atom to which R3 is bound and the carbon atom to which Rb and Rc are bound owing to the radical intermediate generated in the course of the reaction.
- the reaction typically produces a mixture of epimers with respect to the carbon atom to which R3 is bound.
- the Z1 and Z2 in the lipid containing-conjugation partners are each —C(O)O—, and the compound of formula (I) formed in the thiolene method is a compound of formula (IC) as defined herein.
- the thiolene method of the present invention comprises reacting an amino acid-comprising conjugation partner comprising a structure of the formula (III) with lipid containing-conjugation partners of the formula (IIA) and (IIB) that are vinyl esters to provide a compound of the formula (ID).
- the reaction may be carried out, for example as described herein, by irradiating a reaction mixture comprising the amino acid comprising conjugation partner; lipid containing-conjugation partners; a photochemical initiator, such as DMPA.
- One or more additives may be included that reduce the formation of by products, such as a sterically hindered thiol (for example tert-butylmercaptan), an acid (for example TFA), or an organosilane (for example triisopropylsilane), or a combination of any two or more thereof.
- a sterically hindered thiol for example tert-butylmercaptan
- an acid for example TFA
- an organosilane for example triisopropylsilane
- the reaction is typically initiated by the generation of one or more free radicals in the reaction mixture.
- One or more free radicals may be generated in the method by any method known in the art.
- the free radicals may be generated thermally and/or photochemically.
- One or more free radical initiators may be used to initiate the generation of free radicals. Suitable free radical initiators include thermal initiators and photoinitiators.
- Free radicals are generated from thermal initiators by heating.
- the rate of degradation of the thermal initiator and resulting free radical formation depends on the initiator and the temperature at which the initiator is heated. Higher temperatures generally result in faster decomposition. A person skilled in the art will be able to select an appropriate temperature for heating the initiator without undue experimentation.
- thermal initiators include but are not limited to tert-amyl peroxybenzoate, 1,1′-azobis(cyclohexanecarbonitrile), 2,2′-azobisisobutyronitrile (AIBN), benzoyl peroxide, tert-butyl hydroperoxide, tert-butyl peracetate, tert-butyl peroxide, tert-butyl peroxybenzoate, tert-butylperoxy isopropyl carbonate, lauroyl peroxide, peracetic acid, and potassium persulfate.
- thermal initiators include but are not limited to tert-amyl peroxybenzoate, 1,1′-azobis(cyclohexanecarbonitrile), 2,2′-azobisisobutyronitrile (AIBN), benzoyl peroxide, tert-butyl hydroperoxide, tert-butyl peracetate, tert-butyl peroxide, tert-but
- Free radicals may be generated from photoinitiators by irradiation with light.
- the frequency of light necessary to induce degradation of the photoinitiators and free radical formation depends on the initiator.
- Many photoinitiators can be initiated with ultraviolet light.
- Light of a specific wavelength or wavelength range may be used to selectively irradiate the initiator, where the lipid-containing conjugation partners or amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, comprises photosensitive groups.
- a frequency of about 365 nm is used. Light of this frequency is generally compatible with the side chains of naturally occurring amino acids.
- photoinitiators include but are not limited to acetophenone, anisoin, anthraquinone, anthraquinone-2-sulfonic acid, benzil, benzoin, benzoin ethyl ether, benzoin isobutyl ether, benzoin methyl ether, benzophenone, 3,3′,4,4′-benzophenonetetracarboxylic dianhydride, 4-benzoylbiphenyl, 2-benzyl-2-(dimethylamino)-4′-morpholinobutyrophenone, 4′-bis(diethylamino)benzophenone, 4,4′-bis(dimethylamino)benzophenone, camphorquinone, 2-chlorothioxanthen-9-one, dibenzosuberenone, 2,2-diethoxyacetophenone, 4,4′-dihydroxybenzophenone, 2,2-dimethoxy
- the initiator is present in the reaction in a stoichiometric ratio relative to the starting material comprising the thiol of from about 20:1 to about 0.05:1, from about 10:1 to about 0.05:1, from about 5:1 to about 0.05:1, from about 3:1 to about 0.5:1.
- the lipid-containing conjugation partners and amino acid-comprising conjugation partner may be prepared using known synthetic chemistry techniques (for example, the methods generally described in Louis F Fieser and Mary F, Reagents for Organic Synthesis v. 1-19, Wiley, New York (1967-1999 ed.) or Beilsteins Handbuch der organischen Chemie, 4, Aufl. Ed. Springer-Verlag Berlin, including supplements (also available via the Beilstein online database)) or, in some embodiments, may be commercially available.
- lipid-containing conjugation partner compounds of the formula (IIA-1) may be prepared by reacting a compound of the formula (VI) wherein X is OH or a suitable leaving group with a compound of the formula (VII) wherein Y is H, a metal or metalloid, or acyl (for example, alkylcarbonyl) under conditions effective for esterification (or transesterification where Y is an acyl group) (Scheme C2).
- esterification or transesterification
- X is chloro and Y is H
- the reaction may be carried out in the presence of a base, such as pyridine or triethylamine, in a suitable solvent.
- the acid chloride may be converted in situ to a more reactive species (e.g. to the corresponding iodide, using sodium iodide).
- the temperature at which the reaction is carried out depends on the reactivity of the acid species and the solvent used.
- vinyl esters of the formula (IIA-1) may be produced by transesterification with vinyl acetate (itself produced industrially by the reaction of acetic acid and acetylene or acetic acid and ethylene over a suitable catalyst) using an acid or metal catalyst. See, for example, EP0376075A2 and S. K. Karmee, J. Oil Palm Res., 2012, 1518-1523.
- Vinyl esters of the formula (IIA-1) may also be prepared by the addition a carboxylic acid to a terminal acetylene in the presence of a catalyst (usually a palladium or ruthenium complex).
- a catalyst usually a palladium or ruthenium complex.
- Non-terminal acetylenes may also be reacted. See, for example, N. Tsukada, A. Takahashi, Y. Inoue, Tetrahedron Lett., 2011, 52, 248-250 and M. Rotem, Y. Shvo, J. Organometallic Chem. 1993, 448, 159-204.
- Lipid containing conjugation partner compounds of the formula (IIB-1) may be prepared in an analogous fashion, where the compounds of formula (IIA-1) and (IIB-1) are different.
- compounds of formula (VII) are also commercially available or may be prepared from commercially available precursors using standard synthetic chemistry techniques.
- the order in which the lipid-containing conjugation partners and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, and any other components present in the reaction mixture are introduced into the reaction vessel may vary.
- the reaction may be carried out as a one-pot procedure.
- the ratio of the lipid-containing conjugation partners to amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the reaction may vary.
- the mole ratio of the first lipid-containing conjugation partner and second lipid-containing conjugation partner combined (i.e. in total) to the amino acid-comprising conjugation partner is at least 7:1, for example 8:1, 9:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, or 70:1.
- the reaction may be carried out at any suitable temperature.
- the reaction is carried out at a temperature from about ⁇ 25° C. to about 200° C., from about ⁇ 10° C. to about 150° C., from about 0° C. to about 125° C., from about ambient temperature to about 100° C.
- the reaction is carried out at a temperature of less than about 200° C., less than about 175° C., less than about 150° C., less than about 125° C., or less than about 100° C.
- the reaction is carried out at a temperature above ambient temperature. In one embodiment, the reaction is carried out at a temperature from 40 to 200° C., from 50 to 150° C., from 60 to 100° C., from 65 to 90° C., or from 70 to 80° C. In some embodiments, the reaction is carried out at a temperature greater than 40° C., greater than 50° C., greater than 75° C., greater than 100° C., or greater than 150° C.
- the temperature at which the reaction is carried out may depend on how free radicals are generated in the reaction.
- the temperature used may be selected to control the rate of the reaction.
- the temperature may be adjusted during the course of the reaction to control the rate of the reaction.
- the reaction will generally be carried out at a temperature above ambient temperature. The temperature will depend on the reactivity of the species from which free radicals are generated.
- the reaction may be carried out, advantageously, at ambient temperature. In certain embodiments, it may be desirable to cool the reaction mixture to slow the rate of reaction or conversely heat the reaction mixture to increase the rate of reaction.
- the temperature at which the reaction is carried out may be controlled by heating or cooling the reaction mixture by suitable method known in the art. Heat may be applied to the reaction mixture, for example, using a heat exchanger within the reaction vessel, a heating jacket surrounding the reaction vessel, or by immersing the reaction vessel in a heated liquid (e.g. an oil or sand bath). In certain exemplary embodiments, the reaction mixture is heated by microwave irradiation.
- the progress of the reaction may be monitored by any suitable means, for example, by thin layer chromatography (TLC) or high performance liquid chromatorgraphy (HPLC).
- the reaction may be allowed to proceed to substantial completion, as monitored by the consumption of at least one of the starting materials.
- the reaction is allowed to proceed for a period of time from 1 minute to 7 days, 5 minutes to 72 hours, 10 minutes to 48 hours, 10 minutes to 24 hours.
- the reaction is allowed to proceed for a period of time less than 72 h, less than 48 h, less than 24 h, less than 12 h, less than 6 h, less than 4 h, less than 2 h, or less than 1 h.
- the reaction is carried out until at least about 50%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 99% of the amino acid-comprising conjugation partner has been consumed.
- the consumption of starting materials may be monitored by any suitable method, for example, HPLC.
- the reaction mixture may be mixed by any suitable method known in the art, for example, using a magnetic or mechanical stirrer.
- the method used may depend on the scale on which the reaction is carried out.
- the reaction is generally carried out in a liquid reaction medium.
- the liquid reaction medium may comprise a solvent.
- suitable solvents include N-methylpyrrolidone (NMP), dimethylformamide, dichloromethane, 1,2-dichloroethane, chloroform, carbon tetrachloride, water, methanol, ethanol, dimethylsulfoxide, trifluoroacetic acid, acetic acid, acetonitrile, and mixtures thereof.
- the solvent may be selected based on the solubility of the starting materials and other reactants present, for example the free radical initiator.
- the lipid-containing conjugation partners are hydrophobic.
- the hydrophobicity or hydrophilicity of an amino acid-comprising conjugation partner may vary depending on, for example, the amino acid sequence of the peptide of a peptide-containing conjugation partner.
- the presence of a solubilising group in the peptide-containing conjugation partner may increase solubility in polar solvents, such as water. A person skilled in the art will be able to select an appropriate solvent without undue experimentation.
- the reaction may be carried out under substantially oxygen-free conditions. Oxygen may quench free radicals formed in the reaction.
- the reaction mixture may be degassed with an inert gas (e.g. nitrogen or argon) that is substantially oxygen-free to remove any dissolved oxygen before free radicals are generated.
- individual components of the reaction mixture may be degassed with inert gas that is substantially oxygen-free prior to being combined in the reaction vessel.
- the reaction may be carried out under an atmosphere of inert gas that is substantially oxygen-free.
- the method of the present invention may be carried out at ambient pressure.
- An additive that inhibits the formation of undesirable by-products and/or that improves the yield of or conversion to the desired product may be included in the reaction mixture in the thiolene method of the present invention.
- the one or more additive may be an extraneous thiol, an acid, an organosilane, or a combination of any two or more thereof.
- an extraneous or exogenous thiol as an additive in the reaction mixture reduces the formation of undesirable by products.
- the extraneous thiol may, in some embodiments, increase the efficiency or conversion of the desired thiolene reaction.
- suitable extraneous thiols include but are not limited to reduced glutathione, DODT, DTT, protein, sterically hindered thiols, and the like.
- the extraneous thiol is DTT.
- the extraneous thiol is a sterically hindered thiol.
- a suitable sterically hindered extraneous thiol include tert-butyl mercaptan and 1-methylpropyl mercaptan.
- an extraneous thiol such as tert-butylmercaptan can provide a proton to quench the radical intermediate formed on propagation of the radical of formula (X) with the alkene of formula (IIB) to provide the desired compound of formula (IB) and the resulting thiyl radical can propagate the reaction by generating another mole of thiyl radical from the amino acid comprising conjugation partner of formula (III).
- extraneous thiols may in certain embodiments also be capable of prematurely quenching the reaction by providing a proton radical of formula (X).
- the extraneous thiol and the amount in which it is used may be selected such that the yield of or conversion to (as determined by HPLC) the compound of formula (IB) is optimised.
- the extraneous thiol is present in the reaction in a stoichiometric ratio relative to the amino acid comprising conjugation partner of from about 200:1 to about 0.05:1, 100:1 to 0.05:1, 80:1 to 0.05:1, 60:1 to 0.05:1, 40:1 to 0.05:1, 20:1 to about 0.05:1, 10:1 to about 0.5:1, 5:1 to about 1:1, or 3:1 to about 1:1.
- a sterically hindered thiol such as t-BuSH is present in the reaction in a stoichiometric ratio relative to the amino acid comprising conjugation partner of from about 100:1 to 0.05:1, for example about 80:1, about 40:1, or about 3:1.
- the inclusion of an acid in some embodiments may also reduce the formation of undesirable by-products.
- the acid may be a strong inorganic acid, for example HCl, or organic acid, for example TFA.
- the additive is TFA.
- the reaction mixture comprises from about 0.01 to 25, 0.01 to 15, 0.01 to 10, or 1 to 10% v/v acid additive.
- the reaction mixture comprises from 1-10% v/v TFA, for example 5% v/v TFA.
- the reaction mixture comprises a combination of an acid and an exogenous thiol, such as a combination of a strong organic acid and a sterically hindered thiol, for example a combination of TFA and tert-butyl mercaptan.
- Organosilanes are radical-based reducing agents, the activity of which can be modulated by varying the substituents on the silicon atom.
- the organosilane is a compound of the formula (R q ) 3 SiH, wherein Rq at each instance is independently hydrogen or an organic group, for example alkyl or aryl, provided that at least one Rq is not hydrogen.
- organosilanes include but are not limited to triethylsilane (TES), triphenylsilane, diphenylsilane, triisopropylsilane (TIPS), and the like.
- the organosilane is a trialkylsilane, for example TIPS or TES.
- an organosilane such as TIPS can act as a hydrogen donor to provide the desired compound of formula (IB) and promote propagation of the reaction.
- the organosilane is present in the reaction in a stoichiometric ratio relative to the amino acid comprising conjugation partner of from about 200:1 to about 0.05:1, 100:1 to 0.05:1, 80:1 to 0.05:1, 60:1 to 0.05:1, 40:1 to 0.05:1, 20:1 to 0.05:1, 10:1 to 0.5:1, 5:1 to about 1:1, or 3:1 to about 1:1.
- a trialkylsilane such as TIPS is present in the reaction in a stoichiometric ratio relative to the amino acid comprising conjugation partner of from about 100:1 to 0.05:1, for example about 80:1 or about 40:1.
- the organosilane may be used as an additive in combination with an extraneous thiol.
- the organosilane may be used instead of an extraneous thiol.
- An acid, such as TFA may also be present.
- TIPS in the reaction together with TFA but without any extraneous thiol can provide higher conversion to the desired compound of formula (IB) than when a combination of TIPS, t-BuSH, and TFA are used.
- the additive is generally used in an amount sufficient to minimise the formation of undesirable by products without adversely affecting the reaction or any, optional, subsequent steps in the method.
- the products formed in the reaction and conversion to the desired product may be determined by, for example, HPLC.
- the concentration of the lipid-containing conjugation partners and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, respectively, in the reaction mixture may also affect the reaction.
- concentration of the lipid-containing conjugation partners and peptide-containing conjugation partner in the reaction mixture may be varied to e.g. optimise yield and purity without undue experimentation.
- the starting material comprising the thiol is present in a concentration from about 0.05 mM to about 1 M, from about 0.5 mM to about 1 M, from about 1 mM to about 1 M. In some embodiments, the concentration is at least about 0.05 mM, 0.5 mM, or 1 mM.
- the concentration of the starting materials comprising the alkenes is at least about 0.05 mM, 0.5 mM, or 1 mM.
- the amino acid conjugate or peptide conjugate is separated from the reaction medium after the reaction and optionally purified.
- the conjugate may be separated from the reaction medium using any suitable method known in the art, for example, by precipitation.
- the amino acid or peptide conjugate is purified after separating it from the reaction medium.
- the conjugate may be purified by HPLC using one or more suitable solvents.
- the present invention also provides a method of making a peptide conjugate, the method comprising
- amino acid- or peptide conjugate of the formula (I) but excluding provisos (1) and (2) of the first aspect or a salt or solvate thereof may be provided by the methods described herein.
- the peptide conjugate produced by and/or the peptide-containing conjugation partner and/or the peptides coupled in the methods of the present invention may comprise a synthetic peptide.
- Synthetic peptides may be prepared using solid phase peptide synthesis (SPPS).
- SPPS solid phase peptide synthesis
- the amino acid to be coupled to the resin is protected at its Na-terminus by a chemical protecting group.
- the amino acid may also have a side-chain protecting group.
- Such protecting groups prevent undesired or deleterious reactions from taking place during the process of forming the new peptide bond between the carboxyl group of the amino acid to be coupled and the unprotected N ⁇ -amino group of the peptide chain attached to the resin.
- the amino acid to be coupled is reacted with the unprotected N ⁇ -amino group of the N-terminal amino acid of the peptide chain, increasing the chain length of the peptide chain by one amino acid.
- the carboxyl group of the amino acid to be coupled may be activated with a suitable chemical activating agent to promote reaction with the N ⁇ -amino group of the peptide chain.
- the N ⁇ -protecting group of N-terminal amino acid of the peptide chain is then removed in preparation for coupling with the next amino acid residue. This technique consists of many repetitive steps making automation attractive whenever possible.
- peptides may be coupled to the Na-amino group of the solid phase bound amino acid or peptide instead of an individual amino acid, for example where a convergent peptide synthesis is desired.
- the peptide is cleaved from the solid phase support at the linker molecule.
- SPPS may be carried out using a continuous flow method or a batch flow method.
- Continuous flow permits real-time monitoring of reaction progress via a spectrophotometer, but has two distinct disadvantages—the reagents in contact with the peptide on the resin are diluted, and scale is more limited due to physical size constraints of the solid phase resin.
- Batch flow occurs in a filter reaction vessel and is useful because reactants are accessible and can be added manually or automatically.
- Two types of protecting groups are commonly used for protecting the N-alpha-amino terminus: “Boc” (tert-butyloxycarbonyl) and “Fmoc” (9-fluorenylmethyloxycarbonyl).
- Reagents for the Boc method are relatively inexpensive, but they are highly corrosive and require expensive equipment and more rigorous precautions to be taken.
- the Fmoc method which uses less corrosive, although more expensive, reagents is typically preferred.
- the solid phase support used for synthesis can be a synthetic resin, a synthetic polymer film or a silicon or silicate surface (e.g. controlled pore glass) suitable for synthesis purposes.
- a resin is used, commonly polystyrene suspensions, or polystyrene-polyethyleneglycol, or polymer supports for example polyamide.
- resins functionalized with linkers suitable for Boc-chemistry include PAM resin, oxime resin SS, phenol resin, brominated Wang resin and brominated PPOA resin.
- resins suitable for Fmoc chemistry include amino-methyl polystyrene resins, AMPB-BHA resin, Sieber amide resin, Rink acid resin, Tentagel S AC resin, 2-chlorotrityl chloride resin, 2-chlorotrityl alcohol resin, TentaGel S Trt-OH resin, Knorr-2-chlorotrityl resin, hydrazine-2-chlorotrityl resin, ANP resin, Fmoc photolable resin, HMBA-MBHA resin, TentaGel S HMB resin, Aromatic Safety Catch resinBAl resin and Fmoc-hydroxylamine 2 chlorotrityl resin.
- Other resins include PL Cl-Trt resin, PL-Oxime resin and PL-HMBA Resin. Generally resins are interchangeable.
- Preparation of the solid phase support includes solvating the support in an appropriate solvent (e.g. dimethylformamide).
- an appropriate solvent e.g. dimethylformamide.
- the solid phase typically increases in volume during solvation, which in turn increases the surface area available to carry out peptide synthesis.
- Linker molecules are then attached to the support for connecting the peptide chain to the solid phase support.
- Linker molecules are generally designed such that eventual cleavage provides either a free acid or amide at the C-terminus.
- Linkers are generally not resin-specific. Examples of linkers include peptide acids for example 4-hydroxymethylphenoxyacetyl-4′-methylbenzyhydrylamine (HMP), or peptide amides for example benzhydrylamine derivatives, or the hydroxymethylphenoxypropionyl (HMPP) linker.
- HMP 4-hydroxymethylphenoxyacetyl-4′-methylbenzyhydrylamine
- HMPP hydroxymethylphenoxypropionyl
- the first amino acid of the peptide sequence may be attached to the linker after the linker is attached to the solid phase support or attached to the solid phase support using a linker that includes the first amino acid of the peptide sequence.
- Linkers that include amino acids are commercially available.
- the next step is to deprotect the N ⁇ -amino group of the first amino acid.
- deprotection of the N ⁇ -amino group may be carried out with a mild base treatment (piperazine or piperidine, for example). Side-chain protecting groups may be removed by moderate acidolysis (trifluoroacetic acid (TFA), for example).
- TFA trifluoroacetic acid
- deprotection of the N ⁇ -amino group may be carried out using for example TFA.
- the amino acid chain extension, or coupling proceeds by the formation of peptide bonds.
- This process requires activation of the C- ⁇ -carboxyl group of the amino acid to be coupled. This may be accomplished using, for example, in situ reagents, preformed symmetrical anhydrides, active esters, acid halides, or urethane-protected N-carboxyanhydrides. The in situ method allows concurrent activation and coupling.
- Coupling reagents include carbodiimide derivatives, for example N,N′-dicyclohexylcarbodiinnide or N,N-diisopropylcarbodiimide.
- Coupling reagents also include uronium or phosphonium salt derivatives of benzotriazol.
- uronium and phosphonium salts include HBTU (O-1H-benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate), BOP (benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate), PyBOP (Benzotriazole-1-yl-oxy-tripyrrolidinophosphonium hexafluorophosphate), PyAOP, HCTU (O-(1H-6-chloro-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), TCTU (O-1H-6-chlorobenzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetra
- the peptide is cleaved from the resin.
- the conditions used in this process depend on the sensitivity of the amino acid composition of the peptide and the side-chain protecting groups. Generally, cleavage is carried out in an environment containing a plurality of scavenging agents to quench the reactive carbonium ions that originate from the protective groups and linkers. Common cleaving agents include, for example, TFA and hydrogen fluoride (HF).
- cleaving agents include, for example, TFA and hydrogen fluoride (HF).
- the conditions used for cleaving the peptide from the resin may concomitantly remove one or more side-chain protecting groups.
- protective groups in SPPS is well established.
- Examples of common protective groups include but are not limited to acetamidomethyl (Acm), acetyl (Ac), adamantyloxy (AdaO), benzoyl (Bz), benzyl (Bzl), 2-bromobenzyl, benzyloxy (BzlO), benzyloxycarbonyl (Z), benzyloxymethyl (Bonn), 2-bromobenzyloxycarbonyl (2-Br-Z), tert-butoxy (tBuO), tert-butoxycarbonyl (Boc), tert-butoxymethyl (Bum), tert-butyl (tBu), tert-buthylthio (tButhio), 2-chlorobenzyloxycarbonyl (2-Cl-Z), cyclohexyloxy (cHxO), 2,6-dichlorobenzyl (2,6-DiCI-Bzl), 4,4′-d
- additional protective groups may be necessary.
- Mtr, Pmc, Pbf may be used for the protection of Arg
- Trt, Tmob may be used for the protection of Asn and Gln
- Boc may be used for the protection of Trp and Lys
- tBu may be used for the protection of Asp, Glu, Ser, Thr and Tyr
- Acm, tBu, tButhio, Trt and Mmt may be used for the protection of Cys.
- the peptide may be separated from the reaction medium, e.g. by centrifugation or filtration.
- the peptide may then be subsequently purified, e.g. by HPLC using one or more suitable solvents.
- the inventors have found that in some embodiments the peptide-containing conjugation partner may be used in the methods of the present invention without purification following cleavage of the peptide from the resin.
- the thiolene method of the present invention can be carried out using a peptide-containing conjugation partner, wherein the peptide does not contain an N ⁇ -amino group protecting group or any side chain protecting groups.
- the reaction is generally selective for reaction of a thiol and a non-aromatic carbon-carbon double bond.
- thiol groups present in the peptide-containing conjugation partner e.g. in cysteine residues of the peptide
- the thiol groups may be protected with a protective group that is not removable under the conditions used to remove one or more other protecting groups present in the peptide or to cleave the peptide from the resin.
- the peptide will be synthesised using amino acids bearing the appropriate protecting groups.
- a person skilled in the art will be able to select appropriate protecting groups without undue experimentation.
- the amino acid-comprising conjugation partner and/or lipid-containing conjugation partners may comprise one or more unsaturated carbon-carbon bonds in addition to the carbon-carbon double bonds of the lipid containing conjugation partners to be reacted.
- selectivity of the thiol for the carbon-carbon double bond to be reacted in such embodiments may depend on, for example, the steric and/or electronic environment of the carbon-carbon double bond relative to the one or more additional unsaturated carbon-carbon bonds.
- the carbon-carbon double bonds to be reacted are activated relative to any other unsaturated carbon-carbon bonds in the amino acid-comprising conjugation partner and lipid-containing conjugation partner.
- the carbon-carbon double bonds to be reacted are activated relative to any other unsaturated carbon-carbon bonds in the peptide-containing conjugation partner and lipid-containing conjugation partner.
- the N ⁇ -amino group of the amino acid of the amino acid-comprising conjugation partner comprising the thiol is acylated, for example acetylated.
- the methods of the present invention may comprise acylating, for example acetylating, the N ⁇ -amino group of the amino acid of the amino acid-comprising conjugation partner comprising the carbon-carbon double bond or thiol to be reacted.
- acylation may be carried out prior to or after cleavage from the resin.
- the amino acid residue of the peptide-containing conjugation partner bearing the thiol to be reacted is an N-terminal amino acid residue, for example cysteine, and the method comprises acylating the N-terminal amino group prior to cleaving the peptide.
- the method further comprises acylating, for example acetylating, the N ⁇ -amino group of the amino acid of the amino acid conjugate or the amino acid residue of the peptide conjugate to which the lipid moieties are conjugated.
- Acylation of the N ⁇ -amino group of an amino acid may be carried out by reacting an amino acid or peptide with an acylating agent in the presence of base in a suitable solvent, for example DMF.
- acylating agents include acid halides, for example acid chlorides such as acetyl chloride, and acid anhydrides, for example acetic anhydride. Such agents maybe commercially available or may be prepared by methods well known in the art.
- suitable bases include triethylamine, diisopropylethylamine, 4-methylmorpholine, and the like.
- the synthesising the peptide of the peptide-containing conjugation partner comprises coupling an amino acid or a peptide comprising an amino acid that is acylated, for example acetylated, at the N ⁇ -amino group and comprises the thiol to be reacted to one or more amino acids and/or one or more peptides.
- the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate. In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or peptide bound to a solid phase resin support by SPPS. In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to a peptide bound to a solid phase resin support by SPPS. The method may comprise synthesising the peptide bound to the solid phase resin support by SPPS.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
- the peptide to be coupled comprises a peptide epitope.
- a peptide epitope is formed on coupling. The coupling may be carried out by SPPS as described herein.
- the method comprises coupling the amino acid of the amino acid conjugate to a peptide bound to a solid phase resin support by SPPS so as to provide a peptide conjugate comprising a peptide epitope.
- the peptide of the peptide conjugate to be coupled is bound to a solid phase resin support, and the method comprises coupling an amino acid of the peptide conjugate to be coupled to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
- the method comprises coupling an amino acid of the peptide conjugate to an amino acid or peptide bound to a solid phase resin support by SPPS so as to provide peptide conjugate comprising a peptide epitope.
- the method further comprises coupling an epitope, for example a peptide epitope, to the amino acid conjugate or peptide conjugate.
- an epitope for example a peptide epitope
- the coupling may be carried out by SPPS as described herein.
- the epitope for example a peptide epitope
- the linker group is an amino sequence, for example a sequence of two or more, three or more, or four or more contiguous amino acids.
- the linker comprises from about 2 to 20, 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, 4 to 20, 4 to 18, 4 to 16, 4 to 14, 4 to 12, or 4 to 10 amino acids.
- coupling an amino acid or a peptide to another amino acid or peptide as described herein may comprise forming a peptide bond between the N ⁇ -terminus of the amino acid or an amino acid of the peptide of one coupling partner and the C-terminus of the amino acid or an amino acid of the peptide of the other coupling partner.
- the method of the present invention comprises synthesising the amino acid sequence of the peptide of the peptide-containing conjugation partner by SPPS; and reacting the peptide-containing conjugation partner.
- the method of the present invention comprises synthesising the amino acid sequence of the peptide of the peptide-containing conjugation partner by SPPS; and reacting the lipid-containing conjugation partners with the peptide-containing conjugation partner.
- synthesising the amino acid sequence of the peptide of the peptide-containing conjugation partner by SPPS comprises coupling an amino acid or peptide to an amino acid or peptide bound to a solid phase resin support to provide the amino acid sequence of the peptide or a portion thereof.
- the amino acid sequence of the entire peptide of the peptide-containing conjugation partner is synthesised by SPPS.
- the peptide-containing conjugation partner may be reacted, for example with the lipid-containing conjugation partners in the thiolene method, while bound to a solid phase resin support.
- the peptide may be cleaved from the solid phase resin support, and optionally purified, prior to reaction, for example with the lipid-containing conjugation partners.
- the peptide conjugate and/or amino acid-comprising conjugation partner may comprise one or more solubilising groups.
- the one or more solubilising groups increase the solubility of, for example, the peptide-containing conjugation partner in polar solvents, such as water.
- the solubilising group does not adversely affect the biological activity of the peptide conjugate.
- a solubilising group may be advantageous for formulation and/or administration of the peptide conjugate as a pharmaceutical composition.
- the solubilising group is bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner. In some embodiments, the solubilising group is bound to the peptide of the peptide-containing conjugation partner. In some embodiments, the peptide of the peptide conjugate and/or the peptide of the peptide-containing partner comprises a solubilising group. In some embodiments, the peptide of the peptide-containing partner comprises a solubilising group.
- the solubilising group is bound to the side chain of an amino acid in the peptide chain. In some embodiments, the solubilising group is bound to the C- or N-terminus of the peptide chain. In some embodiments, the solubilising group is bound between two amino acid residues in the peptide chain. In some embodiments, the solubilising group is bound to the N ⁇ -amino group of one amino acid residue in the peptide chain and the carboxyl group of another amino acid residue in the peptide chain. Examples of suitable solubilising groups include, but are not limited to, hydrophilic amino acid sequences or polyethylene glycols (PEGs).
- the solubilising group is a hydrophilic amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In some embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. Such solubilising groups may be formed by adding each amino acid of the solubilising group to the peptide chain by SPPS.
- the solubilising group is a polyethylene glycol.
- the polyethylene glycol is bound to the N ⁇ -amino group of one amino acid residue in the peptide chain and the carboxyl group of another amino acid residue in the peptide chain.
- the polyethylene glycol comprises from about 1 to about 100, about 1 to about 50, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 15, about 1 to about 10, about 2 to about 10, or about 2 to about 4 ethylene glycol monomer units.
- Methods for coupling polyethylene glycols to peptides are known.
- the peptide conjugate and/or peptide-containing conjugation partner comprises an antigen, for example, an antigenic peptide.
- the peptide of the peptide conjugate or peptide-containing conjugation partner is or comprises an antigen; or an antigen is bound to peptide, optionally via a linker.
- the peptide-containing conjugation partner comprises an antigen, for example, an antigenic peptide.
- the peptide of the peptide-containing conjugation partner is or comprises an antigen; or an antigen is bound to peptide, optionally via a linker.
- the antigen comprises a peptide comprising an epitope. In one embodiment, the peptide comprising an epitope is a glycopeptide comprising an epitope. In one embodiment, the antigen comprises a glycopeptide comprising an epitope.
- the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide of the peptide-containing conjugation partner comprises an epitope.
- the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes, for example, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes.
- the peptide conjugate and/or peptide-containing conjugation partner is or comprises a glycopeptide comprising an epitope. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner is a glycopeptide. In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises a glycopeptide comprising an epitope bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner. In some embodiments, the peptide-containing conjugation partner is or comprises a glycopeptide comprising an epitope. In some embodiments, the peptide of the peptide-containing conjugation partner is a glycopeptide. In some embodiments, the peptide-containing conjugation partner comprises a glycopeptide comprising an epitope bound to the peptide of the peptide-containing conjugation partner.
- the peptide conjugate and/or peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide of the peptide-containing conjugation partner comprises a proteolytic cleavage site.
- the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises one or more linker groups. In some embodiments, the peptide of the peptide-containing conjugation partner comprises one or more linker groups.
- the peptide conjugate and/or peptide-containing conjugation partner comprises a linker group. In some embodiments, the peptide-containing conjugation partner comprises a linker group.
- the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner via a linker group. In some embodiments, the peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide-containing conjugation partner via a linker group.
- linker groups include but are not limited to amino acid sequences (for example, a peptide), polyethylene glycol, alkyl amino acids, and the like.
- the linker is or comprises a proteolytic cleavage site.
- the linker is or comprises a solubilising group.
- the linker is bound between two amino acid residues in the peptide chain.
- the linker group is bound to the N ⁇ -amino group of one amino acid residue in the peptide conjugate and/or peptide-containing conjugation partner and the carboxyl group of another amino acid residue in the peptide-containing conjugation partner. In some embodiments, the linker group is bound to the N ⁇ -amino group of one amino acid residue in the peptide-containing conjugation partner and the carboxyl group of another amino acid residue in the peptide-containing conjugation partner.
- the linker group is cleavable in vivo from the amino acids to which it is bound. In certain embodiments, the linker group is cleavable by hydrolysis in vivo. In certain embodiments, the linker group is cleavable by enzymatic hydrolysis in vivo. Linker groups may be introduced by any suitable method known in the art.
- the method may further comprise coupling an epitope to the amino acid of the amino acid conjugate or the peptide of the peptide conjugate.
- the epitope may be bound via a linker group, as described above.
- the epitope is a peptide epitope.
- the method comprises coupling a glycopeptide comprising an epitope.
- the peptide conjugates of the invention maintain appropriate uptake, processing, and presentation by antigen presenting cells.
- the lipid-containing conjugate does not interfere with presentation of any antigenic peptide present in the conjugate by antigen presenting cells.
- Confirmation of the identity of the peptides synthesized may be conveniently achieved by, for example, amino acid analysis, mass spectrometry, Edman degradation, and the like.
- the method of the present invention may further comprise separating the amino acid conjugate from the liquid reaction medium.
- the method of the present invention may further comprise separating the peptide conjugate from the liquid reaction medium. Any suitable separation methods known in the art may be used, for example, precipitation and filtration.
- the conjugate may be subsequently purified, for example, by HPLC using one or more suitable solvents.
- the present invention also relates to peptide conjugates made by the methods of the present invention.
- the peptide conjugates may be pure or purified, or substantially pure.
- purified does not require absolute purity; rather, it is intended as a relative term where the material in question is more pure than in the environment it was in previously. In practice the material has typically, for example, been subjected to fractionation to remove various other components, and the resultant material has substantially retained its desired biological activity or activities.
- substantially purified refers to materials that are at least about 60% free, preferably at least about 75% free, and most preferably at least about 90% free, at least about 95% free, at least about 98% free, or more, from other components with which they may be associated during manufacture.
- ⁇ -amino acid refers to a molecule containing both an amino group and a carboxyl group bound to a carbon which is designated the ⁇ -carbon.
- Suitable amino acids include, without limitation, both the D- and L-isomers of the naturally-occurring amino acids, as well as non-naturally occurring amino acids prepared by organic synthesis or other metabolic routes. Unless the context specifically indicates otherwise, the term amino acid, as used herein, is intended to include amino acid analogs.
- the peptide-containing conjugation partner comprises only natural amino acids.
- naturally occurring amino acid refers to any one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
- amino acid analog or “non-naturally occurring amino acid” refers to a molecule which is structurally similar to an amino acid and which can be substituted for an amino acid.
- Amino acid analogs include, without limitation, compounds which are structurally identical to an amino acid, as defined herein, except for the inclusion of one or more additional methylene groups between the amino and carboxyl group (e.g., ⁇ -amino ⁇ -carboxy acids), or for the substitution of the amino or carboxy group by a similarly reactive group (e.g., substitution of the primary amine with a secondary or tertiary amine, or substitution or the carboxy group with an ester or carboxamide).
- peptide and the like is used herein to refer to any polymer of amino acid residues of any length.
- the polymer can be linear or non-linear (e.g., branched), it can comprise modified amino acids or amino acid analogs.
- the term also encompasses amino acid polymers that have been modified naturally or by intervention, for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other modification or manipulation, for example conjugation with labeling or bioactive components.
- peptide conjugates of the present invention have immunological activity.
- T-lymphocytes primarily mediated by T-lymphocytes.
- Pathogenic antigens are expressed on the surface of antigen presenting cells (such as macrophages, B-lymphocytes, and dendritic cells), bound to either major histocompatibility MHC Class I or MHC Class II molecules. Presentation of pathogenic antigen coupled to MHC Class II activates a helper (CD4+) T-cell response. Upon binding of the T-cell to the antigen-MHC II complex, CD4+ T-cells, release cytokines and proliferate.
- antigen presenting cells such as macrophages, B-lymphocytes, and dendritic cells
- CD8+ cytotoxic T-cell response.
- CD8+ cells Upon binding of the T-cell to the antigen-MHC I complex, CD8+ cells secrete perforin and other mediators, resulting in target cell death.
- CD8+ cells secrete perforin and other mediators, resulting in target cell death.
- exemplary methods include those in which the presence of or the level of one or more cytokines associated with a cell-mediated response, such as those identified herein, is assessed.
- cell-based methods to assess or monitor the onset and progression of a cell-mediated response are amenable to use in the present invention, and may include cell proliferation or activation assays, including assays targeted at identifying activation or expansion of one or more populations of immune cells, such as T-lymphocytes.
- methods of the invention elicit both a cell-mediated immune response and a humoral response.
- the humoral immune response is mediated by secreted antibodies produced by B cells.
- the secreted antibodies bind to antigens presented on the surface of invading pathogens, flagging them for destruction.
- TLRs Toll like receptors
- TLRs Toll-like receptors
- PRRs pattern recognition receptors
- TLR2 is a cell-surface receptor expressed on a range of different cell types, including dendritic cells, macrophages and lymphocytes (Coffman, R. L., Sher, A., Seder, R. A., Immunity 2010, 33, 492-503).
- TLR2 recognises a wide range of microbial components including lipopolysaccharides, peptidoglycans and lipoteichoic acid. It is unique amongst TLRs in that it forms heterodimers, with either TLR1 or TLR6; the ability to form complexes with other PRRs may explain the wide range of agonists for TLR2 (Feldmann, M., Steinman, L., Nature 2005, 435, 612-619). Upon ligand binding and heterodimerisation, signalling takes place via the MyD88 pathway, leading to NF ⁇ B activation and consequent production of inflammatory and effector cytokines.
- Di- and triacylated lipopeptides derived from bacterial cell-wall components have been extensively studied as TLR2 agonists (Eriksson, E. M. Y., Jackson, D. C., Curr. Prot. and Pept. Sci. 2007, 8, 412-417). Lipopeptides have been reported to promote dendritic cell maturation, causing the up-regulation of co-stimulatory molecules on the cell surface and enhanced antigen-presentation. Lipopeptides have also been reported to stimulate macrophages to release cytokines and promote the activation of lymphocytes including B cells and CD8+ T cells.
- the peptide conjugate has TLR2 agonist activity.
- S-(2,3-bis(palmitoyloxy)-(2RS)-propyl)-N-palmitoyl-(R-)-Cys-Lys-Lys-Lys-Lys-OH (Pam3CSK4) is a potent TLR2 agonist and may be selected as benchmark against which the TLR2 agonism of the peptide conjugate compounds of the invention may be compared.
- the peptide conjugate has a TLR2 agonist potency from 1,000, 100, or 10 fold less than of the potency of Pam3CSK4 to 1,000, 100, or 10 fold more than the potency of Pam3CSK4.
- the peptide conjugate has TLR2 agonist activity comparable to Pam3CSK4. In some embodiments, the peptide conjugate has TLR2 agonist activity at least about 50%, about 60%, about 70%, about 80%, about 90% that of Pam3CSK4. In some embodiments, the peptide conjugate has TLR2 agonist activity greater than that of Pam3CSK4. For example, in some embodiments, the peptide conjugate has TLR2 agonist activity greater than 100%, 150%, 200%, or 500%. In other embodiments, the peptide conjugate has TLR2 agonist activity 10 fold or 100 fold greater than that of Pam3CSK4.
- the peptide conjugate has TLR2 agonist activity less than that of Pam3CSK4.
- the peptide conjugate has TLR2 agonist activity less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, less than about 1%, or less than 0.1% that of Pam3CSK4.
- the TLR2 agonist activity is determined using a Hek-BlueTM cell assay (for example, by following a procedure analogous to that described in the Examples herein).
- the TLR2 is murine TLR2 or human TLR2. In certain exemplary embodiments, the TLR2 (mTLR2) is human TLR2 (hTLR2).
- the peptide conjugate has an EC 50 for TLR2 agonism (preferably hTLR2) of less than about 500 nM as determined using a HEK-BlueTM cell assay (for example, by following a procedure analogous to that described in the Examples herein), for example less than about 400, 300, 250, 200, 175, 150, 125, 100, 75, 50, 25, 20, 15, 10, 5, 4, 3, 2.5, 2, 1.5, 1, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2 or 0.1 nM, and useful ranges may be selected from any two of these values, for example from about 0.1 nM to 500 nM, 0.1 nM to 150 nM, or 0.1 nM to 10 nM.
- TLR2 agonism preferably hTLR2 agonism
- the peptide conjugate has an EC 50 for TLR2 agonism (preferably hTLR2) of at least about 0.01 nM as determined using a HEK-BlueTM cell assay (for example, by following a procedure analogous to that described in the Examples herein), for example at least 0.05, 0.1, 0.5, 1, 1.5, or 2 nM, and useful ranges may be selected from any two of these values, for example from about 0.01 nM to 2 nM, 0.01 nM to 1.5 nM, or 0.01 nM to 1 nM.
- TLR2 agonism preferably hTLR2 agonism
- the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises a serine amino acid residue adjacent to the amino acid through which the lipid moieties are conjugated to the peptide.
- the serine is bound to the C-termini of the amino acid. The presence of the serine amino acid residue in this position may enhance TLR2 binding.
- the peptide conjugate may comprise an epitope, including, for example two or more epitopes.
- the epitope may be coupled or bound to the peptide via a linker group.
- the epitope is a peptide epitope.
- a person skilled in the art will appreciate that a wide range of peptide epitopes may be employed in the present invention.
- tumour antigens or antigens from various pathogenic organisms have been characterised and are suitable for use in the present invention. All antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- the conjugates of the present invention find application in a wide range of immunotherapies, including but not limited to the treatment and prevention of infectious disease, the treatment and prevention of cancer, and the treatment of viral re-activation during or following immunosuppression, for example in patients who have had bone marrow transplants or haematopoietic stem cell transplants.
- antigens comprising one or more amino acid substitutions, such as one or more conservative amino acid substitutions.
- a “conservative amino acid substitution” is one in which an amino acid residue is replaced with another residue having a chemically similar or derivatised side chain.
- Families of amino acid residues having similar side chains, for example, have been defined in the art. These families include, for example, amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalan
- Amino acid analogs e.g., phosphorylated or glycosylated amino acids
- peptides substituted with non-naturally occurring amino acids including but not limited to N-alkylated amino acids (e.g. N-methyl amino acids), D-amino acids, 3-amino acids, and ⁇ -amino acids.
- a “fragment” of a peptide is a subsequence of the peptide that performs a function that is required for the enzymatic or binding activity and/or provides three dimensional structure of the peptide, such as the three dimensional structure of a polypeptide.
- variant refers to peptide sequences, including for example peptide sequences different from the specifically identified sequences, wherein one or more amino acid residues is deleted, substituted, or added. Variants are naturally-occurring variants, or non-naturally occurring variants. Variants are from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, variants of peptides including peptides possess biological activities that are the same or similar to those of the wild type peptides.
- variant with reference to peptides encompasses all forms of peptides as defined herein.
- conjugates of the present invention are in certain embodiments particularly suited for stimulating T-cell responses, for example in the treatment of neoplastic diseases, including cancer.
- Conjugates of the present invention comprising one or more tumour antigens are specifically contemplated. It will be appreciated that tumour antigens contemplated for use in the preparation of peptide conjugates of the invention will generally comprise one or more peptides. In certain embodiments of the invention, including for example pharmaceutical compositions of the invention, one or more additional tumour antigens may be present, wherein the one or more tumour antigens does not comprise peptide.
- Tumour antigens are typically classified as either unique antigens, or shared antigens, with the latter group including differentiation antigens, cancer-specific antigens, and over-expressed antigens. Examples of each class of antigens are amenable to use in the present invention. Representative tumour antigens for use in the treatment, for example immunotherapeutic treatment, or vaccination against neoplastic diseases including cancer, are discussed below. Compounds, vaccines and compositions comprising one or more antigens prepared using those methods of immunisation are specifically contemplated.
- the tumour antigen is a peptide-containing tumour antigen, such as a polypeptide tumour antigen or glycoprotein tumour antigens.
- the tumour antigen is a saccharide-containing tumour antigen, such as a glycolipid tumour antigen or a ganglioside tumour antigen.
- the tumour antigen is a polynucleotide-containing tumour antigen that expresses a polypeptide-containing tumour antigen, for instance, an RNA vector construct or a DNA vector construct, such as plasmid DNA.
- Tumour antigens appropriate for the use in the present invention encompass a wide variety of molecules, such as (a) peptide-containing tumour antigens, including peptide epitopes (which can range, for example, from 8-20 amino acids in length, although lengths outside this range are also common), lipopolypeptides and glycoproteins, (b) saccharide-containing tumour antigens, including poly-saccharides, mucins, gangliosides, glycolipids and glycoproteins, including and (c) polynucleotides that express antigenic polypeptides.
- peptide-containing tumour antigens including peptide epitopes (which can range, for example, from 8-20 amino acids in length, although lengths outside this range are also common), lipopolypeptides and glycoproteins
- saccharide-containing tumour antigens including poly-saccharides, mucins, gangliosides, glycolipids and glycoproteins, including and (c) polynucleotides that express
- one or more conjugates comprises a tumour antigen that does not itself comprise peptide, but for example is bound to the amino acid-comprising or peptide-containing conjugation partner, are contemplated.
- compositions of the invention in which one or more tumour antigens that does not itself comprise peptide is present are contemplated.
- the tumour antigens are, for example, (a) full length molecules associated with cancer cells, (b) homologues and modified forms of the same, including molecules with deleted, added and/or substituted portions, and (c) fragments of the same, provided said fragments remain antigenic or immunogenic.
- the tumour antigens are provided in recombinant form.
- the tumour antigens include, for example, class I-restricted antigens recognized by CD8+ lymphocytes or class II-restricted antigens recognized by CD4+ lymphocytes.
- tumor antigens include synthetic peptides comprising class I-restricted antigens recognized by CD8+ lymphocytes or class II-restricted antigens recognized by CD4+ lymphocytes.
- Shared tumour antigens are generally considered to be native, unmutated sequences that are expressed by tumours due to epigenetic changes that allow de-repression of developmentally-repressed genes. Accordingly, shared antigens are typically considered preferable to over-expressed or differentiation-associated antigens because there is no expression in normal tissues. Also, the same antigens can be targeted in a number of cancer patients. For example, the cancer-testis antigen NY-ESO-1 is present in the majority of patients with many tumours, and a sizeable minority of patients with other tumours. In another example, breast differentiation tumour antigens NYBR-1 and NYBR-1.1 are found in a proportion of breast cancer sufferers. Shared tumour antigens thus represent an attractive target for development.
- cancer-testis antigens including NY-ESO-1, CTSP-1, CTSP-2, CTSP-3, CTSP-4, SSX2, and SCP1, and breast cancer antigens NYBR-1 and NYBR-1.1, in conjugates of the present invention is specifically contemplated herein.
- the peptide of the peptide-containing conjugation partner or of the peptide conjugate comprises one or more epitopes derived from NY-ESO-1. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 79-116. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 118-143. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 153-180.
- the peptide of the peptide-containing conjugation partner or of the peptide conjugate comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous, 10 or more contiguous, 12 or more contiguous, 15 or more contiguous, 20 or more contiguous, or 25 or more contiguous amino acids from any one of SEQ ID NOs: 9 to 28.
- the peptide comprises more that one amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 9 to 28. In one embodiment, the peptide comprises one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 12-15, 20, 21, and 26-28.
- the prostate vaccine Sipuleucel-T (APC8015, ProvengeTM), which comprises the antigen prostatic acid phosphatase (PAP), is present in 95% of prostate cancer cells. At least in part due to this potential for efficacy in a significant proportion of prostate cancer sufferers, Sipuleucel-T was approved by the FDA in 2010 for use in the treatment of asymptomatic, hormone-refractory prostate cancer. The use of PAP antigen in conjugates of the present invention is specifically contemplated in the present invention.
- Unique antigens are considered to be those antigens that are unique to an individual or are shared by a small proportion of cancer patients, and typically result from mutations leading to unique protein sequences.
- Representative examples of unique tumour antigens include mutated Ras antigens, and mutated p53 antigens.
- the methods of the present invention enable the ready preparation of conjugates comprising one or more unique tumour antigens, for example to elicit specific T-cell responses to one or more unique tumour antigens, for example in the preparation of patient-specific therapies.
- representative tumour antigens include, but are not limited to, (a) antigens such as RAGE, BAGE, GAGE and MAGE family polypeptides, for example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3, MAGE-4, MAGE-5, MAGE-6, and MAGE-12 (which can be used, for example, to address melanoma, lung, head and neck, NSCLC, breast, gastrointestinal, and bladder tumours), (b) mutated antigens, for example, p53 (associated with various solid tumours, for example, colorectal, lung, head and neck cancer), p21/Ras (associated with, for example, melanoma, pancreatic cancer and colorectal cancer), CDK4 (associated with, for example, melanoma), MUM1 (associated with, for example, melanoma), caspase-8 (associated with, for example, head and neck cancer), CIA 0205 (associated with, for example, bladder cancer), HLA-A2-R
- tumour antigens amenable to use in the present invention include TAG-72, (See, e.g., U.S. Pat. No. 5,892,020; human carcinoma antigen (See, e.g., U.S. Pat. No. 5,808,005); TP1 and TP3 antigens from osteocarcinoma cells (See, e.g., U.S. Pat. No. 5,855,866); Thomsen-Friedenreich (TF) antigen from adenocarcinoma cells (See, e.g., U.S. Pat. No. 5,110,911); KC-4 antigen from human prostrate adenocarcinoma (See, e.g., U.S. Pat. No.
- TAG-72 See, e.g., U.S. Pat. No. 5,892,020
- human carcinoma antigen See, e.g., U.S. Pat. No. 5,808,005
- carcinoma or orosomucoid-related antigen See, e.g., U.S. Pat. No. 4,914,021); T and Tn haptens in glycoproteins of human breast carcinoma, MSA breast carcinoma glycoprotein; MFGM breast carcinoma antigen; DU-PAN-2 pancreatic carcinoma antigen; CA125 ovarian carcinoma antigen; YH206 lung carcinoma antigen, Alphafetoprotein (AFP) hepatocellular carcinoma antigen; Carcinoembryonic antigen (CEA) bowel cancer antigen; Epithelial tumour antigen (ETA) breast cancer antigen; Tyrosinase; the raf oncogene product; gp75; gp100; EBV-LMP 1 & 2; EBV-EBNA 1, 2 & 3C; HPV-E4, 6, 7; C017-1A; GA733; gp72; p53; proteinase 3; telomerase; and melanoma gangli
- the tumour antigens are derived from mutated or altered cellular components.
- altered cellular components include, but are not limited to ras, p53, Rb, altered protein encoded by the Wilms' tumour gene, ubiquitin, mucin, protein encoded by the DCC, APC, and MCC genes, as well as receptors or receptor-like structures such as neu, thyroid hormone receptor, platelet derived growth factor (PDGF) receptor, insulin receptor, epidermal growth factor (EGF) receptor, and the colony stimulating factor (CSF) receptor.
- PDGF platelet derived growth factor
- EGF epidermal growth factor
- CSF colony stimulating factor
- Polynucleotide-containing antigens used in the present invention include polynucleotides that encode polypeptide tumour antigens such as those listed above.
- the polynucleotide-containing antigens include, but are not limited to, DNA or RNA vector constructs, such as plasmid vectors (e.g., pCMV), which are capable of expressing polypeptide tumour antigens in vivo.
- the present invention also contemplates the preparation of conjugates comprising viral antigens that are capable of stimulating T-cell to elicit effective anti-viral immunity in patients who are or have been immunosuppressed, for example patients who have had bone marrow transplants, haematopoietic stem cell transplants, or are otherwise undergoing immunosuppression.
- antigens derived from viruses associated with increased incidence of cancer or that are reported to be cancer-causing, such as human papillomavirus, hepatitis A virus, and hepatitis B virus, are contemplated for use in the present invention.
- the tumour antigens include, but are not limited to, p15, Hom/Mel-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, human papillomavirus (HPV) antigens, including E6 and E7, hepatitis B and C virus antigens, human T-cell lymphotropic virus antigens, TSP-180, p185erbB2, p180erbB-3, c-met, mn-23H1, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, p16, TAGE, PSCA, CT7, 43-9F, 5T4, 791 Tgp72, beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29 ⁇ BCAA), CA 195, CA 242, CA-50, CAM43, CD68 ⁇ KP1,
- the tumour antigens include viral proteins implicated in oncogenesis, such as antigens from Epstein Barr virus, human papillomavirus (HPV), including E6 and E7, and hepatitis B and C, and human T-cell lymphotropic virus.
- viral proteins implicated in oncogenesis such as antigens from Epstein Barr virus, human papillomavirus (HPV), including E6 and E7, and hepatitis B and C, and human T-cell lymphotropic virus.
- viral proteins as well as various other viral proteins can also be targets for T cell activity in, for example, treatment against viral disease.
- the present invention may be useful in any infection where T cell activity is known to play a role in immunity (effectively all virus infections and many bacterial infections as well, such as tuberculosis).
- infectious diseases described herein are provided by way of example only and are in no way intended to limit the scope of the invention. It will be appreciated that the present invention may be useful in the treatment of various other diseases and conditions.
- antigens for use in vaccination against pathogenic organisms are discussed below.
- Compounds, vaccines and compositions comprising one or more antigens prepared using those methods of immunisation are specifically contemplated.
- M. tuberculosis antigens have been characterised and are suitable for use in the present invention. All M. tuberculosis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- Exemplary M. tuberculosis antigens suitable for use include early secretary antigen target (ESAT)-6, Ag85A, Ag85B (MPT59), Ag85B, Ag85C, MPT32, MPT51, MPT59, MPT63, MPT64, MPT83, MPB5, MPB59, MPB64, MTC28, Mtb2, Mtb8.4, Mtb9.9, Mtb32A, Mtb39, Mtb41, TB10.4, TB10C, TB11B, TB12.5, TB13A, TB14, TB15, TB15A, TB16, TB16A, TB17, TB18, TB21, TB20.6, TB24, TB27B, TB32, TB32A, TB33, TB38, TB40.8, TB51, TB54, TB64, CFP6, CFP7, CFP7A, CFP7B, CFP8A, CFP8B, CFP9
- hepatitis antigens have been characterised and are suitable for use in the present invention.
- Exemplary hepatitis C antigens include C—p22, E1—gp35, E2—gp70, NS1—p7, NS2—p23, NS3—p70, NS4A—p8, NS4B—p27, NS5A—p56/58, and NS5B—p68, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All hepatitis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- influenza antigens have been characterised and are suitable for use in the present invention.
- Exemplary influenza antigens suitable for use in the present invention include PB, PB2, PA, any of the hemagglutinin (HA) or neuraminidase (NA) proteins, NP, M, and NS, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All influenza antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- a number of B. anthracis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- PA83 is one such antigen for vaccine development.
- AZA FDA licensed vaccine for anthrax
- BioThrax® BioThrax®. This vaccine is derived from the cell-free supernatant of a non-encapsulated strain of B. anthracis adsorbed to aluminum adjuvant.
- PA is the primary immunogen in AVA.
- anthrax antigens suitable for use in the present invention include Protective antigen (PA or PA63), LF and EF (proteins), poly-gamma-(D-glutamate) capsule, spore antigen (endospore specific components), BcIA (exosporium specific protein), BxpB (spore-associated protein), and secreted proteins. All anthrax antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- F. tularensis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- AcpA and IgIC are antigens suitable for vaccine development.
- Other exemplary Tularemia antigens suitable for use in the present invention include 0-antigen, CPS, outer membrane proteins (e.g. FopA), lipoproteins (e.g. Tul4), secreted proteins and lipopolysaccharide. All tularemia antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- a number of B. abortusis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- Omp16 is one such antigen for vaccine development.
- Other exemplary Brucellosis antigens suitable for use in the present invention include O-antigen, lipopolysaccharide, outer membrane proteins (e.g. Omp16), secreted proteins, ribosomal proteins (e.g.
- N. meningitidis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- Cys6, PorA, PorB, FetA, and ZnuD are antigens suitable for vaccine development.
- Other exemplary Meningitis antigens suitable for use in the present invention include 0-antigen, factor H binding protein (fHbp), TbpB, NspA, NadA, outer membrane proteins, group B CPS, secreted proteins and lipopolysaccharide. All meningitis antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- Flavivirus antigens have been identified as potential candidates for vaccine development to treat dengue fever and are useful in the present invention.
- dengue virus envelope proteins E1-E4 and the membrane proteins M1-M4 are antigens suitable for vaccine development.
- Other exemplary dengue antigens suitable for use in the present invention include C, preM, 1, 2A, 2B, 3, 4A, 4B and 5. All dengue antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- a number of ebola virus antigens have been identified as potential candidates for vaccine development to treat ebola infection and are useful in the present invention.
- Filoviridae Zaire ebolavirus and Sudan ebolavirus virion spike glycoprotein precursor antigens ZEBOV-GP, and SEBOV-GP, respectively are suitable for vaccine development.
- Other exemplary ebola antigens suitable for use in the present invention include NP, vp35, vp40, GP, vp30, vp24 and L. All ebola antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- Flavivirus envelope antigen (E) from West Nile virus (WNV) is a non-toxic protein expressed on the surface of WNV virions (WNVE) and are suitable for vaccine development.
- WNV antigens suitable for use in the present invention include Cp, Prm, NS1, NS2A, NS2B, NS3, NS4A, NS4B and NS5.
- the present invention also relates to pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
- compositions may comprise an effective amount of two or more peptide conjugates of the invention in combination.
- pharmaceutical compositions may comprise one or more peptide conjugates of the invention and one or more peptides as described herein.
- pharmaceutically acceptable carrier refers to a carrier (adjuvant or vehicle) that may be administered to a subject together with the peptide conjugate of the present invention, or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
- compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d- ⁇ -tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, poly
- Cyclodextrins such as ⁇ -, ⁇ -, and ⁇ -cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl-O-cyclodextrins, or other solubilized derivatives may also be advantageously used to enhance delivery.
- Oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents, which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
- compositions are formulated to allow for administration to a subject by any chosen route, including but not limited to oral or parenteral (including topical, subcutaneous, intramuscular and intravenous) administration.
- compositions may be formulated with an appropriate pharmaceutically acceptable carrier (including excipients, diluents, auxiliaries, and combinations thereof) selected with regard to the intended route of administration and standard pharmaceutical practice.
- an appropriate pharmaceutically acceptable carrier including excipients, diluents, auxiliaries, and combinations thereof
- the compositions may be administered orally as a powder, liquid, tablet or capsule, or topically as an ointment, cream or lotion.
- suitable formulations may contain additional agents as required, including emulsifying, antioxidant, flavouring or colouring agents, and may be adapted for immediate-, delayed-, modified-, sustained-, pulsed- or controlled-release.
- compositions may be formulated to optimize bioavailability, immunogenicity, or to maintain plasma, blood, or tissue concentrations within the immunogenic or therapeutic range, including for extended periods. Controlled delivery preparations may also be used to optimize the antigen concentration at the site of action, for example.
- compositions may be formulated for periodic administration, for example to provide continued exposure.
- Strategies to elicit a beneficial immunological response for example those that employ one or more “booster” vaccinations, are well known in the art, and such strategies may be adopted.
- compositions may be administered via the parenteral route.
- parenteral dosage forms include aqueous solutions, isotonic saline or 5% glucose of the active agent, or other well-known pharmaceutically acceptable excipients.
- Cyclodextrins for example, or other solubilising agents well-known to those familiar with the art, can be utilized as pharmaceutical excipients for delivery of the therapeutic agent.
- dosage forms suitable for oral administration include, but are not limited to tablets, capsules, lozenges, or like forms, or any liquid forms such as syrups, aqueous solutions, emulsions and the like, capable of providing a therapeutically effective amount of the composition.
- Capsules can contain any standard pharmaceutically acceptable materials such as gelatin or cellulose.
- Tablets can be formulated in accordance with conventional procedures by compressing mixtures of the active ingredients with a solid carrier and a lubricant. Examples of solid carriers include starch and sugar bentonite. Active ingredients can also be administered in a form of a hard shell tablet or a capsule containing a binder, e.g., lactose or mannitol, a conventional filler, and a tabletting agent.
- dosage forms suitable for transdermal administration include, but are not limited, to transdermal patches, transdermal bandages, and the like.
- dosage forms suitable for topical administration of the compositions include any lotion, stick, spray, ointment, paste, cream, gel, etc., whether applied directly to the skin or via an intermediary such as a pad, patch or the like.
- dosage forms suitable for suppository administration of the compositions include any solid dosage form inserted into a bodily orifice particularly those inserted rectally, vaginally and urethrally.
- Examples of dosage of forms suitable for injection of the compositions include delivery via bolus such as single or multiple administrations by intravenous injection, subcutaneous, subdermal, and intramuscular administration or oral administration.
- dosage forms suitable for depot administration of the compositions include pellets of the peptide conjugates or solid forms wherein the peptide conjugates are entrapped in a matrix of biodegradable polymers, microemulsions, liposomes or are microencapsulated.
- infusion devices for the compositions include infusion pumps for providing a desired number of doses or steady state administration, and include implantable drug pumps.
- implantable infusion devices for compositions include any solid form in which the peptide conjugates are encapsulated within or dispersed throughout a biodegradable polymer or synthetic, polymer such as silicone, silicone rubber, silastic or similar polymer.
- dosage forms suitable for transmucosal delivery of the compositions include depositories solutions for enemas, pessaries, tampons, creams, gels, pastes, foams, nebulised solutions, powders and similar formulations containing in addition to the active ingredients such carriers as are known in the art to be appropriate.
- dosage forms include forms suitable for inhalation or insufflation of the compositions, including compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixture thereof and/or powders.
- Transmucosal administration of the compositions may utilize any mucosal membrane but commonly utilizes the nasal, buccal, vaginal and rectal tissues.
- Formulations suitable for nasal administration of the compositions may be administered in a liquid form, for example, nasal spray, nasal drops, or by aerosol administration by nebulizer, including aqueous or oily solutions of the polymer particles.
- Formulations may be prepared as aqueous solutions for example in saline, solutions employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bio-availability, fluorocarbons, and/or other solubilising or dispersing agents known in the art.
- Examples of dosage forms suitable for buccal or sublingual administration of the compositions include lozenges, tablets and the like.
- dosage forms suitable for opthalmic administration of the compositions include inserts and/or compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents.
- compositions including vaccines
- sweetman S. C. (Ed.). Martindale. The Complete Drug Reference, 33rd Edition, Pharmaceutical Press, Chicago, 2002, 2483 pp.; Aulton, M. E. (Ed.) Pharmaceutics. The Science of Dosage Form Design. Churchill Livingstone, Edinburgh, 2000, 734 pp.; and, Ansel, H. C., Allen, L. V. and Popovich, N. G. Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th Ed., Lippincott 1999, 676 pp.
- Excipients employed in the manufacture of drug delivery systems are described in various publications known to those skilled in the art including, for example, Kibbe, E. H.
- the USP also provides examples of modified-release oral dosage forms, including those formulated as tablets or capsules. See, for example, The United States Pharmacopeia 23/National Formulary 18, The United States Pharmacopeial Convention, Inc., Rockville Md., 1995 (hereinafter “the USP”), which also describes specific tests to determine the drug release capabilities of extended-release and delayed-release tablets and capsules.
- the USP test for drug release for extended-release and delayed-release articles is based on drug dissolution from the dosage unit against elapsed test time. Descriptions of various test apparatus and procedures may be found in the USP.
- Extended release oral dosage forms development, evaluation, and application of in vitro/in vivo correlations. Rockville, Md.: Center for Drug Evaluation and Research, Food and Drug Administration, 1997).
- composition may comprise one or more extrinsic adjuvants, advantageously in some embodiments this is not necessary.
- the peptide conjugate comprises an epitope and is self adjuvanting.
- the present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate of the present invention.
- the present invention also relates to a peptide conjugate of the invention for vaccinating or eliciting an immune response in a subject, and to use of a peptide conjugate of the invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention also provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of the present invention.
- the present invention also relates to a pharmaceutical composition of the invention for vaccinating or eliciting an immune response in a subject, and to the use of one or more peptide conjugates of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention also provides a method of activating TLR2 in a subject comprising administering to the subject an effective amount of one or more peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof, or an effective amount of a pharmaceutical composition of the invention.
- the present invention also provides use of one or more peptide conjugate compounds of the invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the invention in the manufacture of a medicament for activating TLR2 in a subject and one or more peptide conjugate compounds of the invention or a pharmaceutically acceptable salt or solvate thereof or a pharmaceutical composition of the invention in a subject for activating TLR2 in a subject.
- Activating TLR2 can stimulate and/or elicit an immune response in the subject, and, in some embodiments, provide immunity.
- peptides described herein and/or one or more peptide conjugates of the present invention for example one or more peptide described herein in together with one or more peptide conjugates, for vaccinating or eliciting an immune response in the subject is contemplated herein.
- two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are administered or used, the two or more peptide conjugates, or one or more peptides and one or more peptide conjugates may be administered or used simultaneously, sequentially, or separately.
- a “subject” refers to a vertebrate that is a mammal, for example, a human. Mammals include, but are not limited to, humans, farm animals, sport animals, pets, primates, mice and rats. The subject may be in need of said vaccinating, eliciting an immune response, or activating TLR2.
- an “effective amount” is an amount sufficient to effect beneficial or desired results including clinical results.
- An effective amount can be administered in one or more administrations by various routes of administration.
- the effective amount will vary depending on, among other factors, the disease indicated, the severity of the disease, the age and relative health of the subject, the potency of the compound administered, the mode of administration and the treatment desired. A person skilled in the art will be able to determine appropriate dosages having regard to these any other relevant factors.
- compositions can be evaluated both in vitro and in vivo.
- the composition can be tested in vitro or in vivo for its ability to induce a cell-mediated immune response.
- the composition can be fed to or injected into an animal (e.g., a mouse) and its effects on eliciting an immune response are then assessed. Based on the results, an appropriate dosage range and administration route can be determined.
- the composition may be administered as a single dose or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule.
- eliciting an immune response comprises raising or enhancing an immune response.
- eliciting an immune response comprises eliciting a humoral and a cell mediated response.
- eliciting an immune response provides immunity.
- the immune response is elicited for treating a disease or condition.
- a person skilled in the art will appreciate that the peptide conjugates described herein are useful for treating a variety of diseases and conditions, depending, for example, on the nature of epitope.
- the diseases or conditions are selected from those associated with the various antigens described herein.
- the disease or condition is an infectious disease, cancer, or viral re-activation post-bone marrow transplant or following induction of profound immunosuppression for any other reason.
- treatment relates generally to treatment, of a human or a non-human subject, in which some desired therapeutic effect is achieved.
- the therapeutic effect may, for example, be inhibition, reduction, amelioration, halt, or prevention of a disease or condition.
- compositions may be used to elicit systemic and/or mucosal immunity.
- Enhanced systemic and/or mucosal immunity may be reflected in an enhanced TH1 and/or TH2 immune response.
- the enhanced immune response may include an increase in the production of IgG1 and/or IgG2a and/or IgA.
- This example describes the synthesis of diastereomerically pure amino acid conjugates 6A and 6B.
- Diastereomerically pure amino acid conjugates 6A and 6B may be prepared using enantiopure epoxide 102A or enantiopure epoxide 102B produced stereospecifically from an enantiomerically pure starting material.
- Enantiopure epoxide 102A and enantiopure epoxide 102B were prepared from L-aspartic acid and D-aspartic acid, respectively, by following the procedure described in Volkmann, R. A. et al. J. Org. Chem., 1992, 57, 4352-4361 for the preparation of (R)-(2-hydroxyethyl)oxirane (102A) from L-aspartic acid.
- (R)-2-Bromosuccinic acid was prepared by following the procedure described above for the preparation of (S)-2-bromosuccinic acid, but using D-aspartic acid instead of L-aspartic acid. [ ⁇ ] D 20.2 +66.5 (c 0.2 in EtOAc). The remaining spectroscopic data was identical to that observed for (S)-2-bromosuccinic acid.
- (R)-2-Bromo-1,4-butanediol was prepared by following the procedure described above for the preparation of (S)-2-bromo-1,4-butanediol, but using (R)-2-bromosuccinic acid instead of (S)-2-bromosuccinic acid. [ ⁇ ] D 21.3 +20.0 (c 0.17 in CHCl 3 ). The remaining spectroscopic data was identical to that observed for (S)-2-bromo-1,4-butanediol.
- (S)-(2-Hydroxyethyl)oxirane (102B) was prepared by following the procedure described above for the preparation of (R)-(2-hydroxyethyl)oxirane (102A), but using (R)-2-bromo-1,4-butanediol instead of (S)-2-bromo-1,4-butanediol. [ ⁇ ] D 22.9 ⁇ 35.2 (c 0.23 in CHCl 3 ). The remaining spectroscopic data was identical to that observed for (S)-2-bromo-1,4-butanediol.
- Diastereomerically pure diol 103A was also converted to diastereomerically pure conjugate 6A by following procedures analogous to the representative procedures described below.
- diester 201A (0.35 g, 0.364 mmol) in trifluoroacetic acid (2 mL) is allowed to stir at r.t. for 1 h after which the mixture is concentrated in vacuo.
- the crude is purified by flash column chromatography (hexanes-EtOAc, 9:1 ⁇ 0:1) to give 6A as a colourless oil.
- Fmoc-Cys-OH is described in the literature: H.-K. Cui, Y. Guo, Y. He, F.-L. Wang, H.-H. Chang, Y. J. Wang, F.-M. Wu, C.-L. Tian, L. Lu, Angew. Chem. Int. Eng., 2013, 52(36), 9558-9562.
- Diastereomerically pure diol 103B was also converted to diastereomerically pure conjugate 6B by following procedures analogous to the representative procedures described below.
- diester 201B (0.35 g, 0.364 mmol) in trifluoroacetic acid (2 mL) is allowed to stir at r.t. for 1 h after which the mixture is concentrated in vacuo.
- the crude is purified by flash column chromatography (hexanes-EtOAc, 9:1 ⁇ 0:1) to give 6B as a colourless oil.
- This example demonstrates the synthesis of amino acid conjugates from various starting materials.
- alkyne 801 14.08 g, 70.00 mmol
- quinoline 11.75 mL, 100.00 mmol
- Lindar's catalyst 1.08 g
- the reaction mixture was connected to a Hz-filled balloon (1 atm) and allowed to stir at r.t. for 5 h.
- the mixture was then filtered through a pad of Celite® and concentrated in vacuo.
- the crude product was purified by flash column chromatography (petroleum ether-EtOAc, 9:1) to give 802 (14.09 g, 99%) as a colourless liquid.
- racemic epoxide 803 (8.272 g, 38.24 mmol), (R,R)-(+)-N,N′-bis(3,5-di-tert-butylsalicylidene)-1,2-cyclohexanediaminocobalt(II) (0.121 g, 0.19 mmol) and glacial acetic acid (0.04 mL, 0.76 mmol) in THF (0.35 mL) at 0° C. was added water (0.38 mL) dropwise. The reaction mixture was allowed to stir at r.t. for 48 h. The mixture was then concentrated in vacuo. The crude product was purified by flash column chromatography (petroleum ether-EtOAc, 9:1) to give 803a (4.12 g, 49%) as a yellow oil.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Analytical Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Medicinal Preparation (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ73500817 | 2017-08-30 | ||
| NZ735008 | 2017-08-30 | ||
| PCT/IB2018/056611 WO2019043604A1 (en) | 2017-08-30 | 2018-08-30 | PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20200361864A1 true US20200361864A1 (en) | 2020-11-19 |
Family
ID=65526296
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/638,185 Abandoned US20200361864A1 (en) | 2017-08-30 | 2018-08-30 | Peptide Conjugates, Conjugation Process, and Uses Thereof |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US20200361864A1 (https=) |
| EP (1) | EP3676250A4 (https=) |
| JP (1) | JP2020532534A (https=) |
| KR (1) | KR20200058424A (https=) |
| CN (1) | CN111247123A (https=) |
| AU (1) | AU2018323043A1 (https=) |
| BR (1) | BR112020003907A2 (https=) |
| CA (1) | CA3073314A1 (https=) |
| EA (1) | EA202090319A1 (https=) |
| IL (1) | IL272931A (https=) |
| MX (1) | MX2020002084A (https=) |
| SG (1) | SG11202001602QA (https=) |
| TW (1) | TW201925240A (https=) |
| WO (1) | WO2019043604A1 (https=) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2618842B1 (en) | 2010-09-22 | 2019-04-24 | Ena Therapeutics Pty Ltd | Novel immunostimulatory method |
| AU2018391325B2 (en) | 2017-12-21 | 2024-07-11 | Axelia Oncology Pty Ltd | Optimised compounds |
| MX2021015961A (es) * | 2019-06-26 | 2022-03-22 | Ena Respiratory Pty Ltd | Moleculas novedosas. |
| CN110681362B (zh) * | 2019-09-26 | 2020-09-11 | 浙江大学 | 以羧基和吲哚基为功能基团的混合模式层析介质 |
| CN111349054A (zh) * | 2020-01-21 | 2020-06-30 | 青岛科技大学 | 一种防锈剂2-(1,3-苯并噻唑-2-硫基)丁二酸的制备方法 |
| JP7744936B2 (ja) * | 2020-06-26 | 2025-09-26 | イーナ レスパラトリー ピーティーワイ リミテッド | 分岐脂質化合物 |
| WO2023028661A1 (en) * | 2021-09-02 | 2023-03-09 | Ena Respiratory Pty Ltd | Formulation |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190046636A1 (en) * | 2016-02-26 | 2019-02-14 | Auckland Uniservices Limited | Amino Acid and Peptide Conjugates and Conjugation Process |
| US10576144B2 (en) * | 2013-06-28 | 2020-03-03 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP4615805B2 (ja) * | 1999-11-15 | 2011-01-19 | ルードヴィッヒ インスティテュート フォー キャンサー リサーチ | Ny−eso−1ペプチド誘導体およびその使用 |
| WO2010028246A2 (en) * | 2008-09-05 | 2010-03-11 | Id Biomedical Corporation Of Quebec | Novel compositions and adjuvants |
| JP2012523379A (ja) * | 2009-04-09 | 2012-10-04 | ザ ユニバーシティー オブ メルボルン | 免疫原性組成物およびその使用 |
-
2018
- 2018-08-30 EP EP18850403.9A patent/EP3676250A4/en not_active Withdrawn
- 2018-08-30 MX MX2020002084A patent/MX2020002084A/es unknown
- 2018-08-30 WO PCT/IB2018/056611 patent/WO2019043604A1/en not_active Ceased
- 2018-08-30 SG SG11202001602QA patent/SG11202001602QA/en unknown
- 2018-08-30 BR BR112020003907-1A patent/BR112020003907A2/pt not_active Application Discontinuation
- 2018-08-30 US US16/638,185 patent/US20200361864A1/en not_active Abandoned
- 2018-08-30 CA CA3073314A patent/CA3073314A1/en active Pending
- 2018-08-30 TW TW107130372A patent/TW201925240A/zh unknown
- 2018-08-30 JP JP2020512441A patent/JP2020532534A/ja active Pending
- 2018-08-30 AU AU2018323043A patent/AU2018323043A1/en not_active Abandoned
- 2018-08-30 CN CN201880055703.0A patent/CN111247123A/zh active Pending
- 2018-08-30 EA EA202090319A patent/EA202090319A1/ru unknown
- 2018-08-30 KR KR1020207009057A patent/KR20200058424A/ko not_active Withdrawn
-
2020
- 2020-02-26 IL IL272931A patent/IL272931A/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10576144B2 (en) * | 2013-06-28 | 2020-03-03 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| US20190046636A1 (en) * | 2016-02-26 | 2019-02-14 | Auckland Uniservices Limited | Amino Acid and Peptide Conjugates and Conjugation Process |
Non-Patent Citations (4)
| Title |
|---|
| Bownds, Shannon et al; "Induction of tumor reactive cytotoxic t-lymphocytes using a peptide from ny-eso-1 modified at the carboxy terminus to enhance hla-a2.1 binding affinity and stability in solution." J. Immunother. (2001) 24(1) p1-9 * |
| Buwitt-Beckmann, Ute et al, "Lipopeptide structure determines tlr2 dependent cell activation level." FEBS J. (2005) 272 p6354-6364 * |
| Mergler, M. and Durieux, J. P.; "The bachem practice of spps." Bachem sales literature(2005) * |
| Sarkar, Aurijit and Kellogg, Glen E.; "Hydrophobicity -- shake flask, protein folding and drug discovery." Curr. Top Med. Chem. (2010) 10(1) p67-83 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3676250A1 (en) | 2020-07-08 |
| IL272931A (en) | 2020-04-30 |
| CA3073314A1 (en) | 2019-03-07 |
| KR20200058424A (ko) | 2020-05-27 |
| MX2020002084A (es) | 2020-03-24 |
| JP2020532534A (ja) | 2020-11-12 |
| EP3676250A4 (en) | 2021-05-26 |
| CN111247123A (zh) | 2020-06-05 |
| SG11202001602QA (en) | 2020-03-30 |
| TW201925240A (zh) | 2019-07-01 |
| AU2018323043A1 (en) | 2020-03-05 |
| WO2019043604A1 (en) | 2019-03-07 |
| EA202090319A1 (ru) | 2020-10-16 |
| BR112020003907A2 (pt) | 2020-09-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11464853B2 (en) | Amino acid and peptide conjugates and conjugation process | |
| US20200361864A1 (en) | Peptide Conjugates, Conjugation Process, and Uses Thereof | |
| US20200306370A1 (en) | Amino acid and peptide conjugates and conjugation process | |
| US11014960B2 (en) | Amino acid and peptide conjugates and uses thereof | |
| HK40013754A (en) | Peptides for amino acid and peptide conjugates and conjugation process | |
| HK1224279B (en) | Amino acid and peptide conjugates and conjugation process |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |