WO2018102740A1 - Compositions and methods related to cell systems for penetrating solid tumors - Google Patents

Compositions and methods related to cell systems for penetrating solid tumors Download PDF

Info

Publication number
WO2018102740A1
WO2018102740A1 PCT/US2017/064299 US2017064299W WO2018102740A1 WO 2018102740 A1 WO2018102740 A1 WO 2018102740A1 US 2017064299 W US2017064299 W US 2017064299W WO 2018102740 A1 WO2018102740 A1 WO 2018102740A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell
tumor
cells
antibody
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/064299
Other languages
English (en)
French (fr)
Inventor
Robert J. Deans
Sivan ELLOUL
Nathan DOWDEN
Avak Kahvejian
Jordi MATA-FINK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rubius Therapeutics Inc
Original Assignee
Rubius Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3045331A priority Critical patent/CA3045331A1/en
Priority to EP17825997.4A priority patent/EP3548050A1/en
Priority to KR1020197019135A priority patent/KR20190091497A/ko
Priority to CN201780074241.2A priority patent/CN110225756A/zh
Priority to BR112019011138-7A priority patent/BR112019011138A2/pt
Priority to JP2019529525A priority patent/JP2019536793A/ja
Priority to AU2017366706A priority patent/AU2017366706A1/en
Priority to MX2019006423A priority patent/MX2019006423A/es
Priority to RU2019120400A priority patent/RU2019120400A/ru
Application filed by Rubius Therapeutics Inc filed Critical Rubius Therapeutics Inc
Publication of WO2018102740A1 publication Critical patent/WO2018102740A1/en
Priority to IL266940A priority patent/IL266940A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/18Erythrocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001124CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6006Cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0641Erythrocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0693Tumour cells; Cancer cells
    • C12N5/0694Cells of blood, e.g. leukemia cells, myeloma cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer

Definitions

  • the cell systems involve erythroid cells that express one or more exogenous polypeptides with targeting function, cancer cell killing function, immune checkpoint inhibition, and/or costimulation.
  • the disclosure provides, in some aspects, a method of treating a subject having a cancer (e.g., a cancer described herein), comprising administering to the subject a preparation comprising a plurality of erythroid cells (e.g., erythroid cells described herein), each erythroid cell comprising an anti-cancer agent (e.g., an anti-cancer agent described herein).
  • the present disclosure also provides, in some aspects, a method of delivering an agent, e.g., a binding agent, to a cell of a cancer in a subject, wherein the cancer comprises an oncogenic mutation, e.g., a translocation that places a cell cycle gene under control of a constitutive promoter, comprising:
  • the present disclosure also provides, in some aspects, a method of treating a subject having a B cell cancer, or of delivering an agent to a cancerous B cell in a subject, wherein the subject has developed resistance to an antibody selected from Table 1, e.g., an anti-CD20 antibody, comprising:
  • erythroid cells e.g., enucleated erythroid cells
  • a preparation of cells comprising a fusion protein comprising a transmembrane domain and a binding domain that binds a tumor antigen (e.g., wherein the binding domain is an anti-CD20 antibody domain)
  • a tumor antigen e.g., an antigen described herein, e.g., an antigen of Table 1, e.g., CD20
  • target cancer cells e.g., B cells
  • apoptosis e.g., caspase-independent apoptosis and/or caspase-dependent apoptosis, of target cancer cells, e.g., B cells
  • a tumor antigen e.g., an antigen described herein, e.g., an antigen of Table 1, e.g., CD20
  • target cancer cells e.g., B cells
  • a preparation comprising a plurality of cells, e.g., erythroid cells (e.g., enucleated erythroid cells), each cell of the plurality comprising the anti-cancer agent, in an amount sufficient to treat the solid tumor,
  • erythroid cells e.g., enucleated erythroid cells
  • the anti-cancer agent comprises an exogenous polypeptide comprising a binding agent, e.g., an antibody, against a tumor cell antigen,
  • erythroid cells e.g., enucleated erythroid cells
  • each cell of the plurality comprising, on its surface, an exogenous polypeptide comprising a binding agent, e.g., an antibody, against an antigen present at the extravascular site, e.g., a tumor antigen,
  • a preparation comprising a plurality of cells, e.g., erythroid cells (e.g., enucleated erythroid cells), each cell of the plurality comprising, on its surface, an exogenous polypeptide comprising a binding agent, e.g., an antibody, against a tumor cell antigen, in an amount sufficient to treat the non-vascularized solid tumor
  • a preparation comprising a plurality of cells, e.g., erythroid cells (e.g., enucleated erythroid cells), each cell of the plurality comprising, on its surface, an exogenous polypeptide comprising a binding agent, e.g., an antibody, against a tumor cell antigen, in an amount sufficient to deliver the binding agent to a tumor cell of the non- vascularized solid tumor,
  • erythroid cells e.g., enucleated erythroid cells
  • a binding agent e.g., an antibody
  • erythroid cells e.g., enucleated erythroid cells
  • each cell of the plurality comprising, on its surface, an exogenous polypeptide comprising a binding agent, e.g., an antibody, against a tumor cell antigen
  • the density of binding agents on the surface of the erythroid cell is sufficient that, upon binding of the binding agents with tumor cell antigen, a tumor antigen accumulates in a lipid raft, the distribution of the antitumor cell antigen is sufficiently perturbed to alter signalling in the tumor cell, the density of tumor antigens on the surface of the cancer cell is significantly altered, an anti-apoptotic pathway (e.g., BCL2 and/or BCLxl pathway) is inhibited, an apoptotic pathway of the cancer cell is induced, a necrotic pathway of the cancer cell is induced, or the membrane properties of the cancer cell are significantly altered, or a combination thereof
  • an anti-apoptotic pathway e.g., BCL2 and/or BCLxl pathway
  • an immune checkpoint-ligand e.g., PD-L1
  • an immune checkpoint molecule e.g., PD1
  • an immune checkpoint molecule expressed on a tumor infiltrating lymphocyte e.g., PD1
  • the fusion protein does not contain Gly-Gly, or does not contain Gly-Gly in an extracellular region, does not contain Gly-Gly in an extracellular region that is within 1, 2, 3, 4, 5, 10, 20, 50, or 100 amino acids of a transmembrane segment; or a combination thereof,
  • an erythroid cell comprising, e.g., on its surface
  • the resistant cancer is resistant to an antibody therapeutic, e.g., an antibody therapeutic of Table 1.
  • the resistant cancer is resistant to a small molecule drug.
  • the small molecule drug is a chemotherapeutic agent, e.g., a chemotherapeutic described herein.
  • the subject has failed to respond to treatment with an antibody of Table 1.
  • the subject is na ⁇ ve to an antibody of Table 1.
  • the antibody is an anti-CD20 antibody, e.g., rituximab.
  • the antibody domain binds a target of Table 1.
  • the stimulatory molecule is a molecule that stimulates an immune effector cells, e.g., a T cell.
  • the stimulatory molecule is a primary stimulant or a costimulatory molecule.
  • the erythroid cell comprises a costimulatory molecule and a primary stimulant. In other embodiments, the erythroid comprises a
  • a second costimulatory molecule e.g., a costimulatory molecule of Table 5
  • a third or more costimulatory molecules e.g., a costimulatory molecule of Table 5
  • a costimulatory molecule e.g., a costimulatory molecule described herein, e.g., a costimulatory molecule of Table 5, e.g., 4-1BBL
  • a costimulatory molecule described herein e.g., a costimulatory molecule of Table 5, e.g., 4-1BBL
  • increased cytokine secretion is due at least in part to increased proliferation of cytokine-secreting cells (e.g., CD4+ T cells, CD8+ T cells, or both of CD4+ T cells and CD8+ T cells).
  • cytokine-secreting cells e.g., CD4+ T cells, CD8+ T cells, or both of CD4+ T cells and CD8+ T cells.
  • the disclosure provides a method comprising:
  • sequence database reference numbers e.g., sequence database reference numbers
  • GenBank, Unigene, NCBI, and Entrez sequences referred to herein, e.g., in any Table herein are incorporated by reference.
  • sequence accession numbers specified herein, including in any Table herein refer to the database entries current as of December 2, 2016.
  • Fig.1 is a graph showing the level of apoptosis in four lymphoma cell lines treated with (from left to right), anti-CD20 antibody alone, anti-CD20 antibody“crosslinked” together with a secondary anti-isotype antibody, control RCT-HA-GPA (at 1:1 or 1:5), or RCT-antiCD20 (at 1:1 or 1:5) antibody alone.
  • Fig.2 is a graph showing level of apoptosis in CD20+ lymphoma cells treated with RCT- antiCD20 or control RCT-HA-GPA in the presence or absence of a caspase-dependent apoptosis inhibitor (FMK).
  • FMK caspase-dependent apoptosis inhibitor
  • FIG. 1-1 and 1-5 indicate a 1:1 and 1:5 ratio, respectively, of lymphoma cells to RCTs.
  • FIG.3 shows tissue sections of CD20+ tumors from mice treated with RCT-antiCD20 or control RCT-HA-GPA. H&E, Hematoxylin and eosin, detects nucleated cells, endogenous red blood cells, and engineered erythroid cells. CD31 staining detects endothelial vasculature.
  • CD20 staining detects Ramos tumor cells.
  • HA detects engineered erythroid cells.
  • Fig.4 is a fluorescence image of a xenograft tumor in a mouse treated with control RCT- HA-GPA (top panel) or RCT-antiCD20 (bottom panel).
  • Fig.5 is a graph showing rescue of IL-2 secretion by RCTs comprising immune checkpoint inhibitors.
  • Fig.7 is a graph showing NF ⁇ B activation as indicated by luciferase activity measured in RLU when Jurkat cells are co-cultured with RCT-41BBL or untransduced control erythroid cells.
  • Fig.8 is a graph showing NF ⁇ B activation resulting from erythroid cells having the indicated number of copies of 4-1BB-L per cell.
  • Fig.9 is a graph showing NF ⁇ B activation resulting from the indicated number of 4-1BB-L RCT cells, compared to an anti-4-1BB antibody.
  • Fig.10 is a pair of graphs showing, in the left panel, the fold change in CD4+ T cells, and in the right panel, the fold change in CD8+ T cells, induced by 4-1BB-L RCT cells, compared to an anti-4-1BB antibody.
  • Fig.11 is a pair of graphs showing, in the left panel, the IFN-gamma secretion, and in the right panel, the TNF-alpha secretion, induced by 4-1BB-L RCT cells, compared to an anti-4-1BB antibody.
  • Fig.12 is a time course showing tumor size in mice treated with 41BBL-RCT and an untreated control.
  • Fig.13 shows the ratio of erythroid cells in the tumor to erythroid cells in blood vessels for erythroid cells having an anti-PD-L1 antibody or an isotype control antibody.
  • Fig.14 is a chart summarizing approximate fold change levels in signalling, proliferation, cytokine levels, and antigen recall activity induced by the indicated RCTs.
  • Fig.15 is a graph quantifying the binding of the indicated erythroid cells to the indicated tumor cells.
  • antibody refers to a protein or part thereof, e.g., an
  • a“combination therapy” or“administered in combination” means that two (or more) different agents or treatments are administered to a subject as part of a treatment regimen for a particular disease or condition.
  • the treatment regimen includes the doses and periodicity of administration of each agent such that the effects of the separate agents on the subject overlap.
  • the delivery of the two or more agents is simultaneous or concurrent and the agents may be co-formulated.
  • the two or more agents are not co-formulated and are administered in a sequential manner as part of a prescribed regimen.
  • each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues.
  • the therapeutic agents can be administered by the same route or by different routes.
  • a first therapeutic agent of the combination may be administered by intravenous injection while a second therapeutic agent of the combination may be administered orally.
  • CDR complementarity determining region
  • the term“persistent” as used herein, in reference to an agent being persistent in a tumor refers to an agent that is continuously resident in the tumor for a prolonged or predetermined time. For instance, if the agent comprises a targeting moiety that binds a tumor antigen, the agent is persistent in the tumor if the agent comprising the targeting moiety is continuously resident in the tumor for longer than an otherwise similar agent lacking the targeting moiety (e.g., an unmodified erythroid cell). In embodiments, an agent that is persistent in the tumor is resident in the tumor for at least 3, 6, or 12 hours or 1, 2, 3, 4, 5, 6, 7, 14, 21, or 28 days (e.g., up to 14 or 28 days).
  • a therapeutic agent delivered by an erythroid cell described herein is more efficacious than the same therapeutic agent delivered freely, that is, not by an erythroid cell described herein, and is useful, e.g., to treat a tumor that is resistant to treatment with that therapeutic agent.
  • a therapeutic agent delivered by an erythroid cell described herein is administered to treat a tumor that is resistant to treatment with a different therapeutic agent.
  • Post-translation modifications also include conjugation to a hydrophobic group (e.g., myristoylation, palmitoylation, isoprenylation, prenylation, or glypiation), conjugation to a cofactor (e.g., lipoylation, flavin moiety (e.g., FMN or FAD), heme C attachment,
  • a hydrophobic group e.g., myristoylation, palmitoylation, isoprenylation, prenylation, or glypiation
  • conjugation to a cofactor e.g., lipoylation, flavin moiety (e.g., FMN or FAD), heme C attachment
  • acylation e.g. O-acylation, N- acylation, or S-acylation
  • formylation acetylation, alkylation (e.g., methylation or ethylation), amidation, butyrylation, gamma-carboxylation, malonylation, hydroxylation, iodination, nucleotide addition such as ADP-ribosylation, oxidation, phosphate ester (O-linked) or phosphoramidate (N-linked) formation, (e.g., phosphorylation or adenylylation), propionylation, pyroglutamate formation, S-glutathionylation, S-nitrosylation, succinylation, sulfation,
  • acylation e.g. O-acylation, N- acylation, or S-acylation
  • alkylation e.g., methylation or ethylation
  • amidation e.g., butyrylation
  • glycosylation includes the addition of a glycosyl group to arginine, asparagine, cysteine, hydroxylysine, serine, threonine, tyrosine, or tryptophan, resulting in a glycoprotein.
  • the glycosylation comprises, e.g., O-linked glycosylation or N-linked
  • an exogenous polypeptide described herein forms a multimer, e.g., a dimer, trimer, tetramer, or hexamer.
  • the exogenous polypeptide e.g., comprising 4-1BBL
  • forms a trimer e.g., a trimer at the surface of the erythroid cell.
  • the erythroid cell comprises an agent, e.g., an exogenous polypeptide, e.g., a surface-exposed exogenous polypeptide, e.g., a surface-exposed polypeptide comprising a transmembrane domain, that binds a tumor antigen described herein, e.g., a tumor antigen of Table 1.
  • the erythroid cell comprises an agent, e.g., an exogenous polypeptide, that comprises an antibody or other binding agent of Table 1 or Table 2, or a fragment or variant thereof.
  • the fragment or variant could be a single domain antibody, e.g., scFv, corresponding to an antibody of Table 1 or Table 2.
  • the GPA polypeptide is C-terminal of the binding domain.
  • the GPA polypeptide has a sequence of: LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGER VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIEN PETSDQ (SEQ ID NO: 1) or a transmembrane portion thereof, or a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing.
  • the GPA polypeptide is C-terminal of the antibody domain.
  • one or more of the exogenous polypeptides comprises a member of the TNF superfamily or a portion thereof.
  • the exogenous polypeptides bind to one or both of death receptors DR4 (TRAIL-R1) and DR5 (TRAIL-R2).
  • the exogenous polypeptides bind to one or more of TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, or
  • the targeting agent binds a marker of neovasculature, e.g. binds an integrin such as avB1, avB3, or avB5, or a4b1 integrins, e.g. a synthetic peptide knottin (Kim et al, JACS 2016, 137(1)) or an endogenous or natural ligand, e.g. echistatin, RGD, EETI2.5F, or VCAM-1, or binds prostate-specific membrane antigen, which is also found abundantly on neovasculature.
  • an integrin such as avB1, avB3, or avB5, or a4b1 integrins
  • an endogenous or natural ligand e.g. echistatin, RGD, EETI2.5F, or VCAM-1
  • binds prostate-specific membrane antigen which is also found abundantly on neovasculature.
  • the anti-cancer agent may bind an immune effector cell, e.g. a T cell or an inflammatory macrophage and may capture and bring the effector cell into proximity of the tumor.
  • the anti-cancer agent may be a direct mediator of cell killing, e.g.
  • the inhibitor of the immune checkpoint molecule is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of B7-H3 (e.g., MGA271), B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN- 15049, CHK 1, CHK2, A2aR, B-7 family ligands, or a combination thereof.
  • B7-H3 e.g., MGA271
  • B7-H4 BTLA
  • HVEM HVEM
  • TIM3 e.g., GAL9, LAG3, VISTA
  • KIR IR
  • CD160 CD160
  • CGEN- 15049 CHK 1, CHK2, A2aR, B-7 family ligands, or a combination thereof.
  • Inhibitors of immune checkpoint molecules can be broken down into at least 4 major categories: i) agents such as antibody that block an inhibitory pathway directly on T cells or natural killer (NK) cells (e.g., PD-1 targeting antibodies such as nivolumab and pembrolizumab, antibodies targeting TIM-3, and antibodies targeting LAG-3, 2B4, CD160, A2aR, BTLA, CGEN-15049, or KIR), ii) agents such as antibodies that activate stimulatory pathways directly on T cells or NK cells (e.g., antibodies targeting OX40, GITR, or 4-1BB), iii) agents such as antibody that block a suppressive pathway on immune cells or rely on antibody-dependent cellular cytotoxicity to deplete suppressive populations of immune cells (e.g., CTLA-4 targeting antibodies such as ipilimumab, antibodies targeting VISTA, and antibodies targeting PD-L2, Gr1, or Ly6G), and iv) agents such as antibodies that block a suppressive pathway directly on cancer cells
  • the erythroid cell comprises an agent, e.g., an exogenous polypeptide, e.g., a surface-exposed exogenous polypeptide, e.g., a surface-exposed polypeptide comprising a transmembrane domain, that comprises a costimulatory molecule of Table 5 or a fragment or variant thereof.
  • the erythroid cell comprises an agent, e.g., an exogenous polypeptide, that comprises a costimulatory molecule of Table 5 or a fragment or variant thereof.
  • a costimulatory molecule of Table 5 comprises one or more of a MHC class I molecule, BTLA, a Toll ligand receptor, OX40, CD27, CD28, CDS, ICAM-1, LFA-1
  • CD11a/CD18 CD11a/CD18
  • ICOS CD278
  • 4-1BB CD137
  • CDS CDS
  • ICAM-1 ICAM-1
  • GITR ICAM-1
  • BAFFR BAFFR
  • HVEM HVEM
  • SLAMF7 SLAMF7
  • NKp80 KLRF1
  • NKp44 NKp44
  • NKp30 NKp46
  • CD160 CD19, CD4
  • an erythroid cell brings an immune effector cell (e.g., T cell) and a cancer cell in close proximity with one another to facilitate the killing of the cancer cell by the immune effector cell.
  • an immune effector cell e.g., T cell
  • the first polypeptide binds a cell surface marker of a cancer cell and the second polypeptide binds a cell surface marker of an immune effector cell.
  • the one or more exogenous polypeptides are situated on or in an erythroid cell
  • any exogenous polypeptide(s) described herein can also be situated on or in another vehicle.
  • the vehicle can comprise, e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome.
  • the vehicle may be, e.g., a particle such as a nanoparticle or a particle greater than 100, 200, 300, 400, 500, 1,000, 1,500, 2,000, or 2,500 nm in diameter.
  • the erythroid cell is a nucleated red blood cell, red blood cell precursor, or enucleated red blood cell.
  • the erythroid cell is a cord blood stem cell, a CD34+ cell, a hematopoietic stem cell (HSC), a spleen colony forming (CFU-S) cell, a common myeloid progenitor (CMP) cell, a blastocyte colony-forming cell, a burst forming unit-erythroid (BFU-E), a megakaryocyte- erythroid progenitor (MEP) cell, an erythroid colony-forming unit (CFU-E), a reticulocyte, an erythrocyte, an induced pluripotent stem cell (iPSC), a mesenchymal stem cell (MSC), a polychromatic normoblast, an orthochromatic normoblast, or a combination thereof.
  • the erythroid cells are immortal or immortalized cells
  • the disclosure provides a plurality of erythroid cells, wherein a first cell of the plurality comprises a first exogenous polypeptide and a second cell of the plurality comprises a second exogenous polypeptide.
  • the plurality of cells comprises two or more polypeptides described herein, e.g., any pair of polypeptides described herein.
  • less than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 2%, or 1% of the cells in the population comprise both the first exogenous polypeptide and the second exogenous polypeptide.
  • the membrane shields the cells from the immune system and/or keeps a plurality of cells in proximity, facilitating interaction with each other or each other’s products. Physical characteristics of enucleated erythroid cells
  • the enucleated erythroid cells described herein have one or more (e.g., 2, 3, 4, or more) physical characteristics described herein, e.g., osmotic fragility, cell size, hemoglobin concentration, or phosphatidylserine content. While not wishing to be bound by theory, in some embodiments an enucleated erythroid cell that expresses an exogenous protein has physical characteristics that resemble a wild-type, untreated erythroid cell.
  • a hypotonically loaded erythroid cell sometimes displays aberrant physical characteristics such as increased osmotic fragility, altered cell size, reduced hemoglobin concentration, or increased phosphatidylserine levels on the outer leaflet of the cell membrane.
  • the population of erythroid cells has an average diameter of about 4, 5, 6, 7, or 8 microns, and optionally the standard deviation of the population is less than 1, 2, or 3 microns. In some embodiments, the one or more erythroid cell has a diameter of about 4-8, 5-7, or about 6 microns.
  • the diameter of the erythroid cell is less than about 1 micron, larger than about 20 microns, between about 1 micron and about 20 microns, between about 2 microns and about 20 microns, between about 3 microns and about 20 microns, between about 4 microns and about 20 microns, between about 5 microns and about 20 microns, between about 6 microns and about 20 microns, between about 5 microns and about 15 microns or between about 10 microns and about 30 microns.
  • Cell diameter is measured, in some embodiments, using an Advia 120 hematology system.
  • the mean corpuscular volume of the erythroid cell is less than 30 fL, 40 fL, 50 fL, 60 fL, 70 fL, 80 fL, 90 fL, 100 fL, 110 fL, 120 fL, 130 fL, 140 fL, 150 fL, 160 fL, 170 fL, 180 fL, 190 fL, 200 fL, or less than 200 fL.
  • the mean corpuscular volume of the erythroid cell is between 80-100, 100-200, 200-300, 300-400, or 400-500 femtoliters (fL).
  • a population of erythroid cells has a mean corpuscular volume set out in this paragraph and the standard deviation of the population is less than 50, 40, 30, 20, 10, 5, or 2 fL.
  • the mean corpuscular volume is measured, in some embodiments, using a hematological analysis instrument, e.g., a Coulter counter.
  • Phosphatidylserine exposure is assessed, in some embodiments, by staining for Annexin-V-FITC, which binds preferentially to PS, and measuring FITC fluorescence by flow cytometry, e.g., using the method of Example 54 of WO2015/073587.
  • an erythroid cell is enucleated.
  • a cell e.g., an erythroid cell
  • Universal donor erythroid cells e.g., Universal donor erythroid cells
  • erythroid cells described herein are autologous and/or allogeneic to the subject to which the cells will be administered.
  • erythroid cells allogeneic to the subject include one or more of blood type specific erythroid cells (e.g., the cells can be of the same blood type as the subject) or one or more universal donor erythroid cells.
  • the enucleated erythroid cells described herein have reduced immunogenicity compared to a reference cell, e.g., have lowered levels of one or more blood group antigens.
  • a compatible ABO blood group can be chosen to prevent an acute intravascular hemolytic transfusion reaction.
  • the ABO blood types are defined based on the presence or absence of the blood type antigens A and B,
  • group O erythrocytes contain neither A nor B antigens, they can be safely transfused into recipients of any ABO blood group, e.g., group A, B, AB, or O recipients.
  • group O erythrocytes are considered universal and may be used in all blood transfusions.
  • an erythroid cell described herein is type O.
  • group A erythroid cells may be given to group A and AB recipients
  • group B erythroid cells may be given to group B and AB recipients
  • group AB erythroid cells may be given to AB recipients.
  • a non-group O erythroid cell it may be beneficial to convert a non-group O erythroid cell to a universal blood type.
  • Enzymatic removal of the immunodominant monosaccharides on the surface of group A and group B erythrocytes may be used to generate a population of group O- like erythroid cells (See, e.g., Liu et al., Nat. Biotech.25:454-464 (2007)).
  • Group B erythroid cells may be converted using an ⁇ -galactosidase derived from green coffee beans. Alternatively or in addition, ⁇ -N-acetylgalactosaminidase and ⁇ -galactosidase enzymatic activities derived from E.
  • meningosepticum bacteria may be used to respectively remove the immunodominant A and B antigens (Liu et al., Nat. Biotech.25:454-464 (2007)), if present on the erythroid cells.
  • packed erythroid cells isolated as described herein are incubated in 200 mM glycine (pH 6.8) and 3 mM NaCl in the presence of either ⁇ -N-acetylgalactosaminidase and ⁇ - galactosidase (about 300 ⁇ g/ml packed erythroid cells) for 60 min at 26° C. After treatment, the erythroid cells are washed by 3-4 rinses in saline with centrifugation and ABO-typed according to standard blood banking techniques.
  • a second blood group is the Rh system, wherein an individual can be Rh+ or Rh-.
  • an erythroid cell described herein is Rh-.
  • the erythroid cell is Type O and Rh-.
  • hematopoietic progenitor cells e.g., CD34+ hematopoietic progenitor cells
  • a nucleic acid or nucleic acids encoding one or more exogenous polypeptides are contacted with a nucleic acid or nucleic acids encoding one or more exogenous polypeptides, and the cells are allowed to expand and differentiate in culture.
  • the nucleic acid may be, e.g., DNA or RNA.
  • viruses may be used as gene transfer vehicles including retroviruses, Moloney murine leukemia virus (MMLV), adenovirus, adeno-associated virus (AAV), herpes simplex virus (HSV), lentiviruses such as human immunodeficiency virus 1 (HIV 1), and spumaviruses such as foamy viruses, for example.
  • MMLV Moloney murine leukemia virus
  • AAV adenovirus
  • AAV adeno-associated virus
  • HSV herpes simplex virus
  • lentiviruses such as human immunodeficiency virus 1 (HIV 1)
  • spumaviruses such as foamy viruses, for example.
  • Number of cells is measured, in some embodiments, using an automated cell counter.
  • the population of erythroid cells comprises at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 98% (and optionally up to about 80, 90, or 100%) enucleated erythroid cells. In some embodiments, the population of erythroid cells contains less than 1% live enucleated cells, e.g., contains no detectable live enucleated cells. Enucleation is measured, in some embodiments, by FACS using a nuclear stain.
  • At least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of erythroid cells in the population comprise one or more (e.g., 2, 3, 4 or more) of the exogenous polypeptides. Expression of the polypeptides is measured, in some embodiments, by FACS using labeled antibodies against the polypeptides. In some embodiments, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of erythroid cells in the population are enucleated and comprise one or more exogenous polypeptides.
  • the population of erythroid cells comprises about 1x10 9 – 2x10 9 , 2x10 9 – 5x10 9 , 5x10 9 – 1x10 10 , 1x10 10 – 2x10 10 , 2x10 10 – 5x10 10 , 5x10 10 – 1x10 11 , 1x10 11 – 2x10 11 , 2x10 11 – 5x10 11 , 5x10 11 – 1x10 12 , 1x10 12 – 2x10 12 , 2x10 12 – 5x10 12 , or 5x10 12 – 1x10 13 cells.
  • erythroid cells comprising (e.g., expressing) exogenous agent (e.g., polypeptides) are described, e.g., in WO2015/073587 and WO2015/153102, each of which is incorporated by reference in its entirety.
  • exogenous agent e.g., polypeptides
  • the erythroid cells described herein are administered to a subject, e.g., a mammal, e.g., a human.
  • a subject e.g., a mammal, e.g., a human.
  • mammals that can be treated include without limitation, humans, domestic animals (e.g., dogs, cats and the like), farm animals (e.g., cows, sheep, pigs, horses and the like) and laboratory animals (e.g., monkey, rats, mice, rabbits, guinea pigs and the like).
  • farm animals e.g., cows, sheep, pigs, horses and the like
  • laboratory animals e.g., monkey, rats, mice, rabbits, guinea pigs and the like.
  • the methods described herein are applicable to both human therapy and veterinary applications.
  • the erythroid cells are administered to a patient every 1, 2, 3, 4, 5, or 6 months.
  • the present disclosure provides a method of treating a disease or condition described herein, comprising administering to a subject in need thereof a composition described herein, e.g., an erythroid cell described herein.
  • the disease or condition is a cancer, e.g., a cancer described herein.
  • the disclosure provides a use of an erythroid cell described herein for treating a disease or condition described herein, e.g., a cancer.
  • the disclosure provides a use of an erythroid cell described herein for manufacture of a medicament for treating a disease or condition described herein, e.g., a cancer.
  • the tumor cell is in a primary tumor. In some embodiments, the tumor cell is other than a circulating tumor cell. In some embodiments, the tumor comprises a mutation in a gene of Table 8. In some embodiments, the mutation in a gene of Table 8 is a mutation specified in the third column of Table 8.
  • Carcinoembryonic antigen CEA
  • Epithelial cell adhesion molecule EPCAM
  • B7H3 CD276
  • KIT CD117
  • Interleukin-13 receptor subunit alpha-2 IL-13Ra2 or CD213A2
  • Mesothelin Interleukin 11 receptor alpha
  • PSCA prostate stem cell antigen
  • Protease Serine 21 Testisin or PRSS21
  • vascular endothelial growth factor receptor 2 (VEGFR2) Lewis(Y) antigen
  • CD24 Platelet-derived growth factor receptor beta
  • PDGFR-beta Stage-specific embryonic antigen-4
  • SSEA-4 Stage-specific embryonic antigen-4
  • CD20 Folate receptor alpha; Receptor tyrosine-protein kinase ERBB2 (Her2/neu); Mucin 1, cell surface associated (MUC1); epidermal growth factor receptor (EGFR); neural cell adhesion molecule (NCAM); Prostase; prostatic acid phosphatase (PAP);
  • Proteasome Prosome, Macropain Subunit, Beta Type, 9 (LMP2); glycoprotein 100 (gp100); oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); tyrosinase; ephrin type-A receptor 2 (EphA2); Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2- 3)bDGalp(1-4)bDGlcp(1-1)Cer); transglutaminase 5 (TGS5); high molecular weight-melanoma- associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); ct
  • angiopoietin-binding cell surface receptor 2 (Tie 2); melanoma cancer testis antigen-1 (MAD- CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; tumor protein p53 (p53); p53 mutant; prostein; survivin; telomerase; prostate carcinoma tumor antigen-1 (PCTA-1 or Galectin 8), melanoma antigen recognized by T cells 1 (MelanA or MART1); Rat sarcoma (Ras) mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor
  • the fragment or variant could be an active fragment of a binding agent of Table 1 or Table 2.
  • the fragment or variant could be an antibody having less than 100% sequence identity to an antibody of Table 1 or Table 2, e.g., an antibody having at least 70%, 75%, 80%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity to the antibody of Table 1 or Table 2 or to a light chain variable fragment, heavy chain variable fragment, or both.
  • the fragment or variant could have the same CDRs as an antibody of Table 1 or Table 2, but one or more mutations in the framework and/or constant region.
  • the fragment or variant could be a binding agent having less than 100% sequence identity to a binding agent of Table 1 or Table 2, e.g., a binding agent having at least 70%, 75%, 80%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity to a binding agent of Table 1 or Table 2 or to an active portion thereof.
  • the erythroid cell comprises a chemotherapeutic agent.
  • the erythroid cell is administered in combination with a chemotherapeutic agent, e.g., the erythroid cell is administered before, after, or simultaneously with the chemotherapeutic agent.
  • the erythroid cell and the chemotherapeutic agent are admixed, and in some embodiments, they are in separate preparations.
  • the erythroid cell and the chemotherapeutic agent may be administered through the same route of administration (e.g., intravenous) or different routes of administration (e.g., intravenous and oral).
  • the chemotherapeutic is a microtubule inhibitor, DNA replication inhibitor, photosensitizer, or enzyme inhibitor.
  • the chemotherapeutic is a microtubule inhibitor (e.g., blocks microtubule assembly for instance a vinca alkaloid, or blocks microtubule disassembly such as a taxane or epothilone).
  • the chemotherapeutic is a microtubule inhibitor (e.g., blocks microtubule assembly for instance a vinca alkaloid, or blocks microtubule disassembly such as a taxane or epothilone).
  • chemotherapeutic is a DNA replication inhibitor (e.g., an antimetabolite such as an
  • the photosensitizer is a porphyrin derivative. More specifically, in some embodiments, the vinca alkaloid is chosen from vinblastine, Vincristine, Vinflunine, Vindesine, or Vinorelbine. In some embodiments, the taxane is chosen from Cabazitaxel, Docetaxel, Larotaxel, Ortataxel, Paclitaxel, or Tesetaxel.
  • the pyrimidine antimetabolite is chosen from a Thymidylate synthase inhibitor (e.g., Fluorouracil, Capecitabine, Tegafur, Carmofur, or Floxuridine), a DNA polymerase inhibitor (e.g., Cytarabine), a Ribonucleotide reductase inhibitor (e.g., Gemcitabine) or a Hypomethylating agent (e.g., Azacitidine of Decitabine).
  • the Deoxyribonucleotide antimetabolite is a Ribonucleotide reductase inhibitor (e.g., Hydroxycarbamide).
  • the topoisomerase inhibitor is an inhibitor of topoisomerase I, e.g., a Camptotheca compound, e.g., Camptothecin, Cositecan, Belotecan, Gimatecan, Exatecan, Irinotecan, Lurtotecan, Silatecan, Topotecan, or Rubitecan.
  • a Camptotheca compound e.g., Camptothecin
  • Cositecan e.g., Camptothecin
  • Belotecan Gimatecan
  • Exatecan Irinotecan
  • Lurtotecan Lurtotecan
  • Silatecan Topotecan
  • Rubitecan a Camptotheca compound
  • the topoisomerase inhibitor is an inhibitor of topoisomerase II, e.g., a
  • the topoisomerase inhibitor has intercalation activity, e.g., an Anthracycline (e.g., Aclarubicin, Daunorubicin, Doxorubicin, Epirubicin, Idarubicin, Amrubicin, Pirarubicin, Valrubici, orn Zorubicin)or an Anthracenedione (e.g., Mitoxantrone or Pixantrone).
  • an Anthracycline e.g., Aclarubicin, Daunorubicin, Doxorubicin, Epirubicin, Idarubicin, Amrubicin, Pirarubicin, Valrubici, orn Zorubicin
  • an Anthracenedione e.g., Mitoxantrone or Pixantrone
  • the alkylating agent is a Nitrogen mustard, e.g., Mechlorethamine, a Cyclophosphamide (e.g., Ifosfamide or Trofosfamide), a Chlorambucil (e.g., Melphalan or Prednimustine), Bendamustine, Uramustine, or Estramustine.
  • the alkylating agent is a Nitrosourea, e.g., Carmustine, Lomustine, Fotemustine, Nimustine, Ranimustine, or Streptozocin.
  • the alkylating agent is an Alkyl sulfonate, e.g., a Busulfan (e.g., Mannosulfan or Treosulfan).
  • the alkylating agent is an Aziridine, e.g., Carboquone, ThioTEPA, Triaziquone, or Triethylenemelamine.
  • the platinum- based agent is chosen from Carboplatin, Cisplatin, Dicycloplatin, Nedaplatin, Oxaliplatin, or Satraplatin.
  • the nonclassical DNA crosslinker is a Hydrazine (e.g.,
  • the intercalator is a Streptomyces compound, e.g., (Actinomycin, Bleomycin, Mitomycin, or Plicamycin).
  • the photosensitizer is selected from an Aminolevulinic acid / Methyl aminolevulinate, Efaproxiral, a porphyrin derivative (e.g., Porfimer sodium Talaporfin, Temoporfin, or Verteporfin).
  • the enzyme inhibitor is selected from a Farnesyltransferase inhibitor (e.g., Tipifarnib), a CDK inhibitor (e.g., Alvocidib, Seliciclib, or Palbociclib), a Proteasome inhibitor (e.g., (Bortezomib, Carfilzomib, or Ixazomib), a Phosphodiesterase inhibitor (e.g., Anagrelide), an IMP dehydrogenase inhibitor (e.g., Tiazofurin), a Arachidonate 5-lipoxygenase inhibitor (e.g., Masoprocol), a PARP inhibitor (e.g.,Olaparib or Rucaparib), an HDAC inhibitor (e.g., Belinostat, Panobinostat, Romidepsin, or Vorinostat) or a Phosphoinositide 3-kinase inhibitor, e.g., (Idelalisib).
  • Celecoxib Demecolcine, Elesclomol, Elsamitrucin, Etoglucid, Lonidamine, Lucanthone, Mitoguazone, Mitotane, Oblimersen, Omacetaxine mepesuccinate, or Eribulin.
  • EXAMPLES Example 1 Erythroid cells expressing an exogenous polypeptide comprising a binding agent to a tumor antigen bind to and promote apoptosis in cells expressing the tumor antigen, and penetrate solid tumors
  • Enucleated erythroid cells were produced which express on their surface a fusion protein comprising, from N-to-C terminus, a rituximab CD20 scFv domain, an HA epitope tag, and full- length GPA (including the extracellular, transmembrane, and intracellular domains) (RCT- antiCD20).
  • Control enucleated erythroid cells were produced which express on their surface just the HA epitope tag fused to the N terminus of full-length GPA (RCT-HA-GPA).
  • the RCT-antiCD20 bound to numerous CD20-expressing cell lines, as shown by flow cytometry (see Table 6). Amount of binding correlated with the levels of CD20 of the cell lines (data not shown). Binding of the RCT-antiCD20 to Ramos CD20-expressing cells was also visualized by immunofluorescence. Cells were stained for CD20 (e.g., on Ramos cells), HA (a tag on ⁇ CD20- RCTs and control RCT-HA-GPA), and DNA (using DAPI).
  • CD20 e.g., on Ramos cells
  • HA a tag on ⁇ CD20- RCTs and control RCT-HA-GPA
  • DNA using DAPI
  • a co-culture of CD20+ Ramos cells and RCT-antiCD20 showed extensive colocalization of CD20 and HA, indicating the RCTs were binding the CD20+ cells and inducing hyper-crosslinking of CD20 (data not shown).
  • a co-culture of CD20+ Ramos cells and control RCT-HA-GPA showed minimal colocalization of CD20 and HA.
  • RCT-antiCD20 but not control RCT-HA-GPA reduced BCL-xL and BCL-2 levels (see Table 7). Inhibition of the BCL2 and BCLxl anti-apoptotic pathways was dose dependent. RCT-antiCD20 was also tested for ability to penetrate solid tumors. Because an erythroid cell is much larger than an antibody, it was not expected that an erythroid cell would be able to efficiently penetrate a solid tumor. (See, e.g., Newick et al. DOI: 10.1146/annurev-med-062315- 120245, Thurber et al.
  • Xenograft tumors were formed by subcutaneous injection of Ramos cells into immunodeficient mice.
  • the mice were intravenously administered mRBC-antiCD20 or control mRBC-HA-GPA.
  • the mRBC-antiCD20 showed extensive tumor penetration, e.g., by H&E staining and HA staining, compared to mRBC-HA- GPA (Fig.3).
  • the mRBC-antiCD20 entered non-necrotic regions of the tumor, whereas mRBC-HA-GPA was generally restricted to the vasculature or necrotic regions of the tumor (Fig.3).
  • RCT-antiPD1 and RCT-antiPDL1 The ability of RCT-antiPD1 and RCT-antiPDL1 to elicit activation in a standard antigen recall assay was assayed.
  • PBMC from a CMV positive donor were stimulated with CMV peptide.
  • Memory T cells sensitive to immune checkpoint inhibition were tested for activation and gamma interferon secretin by co-culture with RCT-antiPD-1 or RCT-antiPD-L1 in comparison to control PBMCs or control RCT.
  • a 3-4 fold increase was demonstrated in interferon-gamma secretion of peripheral blood mononuclear cells (PBMC) in an antigen recall assay (Fig.6).
  • Control RCT-HA-GPA did not increase interferon-gamma levels.
  • RCT-antiPDL1 showed a 3-6 fold increase in interferon-gamma secretion in this assay (data not shown).
  • This experiment indicates that an RCT expressing an immune checkpoint inhibitor can promote an immune response by preventing checkpoint inhibition of T cells.
  • RCT-antiPDL1 were tested for the ability to promote PBMC proliferation.
  • Co-culture of PBMC with RCT-antiPDL1 resulted in a 3.6-fold increase in PBMC cells compared to PBMC alone.
  • Co-culture of PBMC with control RCT-HA-GPA resulted in only a 2.3-fold increase.
  • This experiment indicates an addition mechanism by which an RCT expressing an immune checkpoint inhibitor can promote the immune response.
  • Example 3 Erythroid cells expressing costimulatory molecules promote T cell activity
  • Enucleated erythroid cells were produced which express on their surface a fusion protein comprising, from N-to-C terminus, a 4-1BBL domain, an epitope tag (HA or Flag), and full- length GPA (extracellular, transmembrane, and cytoplasmic domains) (RCT-41BBL).
  • 41-BB-L is a co-stimulatory protein that is expressed on antigen presenting cells and binds the 41-BB receptor on T-cells. Binding of RCT-41-BB-L to recombinant 41-BB was determined using flow cytometry.
  • the RCT-41BBL were assayed by co-culture with Jurkat T cells overexpressing 4-1BB and NFkB-Luc2P (an NF ⁇ B-regulated luciferase reporter construct). Upon binding of 4-1BBL, T cells generally show elevated NF ⁇ B signalling, increased proliferation, increased secretion of IL-2 and interferon-gamma, and protection against activation induced cell death. In the assay, RCT-41BBL stimulated NF ⁇ B activation 30-fold compared with controls, as measured by luciferase activity (Fig.7). Untransduced enucleated erythroid cells did not raise luciferase levels.
  • Example 4 Erythroid cells co-expressing a binding agent to a tumor antigen and TRAIL ligand promote apoptosis in cancer cells expressing the tumor antigen
  • erythroid cells were engineered to simultaneously express anti-CD20 as well as Trail ligand (an apoptosis inducing agent) using methods described above
  • Trail ligand an apoptosis inducing agent
  • co-culture of Ramos cells with RCT-antiCD20, RCT-Trail, and RCT-antiCD20 +Trail exert 32%, 47% and 76% apoptosis respectively after 48 hours, suggesting a synergistic effect of the co- expressing RCTs on tumor cell killing.
  • Example 5 Erythroid cells expressing costimulatory molecules promote T cell activity Erythroid cells were generated that express different amounts of 4-1BB-L-HA by electroporation of increasing amounts of mRNA for 4-1BB-L-HA into RCT in the maturation phase, as described herein, as indicated in the table below. Greater amounts of electroporated mRNA led to greater expression of the encoded protein, both when measured as a percent of expressing cells and copies that are expressed per cell. Table 10 summarizes the expression level, based on 2 duplicates.
  • Jurkat 4-1BB NFkB/Luc cells were also incubated with increasing concentration of the 4-1BB agonist Utomilumab (concentration ranging from 0.001nM to 100nM) with or without a secondary anti human IgG that was used for cross linking of Utomilumab, at a concentration ranging from 0.0025nM to 250nM.
  • Utomilumab alone did not increase NFkB activity in this assay, nor did the secondary antibody alone or the control RCT in any of the concentrations tested.
  • 4-1BB-L RCT were also shown to increase PBMC proliferation.
  • Human peripheral blood mononuclear cells (PBMC) from 3 different donors were obtained from Astrate biologics and were analyzed in a proliferation assay.
  • PBMCs were labelled with Cell Trace Far Red (CTFR, Thermo-Fisher) according to the manufacturer protocol.
  • CTFR Cell Trace Far Red
  • 100000 CTFR labelled PBMCs were left untreated or stimulated with 0.5ug/mL CD3 antibody.
  • Cells were incubated with 12,500, 25,000 or 50,000 RCT (control or expressing 4-1BB-L), or increasing doses of
  • Utomilumab (1nM, 10nM or 100nM) or isotype control antibody, with or without a secondary anti human IgG antibody (2.5nM, 25nM or 250nM). Cells were incubated for 5 days and analyzed in flow cytometry. As shown in Figure 10, Utomilumab with cross linking antibody led to a small increase in proliferation of CD4 and CD8 T cells. On the other hand, incubation of CTFR PBMC with RCT 4-1BB-L led to a dose dependent 2-2.5 fold increase in CD4
  • Cells were incubated with 12,500, 25,000, 50,000 or 100,000 RCT (control or 4-1BB-L), or increasing doses of Utomilumab (1nM, 10nM, 100nM or 1uM) or isotype control antibody, with or without a secondary anti human IgG antibody (2.5nM, 25nM, 250nM or 2.5uM). Cells were incubated for 5 days and analyzed for cytokine secretion in flow cytometry based cytokine panel
  • Example 6 Erythroid cells comprising 41BBL slow tumor growth in vivo
  • An MC38 mouse model system for colon cancer was used to test the effects of erythroid cells comprising 4-1BBL on tumor growth.
  • 41BBL is thought to slow tumor growth by eliciting diverse immune effector responses on both the innate and adaptive immune arms. The most potent responses stimulate CD8+ cytotoxic T cells to proliferate and increase their effector potential through increased interferon gamma production and expression of multiple granzymes.
  • mice For dosing animals, there were an average of 1.1e9 m4-1BB-L mRBCs administered per dose with an average of 36,200 m4-1BB-L molecules per cell corresponding to 0.084 mg/kg m4-1BB-L per dose.
  • mice Fourteen female C57/B6 aged 6-8 weeks mice were inoculated s.c. in left flank with 5 x 10 5 MC-38 cells. Animals’ weights and condition were recorded daily, and tumors were measured 3 times per week. Tumors were measured three times a week by measuring each tumor in 2 dimensions. Tumor volumes were calculated using the standard formula: (L x W 2 )/2. The mean tumor weight and standard error of the mean was calculated for each group at each time point.
  • Example 7 Erythroid cells expressing an exogenous polypeptide comprising a binding agent to a tumor antigen penetrate solid tumors
  • Enucleated erythroid cells were conjugated with anti-PD-L1 at their surface and tested for the ability to infiltrate tumors in mice. Mice were inoculated with B16F10 cells SC. Tumors were allowed to grow to 400 cubic mm before dosing.
  • Murine RBC were conjugated with fragments antibody (Fab) from anti murine PD-L1 and isotype control. Conjugated murine RBC were labelled with CTFR according to the manufacturer’s protocol. Cells were infused into the animals. One day after infusion, tumors were collected.
  • Fab fragments antibody
  • Tumors were sectioned and stained with anti CD31 to visualize tumor vasculature and DAPI to visualize nuclei. Stained sections were scanned and pictures were taken. Using Halo software, the tumor areas and vasculature areas were identified. Total cell counts of labelled RBC in these two areas were taken for both isotype control and anti-PD-L1. The ratio between the RBC found in the tumor and the RBC found in the vessels was calculated. The data presented in Figure 13 suggests that the ratio between RBC in the vessels and RBC in the tumor is 1 (average of measurement in tumors from 8 mice) for the isotype control conjugated RBC, indicating similar amounts in the tumor and the vasculature.
  • the ratio between RBC in the vessel and RBC in the tumor is 1.7 for the anti PD-L1 treated mice, indicating enrichment of RBC in the tumor in the anti-PD-L1 group in comparison with the isotype control mice.
  • the difference in ratio between the 2 groups was statistically significant with P ⁇ 0.01 (student T test). While not wishing to be bound by theory, tumors expressing higher levels of PD-L1 may respond better to RCTs comprising anti-PD-L1 than tumors that express lower levels of PD-L1.
  • the B16F10 cells expressed about 300,000 copies per cell of PD-L1 when stimulated with IFN- gamma at 10 ng/ul.
  • CT26 cells expressed about 150,000 copies per cell of PD-L1 and A20 cells expressed about 100,000 copies per cell of PD-L1 under the same conditions.
  • PD- L1 copy number was measured using a Quantum Simply Cellular kit (Bangs Laboratories). Erythroid cells comprising an anti-PD-L1 antibody at their surface showed greater binding to the IFN-gamma treated B16F10 cells and CT26 than to the A20 cells, consistent with greater levels of PD-L1 expression on the tumor cells leading to increased binding of the erythroid cells to the tumor cells.
  • Example 8 Erythroid cells expressing two agents promote greater immune effector cell stimulation than either polypeptide expressed alone.
  • IL-2 ELISA was performed to evaluated IL-2 secretion to the media as a result of incubation with RCT-anti PD-L1 and RCT 4-1BB-L.
  • RCT anti PD-L1 led to 4 fold increase in IL-2 secretion as compared to PBMCs alone.
  • RCT 4-1BB-L led to a 10 fold increased secretion of 4-1BB-L, whereas the combination of RCT anti PD-L1 and RCT-4-1BB-L led to a 13 fold increase in IL-2 secretion.
  • the antigen recall assay was performed using 200,000 PBMCs from a CMV-positive donor (Astarte), which were stimulated using lysate of CMV-infected cells (Astarte) at 2ug/mL. PBMCs were then incubated with 100,000 RCT expressing the indicated exogenous protein for 4 days. Cells were analyzed for the presence of memory T cells population with flow cytometry to detect cells that are CD4+ and CD45RO+. Supernatant from these experiments was collected and analyzed for IFNg using ELISA. These experiments indicate that erythroid cells expressing a variety of costimulatory molecules induce T cell activation.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Wood Science & Technology (AREA)
  • Mycology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2017/064299 2016-12-02 2017-12-01 Compositions and methods related to cell systems for penetrating solid tumors Ceased WO2018102740A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
MX2019006423A MX2019006423A (es) 2016-12-02 2017-12-01 Composiciones y metodos relacionados con sistemas de celulas para penetrar en tumores solidos.
EP17825997.4A EP3548050A1 (en) 2016-12-02 2017-12-01 Compositions and methods related to cell systems for penetrating solid tumors
KR1020197019135A KR20190091497A (ko) 2016-12-02 2017-12-01 고형 종양으로의 침투를 위한 세포 시스템과 관련된 조성물 및 방법
CN201780074241.2A CN110225756A (zh) 2016-12-02 2017-12-01 与用于穿透实体瘤的细胞系统相关的组合物和方法
BR112019011138-7A BR112019011138A2 (pt) 2016-12-02 2017-12-01 composições e métodos relacionados com sistemas celulares para penetração em tumores sólidos
CA3045331A CA3045331A1 (en) 2016-12-02 2017-12-01 Compositions and methods related to cell systems for penetrating solid tumors
AU2017366706A AU2017366706A1 (en) 2016-12-02 2017-12-01 Compositions and methods related to cell systems for penetrating solid tumors
JP2019529525A JP2019536793A (ja) 2016-12-02 2017-12-01 固形腫瘍に浸透させるための細胞系に関連する組成物および方法
RU2019120400A RU2019120400A (ru) 2016-12-02 2017-12-01 Композиции и способы, связанные с клеточными системами для проникновения в солидные опухоли
IL266940A IL266940A (en) 2016-12-02 2019-05-28 Preparations and methods related to cell systems for infiltrating solid tumors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662429275P 2016-12-02 2016-12-02
US62/429,275 2016-12-02

Publications (1)

Publication Number Publication Date
WO2018102740A1 true WO2018102740A1 (en) 2018-06-07

Family

ID=60937855

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/064299 Ceased WO2018102740A1 (en) 2016-12-02 2017-12-01 Compositions and methods related to cell systems for penetrating solid tumors

Country Status (13)

Country Link
US (2) US20180153989A1 (enExample)
EP (1) EP3548050A1 (enExample)
JP (1) JP2019536793A (enExample)
KR (1) KR20190091497A (enExample)
CN (1) CN110225756A (enExample)
AU (1) AU2017366706A1 (enExample)
BR (1) BR112019011138A2 (enExample)
CA (1) CA3045331A1 (enExample)
IL (1) IL266940A (enExample)
MX (1) MX2019006423A (enExample)
RU (1) RU2019120400A (enExample)
SG (1) SG10202105661TA (enExample)
WO (1) WO2018102740A1 (enExample)

Cited By (60)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019090148A3 (en) * 2017-11-03 2019-06-13 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems for tumor growth inhibition
WO2019173798A1 (en) * 2018-03-08 2019-09-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
WO2020150608A1 (en) 2019-01-18 2020-07-23 Flagship Pioneering, Inc. Trem compositions and uses thereof
WO2020181013A1 (en) 2019-03-04 2020-09-10 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides and pharmaceutical compositions thereof
WO2020198403A2 (en) 2019-03-25 2020-10-01 Flagship Pioneering Innovations Vi, Llc Compositions comprising modified circular polyribonucleotides and uses thereof
WO2020243560A1 (en) 2019-05-31 2020-12-03 Flagship Pioneering, Inc. Uses of trem compositions to modulate trna pools
WO2020252436A1 (en) 2019-06-14 2020-12-17 Flagship Pioneering Innovations Vi, Llc Circular rnas for cellular therapy
WO2020257730A1 (en) 2019-06-19 2020-12-24 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides for protein modulation and uses thereof
WO2021092064A1 (en) 2019-11-04 2021-05-14 Flagship Pioneering, Inc. Trem compositions for con-rare codons and related uses
WO2021092073A1 (en) 2019-11-04 2021-05-14 Flagship Pioneering, Inc. Methods of modifying a nucleic acid sequence
WO2021155177A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Compositions comprising linear polyribonucleotides for protein modulation and uses thereof
WO2021155171A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Delivery of compositions comprising circular polyribonucleotides
WO2021155175A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Compositions for translation and methods of use thereof
US11166996B2 (en) 2018-12-12 2021-11-09 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use
WO2021236980A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering Innovations Vi, Llc Coronavirus antigen compositions and their uses
WO2021236952A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering, Inc. Compositions and methods for producing human polyclonal antibodies
WO2021236930A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2021243290A1 (en) 2020-05-29 2021-12-02 Flagship Pioneering Innovations Vi, Llc Trem compositions and methods relating thereto
WO2021243301A2 (en) 2020-05-29 2021-12-02 Flagship Pioneering Innovations Vi, Llc. Trem compositions and methods relating thereto
WO2021262799A1 (en) 2020-06-23 2021-12-30 Flagship Pioneering, Inc. Anti-viral compounds and methods of using same
CN114026121A (zh) * 2019-01-28 2022-02-08 赛诺菲 治疗多发性骨髓瘤的方法
WO2022051629A1 (en) 2020-09-03 2022-03-10 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2022140702A1 (en) 2020-12-23 2022-06-30 Flagship Pioneering, Inc. Compositions of modified trems and uses thereof
WO2022212784A1 (en) 2021-03-31 2022-10-06 Flagship Pioneering Innovations V, Inc. Thanotransmission polypeptides and their use in treating cancer
WO2023009547A1 (en) 2021-07-26 2023-02-02 Flagship Pioneering Innovations Vi, Llc Trem compositions and uses thereof
WO2023044006A1 (en) 2021-09-17 2023-03-23 Flagship Pioneering Innovations Vi, Llc Compositions and methods for producing circular polyribonucleotides
WO2023069397A1 (en) 2021-10-18 2023-04-27 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2023097003A2 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and their uses
WO2023096990A1 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovation Vi, Llc Coronavirus immunogen compositions and their uses
WO2023096963A1 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovations Vi, Llc Varicella-zoster virus immunogen compositions and their uses
WO2023122789A1 (en) 2021-12-23 2023-06-29 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides encoding antifusogenic polypeptides
WO2023122745A1 (en) 2021-12-22 2023-06-29 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2023220083A1 (en) 2022-05-09 2023-11-16 Flagship Pioneering Innovations Vi, Llc Trem compositions and methods of use for treating proliferative disorders
WO2023220729A2 (en) 2022-05-13 2023-11-16 Flagship Pioneering Innovations Vii, Llc Double stranded dna compositions and related methods
WO2023230570A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating genetic drivers
WO2023230573A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulation of immune responses
WO2023230549A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulation of tumor suppressors and oncogenes
WO2023230578A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating circulating factors
WO2023230566A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating cytokines
WO2023250112A1 (en) 2022-06-22 2023-12-28 Flagship Pioneering Innovations Vi, Llc Compositions of modified trems and uses thereof
WO2024077191A1 (en) 2022-10-05 2024-04-11 Flagship Pioneering Innovations V, Inc. Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer
WO2024097664A1 (en) 2022-10-31 2024-05-10 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2024102799A1 (en) 2022-11-08 2024-05-16 Flagship Pioneering Innovations Vi, Llc Compositions and methods for producing circular polyribonucleotides
WO2024129988A1 (en) 2022-12-14 2024-06-20 Flagship Pioneering Innovations Vii, Llc Compositions and methods for delivery of therapeutic agents to bone
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
WO2024151673A2 (en) 2023-01-09 2024-07-18 President And Fellows Of Harvard College Recombinant nucleic acid molecules and their use in wound healing
WO2024151685A1 (en) 2023-01-09 2024-07-18 Beth Israel Deaconess Medical Center, Inc. Recombinant nucleic acid molecules and their use in wound healing
WO2024173828A1 (en) 2023-02-17 2024-08-22 Flagship Pioneering Innovations Vii, Llc Dna compositions comprising modified uracil
WO2024173836A2 (en) 2023-02-17 2024-08-22 Flagship Pioneering Innovations Vii, Llc Dna compositions comprising modified cytosine
US12089930B2 (en) 2018-03-05 2024-09-17 Marquette University Method and apparatus for non-invasive hemoglobin level prediction
WO2024192420A1 (en) 2023-03-15 2024-09-19 Flagship Pioneering Innovations Vi, Llc Compositions comprising polyribonucleotides and uses thereof
WO2024192422A1 (en) 2023-03-15 2024-09-19 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2024216128A1 (en) 2023-04-12 2024-10-17 Flagship Pioneering Innovations Vi, Llc Trems for use in correction of missense mutations
WO2025006684A1 (en) 2023-06-28 2025-01-02 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides encoding antifusogenic polypeptides
WO2025042786A1 (en) 2023-08-18 2025-02-27 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides and uses thereof
WO2025096807A2 (en) 2023-10-31 2025-05-08 Flagship Pioneering Innovations Vii, Llc Novel therapeutic dna forms
WO2026006577A1 (en) 2024-06-26 2026-01-02 Flagship Pioneering Innovations Vii, Llc Therapeutic circular dna forms
WO2026055547A1 (en) 2024-09-06 2026-03-12 Flagship Pioneering Innovations Vii, Llc Dna compositions and related methods
WO2026055543A1 (en) 2024-09-06 2026-03-12 Flagship Pioneering Innovations Vii, Llc Modified dna compositions and related methods
WO2026064313A1 (en) 2024-09-17 2026-03-26 Flagship Pioneering Innovations Vii, Llc Rna compositions and related methods

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3071515A2 (en) 2013-11-18 2016-09-28 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
EP3583946A1 (en) 2014-04-01 2019-12-25 Rubius Therapeutics, Inc. Enucleated hematopoietic cells comprising an exogenous antigen
PT3402491T (pt) 2016-01-11 2022-03-03 Rubius Therapeutics Inc Composições e métodos relacionados com sistemas celulares terapêuticos multimodais para indicações de cancro
PL3469361T3 (pl) 2016-06-10 2025-02-03 Gadeta B.V. Nowy sposób identyfikacji łańcuchów receptora limfocytu t delta (lub limfocytu t gamma) lub części tych łańcuchów, które pośredniczą w odpowiedzi przeciwnowotworowej lub przeciwzakaźnej
CA3052142A1 (en) 2017-02-17 2018-08-23 Rubius Therapeutics, Inc. Functionalized erythroid cells
US10960071B2 (en) 2017-08-07 2021-03-30 The Regents Of The University Of California Platform for generating safe cell therapeutics
WO2019032628A1 (en) 2017-08-07 2019-02-14 The Regents Of The University Of California GENERATING PLATFORM FOR SAFE CELLULAR THERAPEUTIC AGENTS
WO2020028134A1 (en) * 2018-07-30 2020-02-06 Fred Hutchinson Cancer Research Center Methods and compositions for treating cancer
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
US20220330541A1 (en) 2019-09-05 2022-10-20 Hemanext Inc. Methods for the Preservation of Reagent Red Blood Cells Using Carbon Monoxide
WO2021068971A1 (en) * 2019-10-12 2021-04-15 Bio-Thera Solutions, Ltd. Anti-cd20 antibody formulation and use of anti-cd20 antibody for treatment of cd20 positive diseases
WO2022183057A1 (en) * 2021-02-26 2022-09-01 Cytonus Therapeutics, Inc. Compositions and methods for therapeutic delivery
CA3213636A1 (en) * 2021-03-18 2022-09-22 Seagen Inc. Selective drug release from internalized conjugates of biologically active compounds
WO2022214707A1 (en) * 2021-04-09 2022-10-13 Gadeta B.V. Cellular reporter and methods of using the same
CN115368462B (zh) * 2022-07-19 2026-01-02 合肥天港免疫药物有限公司 双特异性抗体及其应用
WO2024097859A1 (en) * 2022-11-03 2024-05-10 Board Of Regents, The University Of Texas System An adjuvant and cd47-blockade combination cancer treatment and methods of using the same

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009080837A1 (en) * 2007-12-24 2009-07-02 Erytech Pharma Medicament for the treatment of cancer of the pancreas
WO2014183071A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research In vitro production of red blood cells with sortaggable proteins
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
WO2015073587A2 (en) 2013-11-18 2015-05-21 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
WO2015153102A1 (en) 2014-04-01 2015-10-08 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9605709D0 (en) * 1996-03-19 1996-05-22 Cortecs Ltd Method
US20040229335A1 (en) * 2003-05-15 2004-11-18 Introgen Therapeutics, Inc. Methods and compositions for the production of adenoviral vectors
US20100040546A1 (en) * 2008-08-13 2010-02-18 Searete Llc, A Limited Liability Corporation Of The State Of Delaware Biological targeting compositions and methods of using the same
US8461311B2 (en) * 2010-06-08 2013-06-11 Washington University TRAIL trimers, methods and uses therefor

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009080837A1 (en) * 2007-12-24 2009-07-02 Erytech Pharma Medicament for the treatment of cancer of the pancreas
WO2014183071A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research In vitro production of red blood cells with sortaggable proteins
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
WO2015073587A2 (en) 2013-11-18 2015-05-21 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US20160257932A1 (en) * 2013-11-18 2016-09-08 Rubius Therapeutics, Inc. Genetically engineered enucleated erythroid cells comprising a phenylalanine ammonia lyase receiver polypeptide
WO2015153102A1 (en) 2014-04-01 2015-10-08 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation

Non-Patent Citations (23)

* Cited by examiner, † Cited by third party
Title
AGARWAL ET AL.: "Blood group phenotype frequencies in blood donors from a tertiary care hospital in north India", BLOOD RES., vol. 48, no. 1, March 2013 (2013-03-01), pages 51 - 54
AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948
BUCHSBAUM ET AL., FUTURE ONCOL, vol. 4, 3 August 2007 (2007-08-03)
CHAO WANG ET AL: "Multifunctional Theranostic Red Blood Cells For Magnetic-Field-Enhanced in vivo Combination Therapy of Cancer", ADVANCED MATERIALS, vol. 26, no. 28, 1 July 2014 (2014-07-01), DE, pages 4794 - 4802, XP055453317, ISSN: 0935-9648, DOI: 10.1002/adma.201400158 *
CLIN CANCER RES., vol. 6, no. 5, May 2000 (2000-05-01), pages 1875 - 81
EUR J CANCER., vol. 45, no. 2, January 2009 (2009-01-01), pages 228 - 47
FRONT IMMUNOL., vol. 4, 11 December 2013 (2013-12-11), pages 438
GASPARIAN ET AL., APOPTOSIS, vol. 6, 14 June 2009 (2009-06-14)
GREEN; SAMBROOK, MOLECULAR CLONING, 2012
KABAT ET AL.: "Sequences of Proteins of Immunological Interest 5th Ed.", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KIM ET AL., JACS, vol. 137, no. 1, 2016
LIENERT ET AL.: "Synthetic biology in mammalian cells: next generation research tools and therapeutics", NATURE REVIEWS MOLECULAR CELL BIOLOGY, vol. 15, 2014, pages 95 - 107, XP055206837, DOI: doi:10.1038/nrm3738
LIU ET AL., NAT. BIOTECH., vol. 25, 2007, pages 454 - 464
MITRA ET AL.: "Blood groups systems", INDIAN J ANAESTH., vol. 58, no. 5, September 2014 (2014-09-01), pages 524 - 528
MOHR ET AL., BMC CANCER, vol. 15, 2015, pages 494
MUKTHAVARAM RAJESH ET AL: "Targeting and depletion of circulating leukocytes and cancer cells by lipophilic antibody-modified erythrocytes", JOURNAL OF CONTROLLED RELEASE, vol. 183, 2014, pages 146 - 153, XP028648103, ISSN: 0168-3659, DOI: 10.1016/J.JCONREL.2014.03.038 *
NATURE, vol. 500, no. 7463, 22 August 2013 (2013-08-22), pages 415 - 21
NATURE, vol. 515, no. 7528, 27 November 2014 (2014-11-27), pages 577 - 81
POLYAK ET AL.: "Identification of a Cytoplasmic Region of CD20 Required for Its Redistribution to a Detergent-Insoluble Membrane Compartment", THE JOURNAL OF IMMUNOLOGY, vol. 161, no. 7, 1 October 1998 (1998-10-01), pages 3242 - 3248, XP002390461
See also references of EP3548050A1
TEMPLETON, GENE AND CELL THERAPY, 2015
TRENDS IMMUNOL., vol. 35, no. 11, November 2014 (2014-11-01), pages 571 - 80
VLADIMIR R MUZYKANTOV: "Drug delivery by red blood cells: vascular carriers designed by mother nature", EXPERT OPINION ON DRUG DELIVERY, vol. 7, no. 4, 1 April 2010 (2010-04-01), pages 403 - 427, XP055088510, ISSN: 1742-5247, DOI: 10.1517/17425241003610633 *

Cited By (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019090148A3 (en) * 2017-11-03 2019-06-13 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems for tumor growth inhibition
US12089930B2 (en) 2018-03-05 2024-09-17 Marquette University Method and apparatus for non-invasive hemoglobin level prediction
WO2019173798A1 (en) * 2018-03-08 2019-09-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
US11141433B2 (en) 2018-03-08 2021-10-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
US11446344B1 (en) 2018-12-12 2022-09-20 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use
US11166996B2 (en) 2018-12-12 2021-11-09 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use
WO2020150608A1 (en) 2019-01-18 2020-07-23 Flagship Pioneering, Inc. Trem compositions and uses thereof
CN114026121A (zh) * 2019-01-28 2022-02-08 赛诺菲 治疗多发性骨髓瘤的方法
WO2020181013A1 (en) 2019-03-04 2020-09-10 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides and pharmaceutical compositions thereof
WO2020198403A2 (en) 2019-03-25 2020-10-01 Flagship Pioneering Innovations Vi, Llc Compositions comprising modified circular polyribonucleotides and uses thereof
WO2020243560A1 (en) 2019-05-31 2020-12-03 Flagship Pioneering, Inc. Uses of trem compositions to modulate trna pools
WO2020252436A1 (en) 2019-06-14 2020-12-17 Flagship Pioneering Innovations Vi, Llc Circular rnas for cellular therapy
WO2020257730A1 (en) 2019-06-19 2020-12-24 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides for protein modulation and uses thereof
WO2021092073A1 (en) 2019-11-04 2021-05-14 Flagship Pioneering, Inc. Methods of modifying a nucleic acid sequence
WO2021092064A1 (en) 2019-11-04 2021-05-14 Flagship Pioneering, Inc. Trem compositions for con-rare codons and related uses
WO2021155177A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Compositions comprising linear polyribonucleotides for protein modulation and uses thereof
WO2021155175A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Compositions for translation and methods of use thereof
WO2021155171A1 (en) 2020-01-29 2021-08-05 Flagship Pioneering Innovations Vi, Llc Delivery of compositions comprising circular polyribonucleotides
WO2021236952A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering, Inc. Compositions and methods for producing human polyclonal antibodies
WO2021236930A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2021236980A1 (en) 2020-05-20 2021-11-25 Flagship Pioneering Innovations Vi, Llc Coronavirus antigen compositions and their uses
WO2021243290A1 (en) 2020-05-29 2021-12-02 Flagship Pioneering Innovations Vi, Llc Trem compositions and methods relating thereto
WO2021243301A2 (en) 2020-05-29 2021-12-02 Flagship Pioneering Innovations Vi, Llc. Trem compositions and methods relating thereto
WO2021262799A1 (en) 2020-06-23 2021-12-30 Flagship Pioneering, Inc. Anti-viral compounds and methods of using same
WO2022051629A1 (en) 2020-09-03 2022-03-10 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2022140702A1 (en) 2020-12-23 2022-06-30 Flagship Pioneering, Inc. Compositions of modified trems and uses thereof
WO2022212784A1 (en) 2021-03-31 2022-10-06 Flagship Pioneering Innovations V, Inc. Thanotransmission polypeptides and their use in treating cancer
WO2023009547A1 (en) 2021-07-26 2023-02-02 Flagship Pioneering Innovations Vi, Llc Trem compositions and uses thereof
WO2023044006A1 (en) 2021-09-17 2023-03-23 Flagship Pioneering Innovations Vi, Llc Compositions and methods for producing circular polyribonucleotides
EP4464783A2 (en) 2021-09-17 2024-11-20 Flagship Pioneering Innovations VI, LLC Compositions and methods for producing circular polyribonucleotides
WO2023069397A1 (en) 2021-10-18 2023-04-27 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2023096963A1 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovations Vi, Llc Varicella-zoster virus immunogen compositions and their uses
WO2023096990A1 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovation Vi, Llc Coronavirus immunogen compositions and their uses
WO2023097003A2 (en) 2021-11-24 2023-06-01 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and their uses
WO2023122745A1 (en) 2021-12-22 2023-06-29 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2023122789A1 (en) 2021-12-23 2023-06-29 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides encoding antifusogenic polypeptides
WO2023220083A1 (en) 2022-05-09 2023-11-16 Flagship Pioneering Innovations Vi, Llc Trem compositions and methods of use for treating proliferative disorders
WO2023220729A2 (en) 2022-05-13 2023-11-16 Flagship Pioneering Innovations Vii, Llc Double stranded dna compositions and related methods
EP4641203A2 (en) 2022-05-25 2025-10-29 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulating cytokines
WO2023230578A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating circulating factors
WO2023230566A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating cytokines
WO2023230573A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulation of immune responses
EP4650780A2 (en) 2022-05-25 2025-11-19 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulating circulating factors
WO2023230570A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating genetic drivers
EP4641202A2 (en) 2022-05-25 2025-10-29 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulation of immune responses
EP4640849A2 (en) 2022-05-25 2025-10-29 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulating genetic drivers
EP4641201A2 (en) 2022-05-25 2025-10-29 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulation of tumor suppressors and oncogenes
WO2023230549A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulation of tumor suppressors and oncogenes
WO2023250112A1 (en) 2022-06-22 2023-12-28 Flagship Pioneering Innovations Vi, Llc Compositions of modified trems and uses thereof
WO2024077191A1 (en) 2022-10-05 2024-04-11 Flagship Pioneering Innovations V, Inc. Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer
WO2024097664A1 (en) 2022-10-31 2024-05-10 Flagship Pioneering Innovations Vi, Llc Compositions and methods for purifying polyribonucleotides
WO2024102799A1 (en) 2022-11-08 2024-05-16 Flagship Pioneering Innovations Vi, Llc Compositions and methods for producing circular polyribonucleotides
WO2024129988A1 (en) 2022-12-14 2024-06-20 Flagship Pioneering Innovations Vii, Llc Compositions and methods for delivery of therapeutic agents to bone
WO2024151673A2 (en) 2023-01-09 2024-07-18 President And Fellows Of Harvard College Recombinant nucleic acid molecules and their use in wound healing
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
WO2024151685A1 (en) 2023-01-09 2024-07-18 Beth Israel Deaconess Medical Center, Inc. Recombinant nucleic acid molecules and their use in wound healing
WO2024173836A2 (en) 2023-02-17 2024-08-22 Flagship Pioneering Innovations Vii, Llc Dna compositions comprising modified cytosine
WO2024173828A1 (en) 2023-02-17 2024-08-22 Flagship Pioneering Innovations Vii, Llc Dna compositions comprising modified uracil
WO2024192422A1 (en) 2023-03-15 2024-09-19 Flagship Pioneering Innovations Vi, Llc Immunogenic compositions and uses thereof
WO2024192420A1 (en) 2023-03-15 2024-09-19 Flagship Pioneering Innovations Vi, Llc Compositions comprising polyribonucleotides and uses thereof
WO2024216128A1 (en) 2023-04-12 2024-10-17 Flagship Pioneering Innovations Vi, Llc Trems for use in correction of missense mutations
WO2025006684A1 (en) 2023-06-28 2025-01-02 Flagship Pioneering Innovations Vi, Llc Circular polyribonucleotides encoding antifusogenic polypeptides
WO2025042786A1 (en) 2023-08-18 2025-02-27 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides and uses thereof
WO2025096807A2 (en) 2023-10-31 2025-05-08 Flagship Pioneering Innovations Vii, Llc Novel therapeutic dna forms
WO2026006577A1 (en) 2024-06-26 2026-01-02 Flagship Pioneering Innovations Vii, Llc Therapeutic circular dna forms
WO2026055547A1 (en) 2024-09-06 2026-03-12 Flagship Pioneering Innovations Vii, Llc Dna compositions and related methods
WO2026055543A1 (en) 2024-09-06 2026-03-12 Flagship Pioneering Innovations Vii, Llc Modified dna compositions and related methods
WO2026064313A1 (en) 2024-09-17 2026-03-26 Flagship Pioneering Innovations Vii, Llc Rna compositions and related methods

Also Published As

Publication number Publication date
US20200345845A1 (en) 2020-11-05
JP2019536793A (ja) 2019-12-19
US20180153989A1 (en) 2018-06-07
EP3548050A1 (en) 2019-10-09
CA3045331A1 (en) 2018-06-07
AU2017366706A1 (en) 2019-06-13
RU2019120400A (ru) 2021-01-11
SG10202105661TA (en) 2021-07-29
CN110225756A (zh) 2019-09-10
KR20190091497A (ko) 2019-08-06
BR112019011138A2 (pt) 2019-10-01
RU2019120400A3 (enExample) 2021-04-23
MX2019006423A (es) 2019-08-22
IL266940A (en) 2019-07-31

Similar Documents

Publication Publication Date Title
EP3548050A1 (en) Compositions and methods related to cell systems for penetrating solid tumors
AU2018250336B2 (en) Engineered cells expressing prostate-specific membrane antigen (PSMA) or a modified form thereof and related methods
US12617849B2 (en) Antigen specific CD19-targeted CAR-T cells
WO2021188599A1 (en) Novel antigen binding domains and synthetic antigen receptors incorporating the same
CA3090546A1 (en) Chimeric antigen receptors targeting the tumor microenvironment
KR20200120939A (ko) 변형된 만능성 줄기 세포, 및 제조 및 사용 방법
JP2018532432A (ja) Traf誘導ドメインを含有するキメラ受容体ならびに関連する組成物および方法
JP7524465B2 (ja) 免疫細胞機能の改善
US20200369767A1 (en) Regimes for co-administration of immunotherapeutic agents against c-kit and cd47
JP7690597B2 (ja) 免疫細胞機能の改善
US20200262894A1 (en) Strep-tag specific binding proteins and uses thereof
US20240091356A1 (en) Bi-specific car t ccells for b cell malignancies
WO2026003364A1 (en) Chimeric coreceptors
HK40068212A (en) Regimes for co-administration of immunotherapeutic agents against c-kit and cd47

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17825997

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3045331

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019529525

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019011138

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017366706

Country of ref document: AU

Date of ref document: 20171201

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197019135

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017825997

Country of ref document: EP

Effective date: 20190702

ENP Entry into the national phase

Ref document number: 112019011138

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190530