WO2018102304A1 - Methods of treating prlr positive breast cancer - Google Patents
Methods of treating prlr positive breast cancer Download PDFInfo
- Publication number
- WO2018102304A1 WO2018102304A1 PCT/US2017/063476 US2017063476W WO2018102304A1 WO 2018102304 A1 WO2018102304 A1 WO 2018102304A1 US 2017063476 W US2017063476 W US 2017063476W WO 2018102304 A1 WO2018102304 A1 WO 2018102304A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- prlr
- antibody
- seq
- antigen
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C[C@@](C(O[C@@](CC(N(C)c(cc(CC(C)=CC=C[C@]([C@@](C1)(N2)O)OC)cc3OC)c3Cl)=O)[C@]3(C)O[C@]3[C@](C)[C@]1OC2=O)=O)N(C)C(*N)=O Chemical compound C[C@@](C(O[C@@](CC(N(C)c(cc(CC(C)=CC=C[C@]([C@@](C1)(N2)O)OC)cc3OC)c3Cl)=O)[C@]3(C)O[C@]3[C@](C)[C@]1OC2=O)=O)N(C)C(*N)=O 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
- A61K31/195—Carboxylic acids, e.g. valproic acid having an amino group
- A61K31/197—Carboxylic acids, e.g. valproic acid having an amino group the amino and the carboxyl groups being attached to the same acyclic carbon chain, e.g. gamma-aminobutyric acid [GABA], beta-alanine, epsilon-aminocaproic acid or pantothenic acid
- A61K31/198—Alpha-amino acids, e.g. alanine or edetic acid [EDTA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/27—Esters, e.g. nitroglycerine, selenocyanates of carbamic or thiocarbamic acids, meprobamate, carbachol, neostigmine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5365—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/56—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
- A61K31/565—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids not substituted in position 17 beta by a carbon atom, e.g. estrane, estradiol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57554—Prolactin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2869—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure is related to methods of treating PRLR positive breast cancer using (a) an antibody-drug conjugate comprising an anti-PRLR antibody conjugated to a cytotoxic agent and (b) fulvestrant.
- sequence listing is submitted concurrently with the specification electronically via EFS-Web as an ASCII formatted sequence listing with a file name of "10314Pl-US_SeqListing.txt", a creation date of November 29, 2016, and a size of about 144KB.
- the sequence listing contained in this ASCII formatted document is part of the specification and is herein incorporated by reference in its entirety.
- Prolactin is a polypeptide growth hormone that exerts its activity by interacting with the prolactin receptor (PRLR).
- PRLR is a single transmembrane receptor belonging to the class 1 cytokine receptor superfamily. The binding of prolactin to PRLR leads to receptor dimerization and intracellular signaling. Signaling through PRLR is associated with various processes such as mammary gland development, lactation, reproduction and immunomodulation. Moreover, high levels of PRLR expression have been detected in breast, prostate, and other tumor types.
- Blockade of PRLR signaling has been suggested as a means for treating breast and prostate cancer. (See, e.g., Damiano and Wasserman, Apr. 2013, Clin. Cancer Res. 19(7): 1644-1650).
- Anti-PRLR antibodies are mentioned, e.g. , in US Patent Nos. 9,302,015, 7,867,493, and 7,422,899. Nonetheless, there is a need in the art for novel methods of treating cancer and other disorders associated with PRLR expression and/or signaling.
- the present disclosure is directed toward overcoming one or more of the problems discussed above.
- ADCs antibody-drug conjugates
- the ADCs can be useful to treat PRLR positive breast cancer, and are particularly useful when used as a combination therapy with fulvestrant.
- a method of treating PRLR positive breast cancer comprising co-administering to a patient a therapeutically effective amount of: (a) an antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof conjugated to a cytotoxic agent, wherein the antibody or antigen-binding fragment thereof binds to human prolactin receptor (PRLR), and (b) fulvestrant.
- ADC antibody-drug conjugate
- PRLR human prolactin receptor
- the cytotoxic agent is a maytansinoid.
- a method of treating PRLR positive breast cancer in a patient comprising co-administering to the patient a therapeutically effective amount of: (a) an antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof conjugated to maytansinoid, wherein the antibody or antigen-binding fragment thereof binds to human prolactin receptor (PRLR), and (b) fulvestrant.
- ADC antibody-drug conjugate
- PRLR human prolactin receptor
- the maytansinoid is DM1 or DM4.
- the ADC kills cells that express PRLR at an expression level of less than 30-fold above background, for example, at an expression level of less than
- the ADC kills cells that express PRLR at an expression level greater than 12-fold above background but less than 30-fold above background.
- a method of treating PRLR positive breast cancer in a patient comprising co-administering to the patient a therapeutically effective amount of: (a) an antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof conjugated to DM1 through an MCC linker, wherein the antibody or antigen-binding fragment thereof binds to human prolactin receptor (PRLR), and (b) fulvestrant.
- ADC antibody-drug conjugate
- PRLR human prolactin receptor
- the patient was previously treated with an estrogen receptor inhibitor.
- Treatment of a PRLR positive breast cancer with an ADC described herein can have one or more of the following effects, among others: the ADC can inhibit prolactin mediated STAT5 activity; the ADC can induce mitotic arrest in cells expressing PRLR; and/or the ADC can inhibit the growth of cells expressing PRLR.
- a method for killing tumor cells that express low levels of PRLR comprising contacting the cells with: (a) an antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof conjugated to a cytotoxic agent, wherein the antibody or antigen-binding fragment thereof binds to human prolactin receptor (PRLR), and (b) fulvestrant.
- ADC antibody-drug conjugate
- PRLR human prolactin receptor
- the tumor cells express less than 1 million copies of PRLR per cell.
- the tumor cells express between 300 and 500,000 copies of PRLR per cell.
- a method for killing tumor cells that express low levels of PRLR comprising contacting the cells with: (a) an antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof conjugated to a maytansinoid, wherein the antibody or antigen-binding fragment thereof binds to human prolactin receptor (PRLR), and (b) fulvestrant.
- ADC antibody-drug conjugate
- PRLR human prolactin receptor
- the antibodies useful according to the methods provided herein can be full- length, for example, an IgGl or and IgG4 antibody, or may comprise only an antigen-binding portion, for example, a Fab, F(ab' )2, or scFv fragment, and can be modified to affect functionality, e.g., to eliminate residual effector functions (Reddy et al., (2000), J. Immunol. 164: 1925-1933).
- ADC comprising antibodies and antigen-binding fragments thereof that bind human prolactin receptor (PRLR).
- PRLR human prolactin receptor
- Table 1 sets forth the amino acid sequence identifiers of the heavy chain variable regions (HCVRs), light chain variable regions (LCVRs), heavy chain complementarity determining regions (HCDRl, HCDR2 and HCDR3), and light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) of the exemplary anti-PRLR antibodies.
- Table 2 sets forth the nucleic acid sequence identifiers of the HCVRs, LCVRs, HCDRl, HCDR2 HCDR3, LCDR1, LCDR2 and LCDR3 of the exemplary anti-PRLR antibodies.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising an HCVR comprising an amino acid sequence selected from any of the HCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising an LCVR comprising an amino acid sequence selected from any of the LCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising an HCVR and an LCVR amino acid sequence pair (HCVR/LCVR) comprising any of the HCVR amino acid sequences listed in Table 1 paired with any of the LCVR amino acid sequences listed in Table 1.
- the ADCs useful herein comprise antibodies, or antigen-binding fragments thereof, comprising an HCVR/LCVR amino acid sequence pair contained within any of the exemplary anti-PRLR antibodies listed in Table 1.
- the HCVR/LCVR amino acid sequence pair is selected from the group consisting of: 18/26; 66/74; 274/282; 290/298; and 370/378.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a heavy chain CDRl (HCDR1) comprising an amino acid sequence selected from any of the HCDR1 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- HCDR1 heavy chain CDRl
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a heavy chain CDR2 (HCDR2) comprising an amino acid sequence selected from any of the HCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- HCDR2 heavy chain CDR2
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a heavy chain CDR3 (HCDR3) comprising an amino acid sequence selected from any of the HCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- HCDR3 heavy chain CDR3
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a light chain CDRl (LCDRl) comprising an amino acid sequence selected from any of the LCDRl amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- LCDRl light chain CDRl
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a light chain CDR2 (LCDR2) comprising an amino acid sequence selected from any of the LCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a light chain CDR3 (LCDR3) comprising an amino acid sequence selected from any of the LCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising an HCDR3 and an LCDR3 amino acid sequence pair (HCDR3/LCDR3) comprising any of the HCDR3 amino acid sequences listed in Table 1 paired with any of the LCDR3 amino acid sequences listed in Table 1.
- the ADCs useful herein comprise antibodies, or antigen-binding fragments thereof, comprising an HCDR3/LCDR3 amino acid sequence pair contained within any of the exemplary anti-PRLR antibodies listed in Table 1.
- the HCDR3/LCDR3 amino acid sequence pair is selected from the group consisting of: 24/32; 72/80; 280/288; 296/304; and 376/384.
- the ADCs useful herein comprise antibodies or antigen-binding fragments thereof that specifically bind PRLR, comprising a set of six CDRs (i.e., HCDR1-HCDR2- HCDR3-LCDR1-LCDR2-LCDR3) contained within any of the exemplary anti-PRLR antibodies listed in Table 1.
- the HCDR1-HCDR2-HCDR3-LCDR1- LCDR2-LCDR3 amino acid sequences set is selected from the group consisting of: 20-22-24- 28-30-32; 68-70-72-76-78-80; 276-278-280-284-286-288; 292-294-296-300-302-304; and 372-374-376-380-382-384.
- the ADCs useful herein comprise antibodies, or antigen-binding fragments thereof that specifically bind PRLR, comprising a set of six CDRs (i.e. , HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) contained within an HCVR LCVR amino acid sequence pair as defined by any of the exemplary anti-PRLR antibodies listed in Table 1.
- the antibodies or antigen-binding fragments thereof that specifically bind PRLR comprise the HCDR 1 -HCDR2-HCDR3-LCDR 1 -LCDR2-LCDR3 amino acid sequences set contained within an HCVR/LCVR amino acid sequence pair selected from the group consisting of: 18/26; 66/74; 274/282; 290/298; and 370/378.
- Methods and techniques for identifying CDRs within HCVR and LCVR amino acid sequences are well known in the art and can be used to identify CDRs within the specified HCVR and/or LCVR amino acid sequences disclosed herein. Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g.
- the Kabat definition is based on sequence variability
- the Chothia definition is based on the location of the structural loop regions
- the AbM definition is a compromise between the Kabat and Chothia approaches. See, e.g. , Kabat, "Sequences of Proteins of Immunological Interest," National Institutes of Health, Bethesda, Md. (1991); Al-Lazikani et al. , J. Mol. Biol. 273:927-948 (1997); and Martin et al , Proc. Natl. Acad. Sci. USA ⁇ 6:9268-9272 (1989). Public databases are also available for identifying CDR sequences within an antibody.
- nucleic acid molecules encoding anti-PRLR antibodies or portions thereof, which are useful in the methods described herein.
- nucleic acid molecules are provided encoding any of the HCVR amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules are provided encoding any of the LCVR amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the HCDR1 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR1 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the HCDR2 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR2 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the HCDR3 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR3 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the LCDR1 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR1 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the LCDR2 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR2 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding any of the LCDR3 amino acid sequences listed in Table 1 ; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR3 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- nucleic acid molecules encoding an HCVR wherein the HCVR comprises a set of three CDRs (i.e. , HCDR 1 -HCDR2-HCDR3 ) , wherein the HCDR1-HCDR2-HCDR3 amino acid sequence set is as defined by any of the exemplary anti-PRLR antibodies listed in Table 1.
- nucleic acid molecules encoding an LCVR wherein the LCVR comprises a set of three CDRs (i.e. , LCDR1-LCDR2-LCDR3), wherein the LCDR1-LCDR2-LCDR3 amino acid sequence set is as defined by any of the exemplary anti- PRLR antibodies listed in Table 1.
- nucleic acid molecules encoding both an HCVR and an LCVR, wherein the HCVR comprises an amino acid sequence of any of the HCVR amino acid sequences listed in Table 1, and wherein the LCVR comprises an amino acid sequence of any of the LCVR amino acid sequences listed in Table 1.
- the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto, and a polynucleotide sequence selected from any of the LCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
- the nucleic acid molecule encodes an HCVR and LCVR, wherein the HCVR and LCVR are both derived from the same anti-PRLR antibody listed in Table 1.
- recombinant expression vectors capable of expressing a polypeptide comprising a heavy or light chain variable region of an anti-PRLR antibody.
- the recombinant expression vectors can comprise any of the nucleic acid molecules mentioned above, i.e. , nucleic acid molecules encoding any of the HCVR, LCVR, and/or CDR sequences as set forth in Table 1.
- the disclosure provides a pharmaceutical composition
- a pharmaceutical composition comprising an ADC, wherein the ADC comprises a recombinant human antibody or fragment thereof which specifically binds PRLR conjugated to cytotoxic agent, and a pharmaceutically acceptable carrier.
- the composition is an ADC comprising combination of an anti-PRLR antibody conjugated to a cytotoxic agent, and a second therapeutic agent.
- the second therapeutic agent is any agent that is advantageously combined with an anti-PRLR antibody, for example, fulvestrant.
- the ADCs can comprise an anti-PRLR antibody conjugated to a cytotoxic agent, for example, a maytansinoid.
- the maytansinoid is DM1 or DM4.
- Exemplary combination therapies, co- formulations, and ADCs involving the anti-PRLR antibodies useful in the methods provided herein are disclosed elsewhere in the present disclosure.
- therapeutic methods for killing tumor cells or for inhibiting or attenuating tumor cell growth using an anti-PRLR antibody or antigen- binding portion of an antibody as provided herein comprise administering a therapeutically effective amount of a pharmaceutical composition comprising an ADC described herein to a subject having PRLR-positive breast cancer, in addition to treatment with fulvestrant.
- the ADCs useful herein comprise anti-PRLR antibodies that interact with one or more amino acids contained within the sequence
- a peptide that comprises an amino acid sequence that is the same as that of a fragment having no more than 102 amino acids of the amino acid sequence of SEQ. ID NO.:404.
- the fragment is within the first fibronectin-like type III domain of the extracellular domain of PRLR (amino acids 27-128 of SEQ ID NO:404).
- a peptide consisting essentially of an amino acid sequence that is the same as that of a fragment having no more than 102 amino acids of the amino acid sequence of SEQ. ID NO.:404.
- the fragment is within the first fibronectin-like type III domain of the extracellular domain of PRLR (amino acids 27-128 of SEQ ID NO:404). Further provided is a peptide that consists of an amino acid sequence that is the same as that of a fragment having no more than 102 amino acids of the amino acid sequence of SEQ. ID NO.:404. In a related aspect, the fragment is within the first fibronectin-like type III domain of the extracellular domain of PRLR (amino acids 27-128 of SEQ ID NO:404).
- the fragment is selected from the group consisting of (a) amino acids 72 to 94 of SEQ ID NO:404; (b) amino acids 72 to 95 of SEQ ID NO:404; (c) amino acids 96 to 101 of SEQ ID NO:404; and (d) amino acids 96 to 102 of SEQ ID NO:404.
- the peptide can be manufactured synthetically or isolated.
- composition comprising a peptide that comprises an amino acid sequence that is the same as that of a fragment having no more than 102 amino acids of the amino acid sequence of SEQ. ID NO.:404.
- the fragment is within the first fibronectin-like type III domain of the extracellular domain of PRLR (amino acids 27-128 of SEQ ID NO:404).
- methods of detecting the presence and/or quantity of specific antibodies to the peptide in a sample comprising contacting the sample with the composition, and detecting the presence and/or measuring the quantity of the specific antibodies bound to the composition.
- the peptide is bound to a solid support.
- the peptide is labeled such as with an enzyme, florescent, biotin, or radioactive label.
- nucleic acid sequence encoding an amino acid sequence that is the same as that of a fragment having no more than 102 amino acids of the amino acid sequence of SEQ. ID NO.:404.
- the fragment is within the first fibronectin-like type III domain of the extracellular domain of PRLR (amino acids 27-128 of SEQ ID NO:404).
- peptide that comprises an amino acid sequence of
- SEQ. ID NO.:405. Also provided is a peptide that consists essentially of an amino acid sequence of SEQ. ID NO.:405. Further provided is a peptide that consists of an amino acid sequence SEQ. ID NO.:405. The peptide can be manufactured synthetically or isolated.
- FigurelA and IB demonstrates H1H6958N2 and H1H6958N2-DM1 blocking
- PRLR binding to prolactin PRL.
- H1H6958N2-DM1 and H1H6958N2 blocked binding of lOnM human PRLR to PRL with IC 50 values of 4.4nM and 5.0nM, respectively (A).
- H1H6958N2-DM1 and H1H6958N2 blocked binding of lOnM monkey PRLR to PRL with IC 50 values of 4.2nM and 5.8nM, respectively (B).
- Figure 1C shows HEK293/PRLR/STAT5-Luc cells treated with increasing concentrations of PRL (stars) resulting in an increase of luminescence (plotted as RLU), indicative of PRLR signaling-mediated induction of luciferase expression (C).
- PRL stars
- RLU luminescence
- C luciferase expression
- the non-binding control ADC (closed triangles) and the unconjugated control mAb (gray, open triangles) did not block PRL-mediated PRLR signaling under identical assay conditions. Mean and SD data is shown. RLU: relative light units. The x-axis indicates the molar concentration of ADC or mAb except for the PRL dose response curve, where molar concentration of PRL is indicated.
- Figures 2A, 2B, 2C, and 2D demonstrate H1H6958N2-DM1 is active against
- MCF7 tumors and MCF7/PRLR tumors in vivo NCr Nude mice bearing established MCF7 or MCF7/PRLR tumors were treated with H1H6958N2-DM1 and controls.
- the line graphs depict the average tumor volume + SEM per group over time. The arrow indicates the day of dosing.
- FIGS 3A, 3B, and 3C demonstrate H1H6958N2-DM1 is efficacious against in T47Dvl l tumors and has combined activity with fulvestrant.
- SCID mice bearing established T47Dvl l tumors were treated with H1H6958N2-DM1 and controls.
- T47Dvl l is a tumorigenic variant of parental T47D cells generated through in vivo passaging.
- the line graphs depict the average tumor volume + SEM per group over time. Results of a single dose study (A) and results of a multi-dose (q7dx3) study (B). Results of the single dose
- Figure 4 provides activity of weekly fulvestrant treatment of T47DvII xenografts.
- FIG. 5 demonstrates H1H6958N2-DM1 mediates mitotic arrest in T47Dvl 1 tumors.
- IHC for phospho-Histone H3 (PHH3) was used as a marker of cells accumulating in a mitotic state.
- the percent of PHH3 positive nuclei were quantified for each treatment.
- FIGS. 6A and 6B demonstrate H 1 H6958N2-DM 1 is active in TM00107
- PDX (Jackson Labs) tumors. NSG mice bearing established TM00107 tumors were treated with PRLR ADC and controls. The line graphs depict the average tumor volume + SEM per group over time. The arrow indicates the day of dosing. Results of a multi-dose (q7dx4) study (A) and the change in tumor volume at Day 30 in the multi-dose study (B).
- the expression "PRLR” includes both monomeric and multimeric PRLR molecules.
- the expression "monomeric human PRLR” means a PRLR protein or portion thereof that does not contain or possess any multimerizing domains and that exists under normal conditions as a single PRLR molecule without a direct physical connection to another PRLR molecule.
- An exemplary monomeric PRLR molecule is the molecule referred to herein as "hPRLR.mmh” comprising the amino acid sequence of SEQ ID NO:401 (see, e.g. , Example 3, herein).
- dimeric human PRLR means a construct comprising two PRLR molecules connected to one another through a linker, covalent bond, non-covalent bond, or through a multimerizing domain such as an antibody Fc domain.
- An exemplary dimeric PRLR molecule is the molecule referred to herein as "hPRLR.mFc" comprising the amino acid sequence of SEQ ID NO:402 (see, e.g., Example 3, herein).
- the expression “cell surface-expressed PRLR” means one or more PRLR protein(s), or the extracellular domain thereof, that is/are expressed on the surface of a cell in vitro or in vivo, such that at least a portion of a PRLR protein is exposed to the extracellular side of the cell membrane and is accessible to an antigen-binding portion of an antibody.
- a “cell surface-expressed PRLR” can comprise or consist of a PRLR protein expressed on the surface of a cell which normally expresses PRLR protein.
- “cell surface-expressed PRLR” can comprise or consist of PRLR protein expressed on the surface of a cell that normally does not express human PRLR on its surface but has been artificially engineered to express PRLR on its surface.
- anti-PRLR antibody includes both monovalent antibodies with a single specificity, as well as bispecific antibodies comprising a first arm that binds PRLR and a second arm that binds a second (target) antigen, wherein the anti-PRLR arm comprises any of the HCVR/LCVR or CDR sequences as set forth in Table 1 herein.
- the expression "anti-PRLR antibody” also includes antibody-drug conjugates (ADCs) comprising an anti-PRLR antibody or antigen-binding portion thereof conjugated to a drug or toxin (i.e., cytotoxic agent).
- ADCs antibody-drug conjugates
- anti-PRLR antibody also includes antibody-radionuclide conjugates (ARCs) comprising an anti-PRLR antibody or antigen- binding portion thereof conjugated to a radionuclide.
- antibody means any antigen-binding molecule or molecular complex comprising at least one complementarity determining region (CDR) that specifically binds to or interacts with a particular antigen (e.g. , PRLR).
- CDR complementarity determining region
- the term “antibody” includes immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g. , IgM).
- Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region comprises three domains, CHI , CH2 and CH3.
- Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region comprises one domain (CLI).
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the FRs of the anti-PRLR antibody may be identical to the human germline sequences, or may be naturally or artificially modified.
- An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
- antibody also includes antigen-binding fragments of full antibody molecules.
- antigen-binding portion of an antibody, “antigen- binding fragment” of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex.
- Antigen-binding fragments of an antibody may be derived, e.g. , from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains. Such DNA is known and/or is readily available from, e.g.
- DNA libraries including, e.g. , phage- antibody libraries
- the DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
- Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab')2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g. , an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3- CDR3-FR4 peptide.
- CDR complementarity determining region
- engineered molecules such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g. monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression "antigen-binding fragment," as used herein.
- SMIPs small modular immunopharmaceuticals
- An antigen-binding fragment of an antibody will typically comprise at least one variable domain.
- the variable domain may be of any size or amino acid composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences.
- the VH and VL domains may be situated relative to one another in any suitable arrangement.
- the variable region may be dimeric and contain VH-VH, VH-VL or VL-VL dimers.
- the antigen-binding fragment of an antibody may contain a monomeric VH or VL domain.
- an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain.
- variable and constant domains that may be found within an antigen-binding fragment of an antibody include: (i) VH-CH1; (ii) VH-CH2; (iii) VH- C H 3; (iv) VH-CH1-C h 2; (V) V H -CH1-C h 2-CH3; (vi) V H -C H 2-C H 3; (vii) V H -C L ; (viii) V L -C H l; (ix) VL-C h 2; (X) V L -CH3; (xi) V L -C H l-C H 2; (xii) V L -CH1-C h 2-CH3; (xiii) V L -C H 2-C H 3; and ( iv) VL-CL-
- a hinge region may consist of at least 2 (e.g. , 5, 10, 15, 20, 40, 60 or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule.
- an antigen-binding fragment of an antibody provided herein may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric VH or VL domain (e.g. , by disulfide bond(s)).
- antigen-binding fragments may be monospecific or multispecific (e.g., bispecific).
- a multispecific antigen-binding fragment of an antibody will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen.
- Any multispecific antibody format, including the exemplary bispecific antibody formats disclosed herein, may be adapted for use in the context of an antigen-binding fragment of an antibody of the present disclosure using routine techniques available in the art.
- the antibodies useful herein may function through complement-dependent cytotoxicity (CDC) or antibody-dependent cell-mediated cytotoxicity (ADCC).
- CDC complement-dependent cytotoxicity
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement-dependent cytotoxicity
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- NK Natural Killer
- CDC and ADCC can be measured using assays that are well known and available in the art. (See, e.g., U.S. Patent Nos 5,500,362 and 5,821,337, and Clynes et al. (1998) Proc. Natl.
- the constant region of an antibody is important in the ability of an antibody to fix complement and mediate cell-dependent cytotoxicity.
- the isotype of an antibody may be selected on the basis of whether it is desirable for the antibody to mediate cytotoxicity.
- the anti-PRLR antibodies provided herein are human antibodies.
- the term "human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- the antibodies may, in some embodiments, be recombinant human antibodies.
- recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described further below), antibodies isolated from a recombinant, combinatorial human antibody library (described further below), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences.
- Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences.
- such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- an immunoglobulin molecule comprises a stable four chain construct of approximately 150-160 kDa in which the dimers are held together by an interchain heavy chain disulfide bond.
- the dimers are not linked via interchain disulfide bonds and a molecule of about 75-80 kDa is formed composed of a covalently coupled light and heavy chain (half- antibody).
- the frequency of appearance of the second form in various intact IgG isotypes is due to, but not limited to, structural differences associated with the hinge region isotype of the antibody.
- a single amino acid substitution in the hinge region of the human IgG4 hinge can significantly reduce the appearance of the second form (Angal et al. (1993) Molecular Immunology 30: 105) to levels typically observed using a human IgGl hinge.
- the instant disclosure provides antibodies having one or more mutations in the hinge, CH2 or CH3 region which may be desirable, for example, in production, to improve the yield of the desired antibody form.
- the antibodies provided herein may be isolated antibodies.
- An "isolated antibody,” as used herein, means an antibody that has been identified and separated and/or recovered from at least one component of its natural environment. For example, an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced, is an “isolated antibody” for purposes of the present disclosure.
- An isolated antibody also includes an antibody in situ within a recombinant cell. Isolated antibodies are antibodies that have been subjected to at least one purification or isolation step. According to certain embodiments, an isolated antibody may be substantially free of other cellular material and/or chemicals.
- the anti-PRLR antibodies useful in the methods disclosed herein may comprise one or more amino acid substitutions, insertions and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antibodies were derived. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases.
- the present disclosure includes antibodies, and antigen-binding fragments thereof, which are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids within one or more framework and/or CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as "germline mutations").
- Germline mutations A person of ordinary skill in the art, starting with the heavy and light chain variable region sequences disclosed herein, can easily produce numerous antibodies and antigen-binding fragments which comprise one or more individual germline mutations or combinations thereof.
- all of the framework and/or CDR residues within the VH and/or VL domains are mutated back to the residues found in the original germline sequence from which the antibody was derived.
- only certain residues are mutated back to the original germline sequence, e.g. , only the mutated residues found within the first 8 amino acids of FRl or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1, CDR2 or CDR3.
- one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (i.e. , a germline sequence that is different from the germline sequence from which the antibody was originally derived).
- the antibodies of the present disclosure may contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g. , wherein certain individual residues are mutated to the corresponding residue of a particular germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence.
- antibodies and antigen-binding fragments that contain one or more germline mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc.
- Antibodies and antigen-binding fragments obtained in this general manner are encompassed within the present disclosure.
- PRLR antibodies where the antibodies comprise variants of any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein having one or more conservative substitutions.
- the anti-PRLR antibodies can have HCVR, LCVR, and/or CDR amino acid sequences with, e.g. , 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer, etc. conservative amino acid substitutions relative to any of the HCVR, LCVR, and/or CDR amino acid sequences set forth in Table 1 herein.
- epitope refers to an antigenic determinant that interacts with a specific antigen binding site in the variable region of an antibody molecule known as a paratope.
- a single antigen may have more than one epitope.
- different antibodies may bind to different areas on an antigen and may have different biological effects.
- Epitopes may be either conformational or linear.
- a conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain.
- a linear epitope is one produced by adjacent amino acid residues in a polypeptide chain.
- an epitope may include moieties of saccharides, phosphoryl groups, or sulfonyl groups on the antigen.
- nucleic acid or fragment thereof indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleic acid (or its complementary strand), there is nucleotide sequence identity in at least about 95%, and more preferably at least about 96%, 97%, 98% or 99% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as FASTA, BLAST or Gap, as discussed below.
- a nucleic acid molecule having substantial identity to a reference nucleic acid molecule may, in certain instances, encode a polypeptide having the same or substantially similar amino acid sequence as the polypeptide encoded by the reference nucleic acid molecule.
- the percent sequence identity or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well-known to those of skill in the art. See, e.g. , Pearson (1994) Methods Mol. Biol. 24: 307-331, herein incorporated by reference.
- groups of amino acids that have side chains with similar chemical properties include (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic -hydroxyl side chains: serine and threonine; (3) amide-containing side chains:
- aromatic side chains phenylalanine, tyrosine, and tryptophan
- basic side chains lysine, arginine, and histidine
- acidic side chains aspartate and glutamate
- sulfur-containing side chains are cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine- tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine.
- a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443-1445, herein incorporated by reference.
- a “moderately conservative” replacement is any change having a nonnegative value in the PAM250 log-likelihood matrix.
- Sequence similarity for polypeptides is typically measured using sequence analysis software. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions.
- GCG software contains programs such as Gap and Bestfit which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild type protein and a mutein thereof. See, e.g. , GCG Version 6.1. Polypeptide sequences also can be compared using FASTA using default or recommended parameters, a program in GCG Version 6.1.
- FASTA e.g., FASTA2 and FASTA3
- FASTA2 and FASTA3 provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (Pearson (2000) supra).
- Another preferred algorithm when comparing a sequence to a database containing a large number of sequences from different organisms is the computer program BLAST, especially BLASTP or TBLASTN, using default parameters. See, e.g. , Altschul et al. (1990) J. Mol. Biol. 215:403-410 and Altschul et al. (1997) Nucleic Acids Res. 25:3389-402, each herein incorporated by reference.
- an anti-PRLR antibody as described herein may exhibit reduced binding to PRLR at acidic pH as compared to neutral pH.
- anti-PRLR antibodies may exhibit enhanced binding to PRLR at acidic pH as compared to neutral pH.
- the expression "acidic pH” includes pH values less than about 6.2, e.g. , about 6.0, 5.95, 5,9, 5.85, 5.8, 5.75, 5.7, 5.65, 5.6, 5.55, 5.5, 5.45, 5.4, 5.35, 5.3, 5.25, 5.2, 5.15, 5.1, 5.05, 5.0, or less.
- neutral pH means a pH of about 7.0 to about 7.4.
- the expression “neutral pH” includes pH values of about 7.0, 7.05, 7.1, 7.15, 7.2, 7.25, 7.3, 7.35, and 7.4.
- "reduced binding to PRLR at acidic pH as compared to neutral pH” is expressed in terms of a ratio of the KD value of the antibody binding to PRLR at acidic pH to the KD value of the antibody binding to PRLR at neutral pH (or vice versa).
- an antibody or antigen-binding fragment thereof may be regarded as exhibiting "reduced binding to PRLR at acidic pH as compared to neutral pH" for purposes of the present disclosure if the antibody or antigen-binding fragment thereof exhibits an
- the acidic/neutral KD ratio for an antibody or antigen-binding fragment of the present disclosure can be about 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5, 12.0, 12.5, 13.0, 13.5, 14.0, 14.5, 15.0, 20.0. 25.0, 30.0, 40.0, 50.0, 60.0, 70.0, 100.0 or greater.
- Antibodies with pH-dependent binding characteristics may be obtained, e.g. , by screening a population of antibodies for reduced (or enhanced) binding to a particular antigen at acidic pH as compared to neutral pH. Additionally, modifications of the antigen- binding domain at the amino acid level may yield antibodies with pH-dependent
- an antibody with reduced antigen- binding at acidic pH relative to neutral pH may be obtained.
- a modification at position 250 e.g., E or Q
- 250 and 428 e.g., L or F
- 252 e.g., L/Y/F/W or T
- 254 e.g., S or T
- 256 e.g., S/R/Q/E/D or T
- a modification at position 428 and/or 433 e.g., H/L/R/S/P/Q or K
- 434 e.g., H/F or Y
- a modification at position 250 and/or 428 or a modification at position 307 or 308 (e.g., 308F, V308F), and 434.
- the modification comprises a 428L (e.g., M428L) and 434S (e.g., N434S) modification; a 428L, 2591 (e.g., V259I), and 308F (e.g., V308F) modification; a 433K (e.g., H433K) and a 434 (e.g., 434Y) modification; a 252, 254, and 256 (e.g., 252Y, 254T, and 256E) modification; a 250Q and 428L modification (e.g., T250Q and M428L); and a 307 and/or 308 modification (e.g., 308F or 308P).
- a 428L e.g., M428L
- 434S e.g., N434S
- 428L, 2591 e.g., V259I
- 308F e.g., V308F
- 433K
- the antibodies useful herein include anti-PRLR antibodies comprising an Fc domain comprising one or more pairs or groups of mutations selected from the group consisting of: 250Q and 248L (e.g. , T250Q and M248L); 252Y, 254T and 256E (e.g. , M252Y, S254T and T256E); 428L and 434S (e.g. , M428L and N434S); and 433K and 434F (e.g. , H433K and N434F). All possible combinations of the foregoing Fc domain mutations, and other mutations within the antibody variable domains disclosed herein, are contemplated within the scope of the present disclosure.
- ADCs comprising antibodies and antigen-binding fragments thereof that bind monomeric human PRLR with high affinity.
- these antibodies include anti-PRLR antibodies that bind monomeric human PRLR (e.g. , hPRLR.mmh) with a KD of less than about 4.0 nM as measured by surface plasmon resonance at 25°C or 37°C, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- antibodies and antigen-binding fragments thereof that bind monomeric human PRLR (e.g. , hPRLR.mmh) with a dissociative half-life (t1 ⁇ 2) of greater than about 5 minutes as measured by surface plasmon resonance at 25°C or 37°C, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- monomeric human PRLR e.g. , hPRLR.mmh
- t1 ⁇ 2 dissociative half-life
- anti-PRLR antibodies are provided that bind monomeric human PRLR at 37°C with a t1 ⁇ 2 of greater than about 5 minutes, greater than about 6 minutes, greater than about 8 minutes, greater than about 10 minutes, greater than about 12 minutes, greater than about 14 minutes, greater than about 16 minutes, greater than about 18 minutes, greater than about 20 minutes, greater than about 30 minutes, greater than about 40 minutes, or longer, as measured by surface plasmon resonance, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- dimeric human PRLR e.g. , hPRLR.mFc
- anti- PRLR antibodies can bind dimeric human PRLR with a KD of less than about 250 pM as measured by surface plasmon resonance at 25°C or 37°C, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- anti-PRLR antibodies that bind dimeric human PRLR at 37°C with a KD of less than about 250 pM, less than about 200 pM, less than about 180 pM, less than about 160 pM, less than about 140 pM, less than about 120 pM, less than about 100 pM, less than about 80 pM, less than about 70 pM, or less than about 60 pM, as measured by surface plasmon resonance, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- Also useful herein are antibodies and antigen-binding fragments thereof that bind dimeric human PRLR (e.g. , hPRLR.mFc) with a dissociative half-life (t1 ⁇ 2) of greater than about 55 minutes as measured by surface plasmon resonance at 25°C or 37°C, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- dimeric human PRLR e.g. , hPRLR.mFc
- t1 ⁇ 2 dissociative half-life
- anti-PRLR antibodies that bind dimeric human PRLR at 37°C with a t1 ⁇ 2 of greater than about 55 minutes, greater than about 60 minutes, greater than about 65 minutes, greater than about 70 minutes, greater than about 75 minutes, greater than about 80 minutes, greater than about 85 minutes, greater than about 90 minutes, greater than about 95 minutes, greater than about 100 minutes, greater than about 120 minutes, greater than about 140 minutes, greater than about 160 minutes, or longer, as measured by surface plasmon resonance, e.g. , using an assay format as defined in Example 3 herein, or a substantially similar assay.
- antibodies and antigen-binding fragments thereof that bind PRLR and block prolactin-mediated signaling in cells expressing human PRLR.
- such antibodies include anti-PRLR antibodies that block prolactin-mediated signaling in cells that express human PRLR, with an IC 50 of less than about 1.3 nM as measured using a prolactin signaling blocking assay, e.g. , using an assay format as defined in Example 5 herein, or a substantially similar assay.
- antibodies and antigen-binding fragments thereof that bind PRLR but do not block prolactin-mediated signaling in cells expressing human PRLR.
- an antibody or antigen-binding fragment thereof "does not block" prolactin- mediated signaling if, when tested in a prolactin signaling blocking assay such as the assay defined in Example 5 herein or a substantially similar assay, the antibody exhibits no or only negligible blocking activity.
- an antibody or antigen- binding fragment "does not block" prolactin-mediated signaling if the antibody exhibits an IC 50 value of greater than about 10 nM, or greater than about 100 nM when tested in a prolactin signaling blocking assay such as the assay defined in Example 5 herein or a substantially similar assay.
- the antibodies useful herein may possess one or more of the aforementioned biological characteristics, or any combination thereof.
- the foregoing list of biological characteristics of the antibodies of the disclosure is not intended to be exhaustive.
- Other biological characteristics of the antibodies of the present disclosure will be evident to a person of ordinary skill in the art from a review of the present disclosure including the working Examples herein.
- ADCs Antibody-Drug Conjugates
- ADCs comprising an anti-PRLR antibody or antigen-binding fragment thereof conjugated to a therapeutic moiety such as a cytotoxic agent, a chemotherapeutic drug, or a radioisotope.
- Cytotoxic agents include any agent that is detrimental to the growth, viability or propagation of cells.
- suitable cytotoxic agents and chemotherapeutic agents that can be conjugated to anti-PRLR antibodies in accordance with this aspect of the disclosure include, e.g.
- l-(2chloroethyl)-l,2-dimethanesulfonyl hydrazide 1,8-dihydroxy- bicyclo[7.3.1]trideca-4,9-diene-2,6-diyne-13-one, 1-dehydrotestosterone, 5-fluorouracil, 6- mercaptopurine, 6-thioguanine, 9-amino camptothecin, actinomycin D, amanitins, aminopterin, anguidine, anthracycline, anthramycin (AMC), auristatins, bleomycin, busulfan, butyric acid, calicheamicins, camptothecin, carminomycins, carmustine, cemadotins, cisplatin, colchicin, combretastatins, cyclophosphamide, cytarabine, cytochalasin B, dactinomycin, da
- cytotoxic agents include a tomaymycin derivative or a dolastatin derivative.
- the cytotoxic agent that is conjugated to an anti-PRLR antibody is an auristatin such as MMAE, MMAF, or derivatives thereof.
- auristatin such as MMAE, MMAF, or derivatives thereof.
- Other cytotoxic agents known in the art are contemplated within the scope of the present disclosure, including, e.g. , protein toxins such ricin, C.
- Maytansinoids are analogs of maytansine, a potent microtubule targeted compound that induces mitotic arrest.
- Suitable maytansinoids for the conjugates described herein include, but are not limited to DM1 and DM4.
- Suitable maytansinoids also include, but are not limited to, thos
- A is arylene or heteroarylene.
- Suitable maytansinoids also include, but are not limited to, those having the structure of Formula (II):
- pi, p2 and p3 are each independently 0, or an integer from 1 to 100;
- x 0, 1 or 2;
- R5, R 6 and Rg are each independently H, or a substituted or unsubstituted: alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl; and
- alkyl is a substituted or unsubstituted: alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl.
- Suitable maytansinoids include those provided in WO 2014/145090, WO 2016/160615, and WO 2015/031396, incorporated by reference herein in their entireties.
- the ADC useful in the methods provided herein comprises the formula M-[L-D]n, wherein M is an antibody or antigen-binding fragment thereof that binds to human prolactin receptor (PRLR), L is a linker, D is a cytotoxic agent, and n is an integer from 1 to 20.
- L is 4-(N- maleimidomethyl)cyclohexane-l-carboxylate (MCC), and D is DM1
- MPC 4-(N- maleimidomethyl)cyclohexane-l-carboxylate
- n is an integer from 2 to 5. In certain embodiments, n is 3 or 4.
- ARCs antibody-radionuclide conjugates
- ARCs comprising anti-PRLR antibodies conjugated to one or more radionuclides, for example, the chelating moiety.
- radionuclides that can be used in the context of this aspect of the disclosure include, but are not limited to, e.g. , 225 Ac, 212 Bi, 213 Bi, 131 I, 186 Re, 227 Th, 222 Rn,
- ADCs useful herein comprise an anti-PRLR conjugated to a cytotoxic agent (e.g. , any of the cytotoxic agents disclosed above) via a linker molecule.
- a linker refers to any divalent group or moiety that links, connects, or bonds an antibody, or an antigen-binding fragment thereof, with a payload compound set forth herein (e.g., cytotoxic agent).
- suitable linkers for the antibody conjugates described herein are those that are sufficiently stable to exploit the circulating half-life of the antibody and, at the same time, capable of releasing its payload after antigen- mediated internalization of the conjugate. Linkers can be cleavable or non-cleavable.
- Cleavable linkers are linkers that are cleaved by intracellular metabolism following internalization, e.g., cleavage via hydrolysis, reduction, or enzymatic reaction.
- Non-cleavable linkers are linkers that release an attached payload via lysosomal degradation of the antibody following internalization.
- Suitable linkers include, but are not limited to, acid-labile linkers, hydrolysis- labile linkers, enzymatically cleavable linkers, cathepsin cleavable linkers, reduction labile linkers, self-immolative linkers, and ⁇ -gluconuride linkers.
- Suitable linkers also include, but are not limited to, those that are or comprise glucuronides, succinimide-thioethers, polyethylene glycol (PEG) units, hydrazones, mal-caproyl (mc) units, disulfide units (e.g., - S-S-, -S-QR R 2 ) -, wherein R 1 and R 2 are independently hydrogen or hydrocarbyl), carbamate units, para-amino-benzyl units (PAB; e.g., derived from p-amino benzyl alcohol), phosphate units, e.g., mono-, bis-, or tris- phosphate units, and peptide units, e.g., peptide units containing two, three four, five, six, seven, eight, or more amino acids, including but not limited to Val-Cit and Phe-Lys units.
- Suitable linkers also include MCC (4-[- maleimidomethyl] cyclohexan
- Linkers can be bonded to the antibody or antigen-binding fragment thereof through any suitable amino acid of the antibody or antigen-binding fragment.
- amino acids include, but are not limited to lysine, cysteine, selenocysteine, non-natural amino acids, and acidic amino acids.
- Linkers can also be conjugated to glutamine via transglutaminase- based chemo-enzymatic conjugation (see, e.g., Dennler et al., Bioconjugate Chem. 2014, 25, 569-578).
- Linkers can be coupled to cysteine residues, for example, by reacting the antibody with a linker containing a suitable reactive moiety, e.g., a maleimido group.
- Linkers can be coupled to lysine residues, for example, by reacting the antibody with a linker containing an activated ester or acid halide group.
- Antibodies can also be conjugated via click chemistry reaction.
- the linker comprises a reactive group, e.g., alkyne that is capable of undergoing a 1,3 cycloaddition reaction with an azide.
- suitable reactive groups include, but are not limited to, strained alkynes, e.g., those suitable for strain- promoted alkyne-azide cycloadditions (SPAAC), cycloalkynes, e.g., cyclooctynes, benzannulated alkynes, and alkynes capable of undergoing 1,3 cycloaddition reactions with azides in the absence of copper catalysts.
- Suitable alkynes also include, but are not limited to, DIBAC, DIBO, BARAC, DIFO, substituted, e.g., fluorinated alkynes, aza-cycloalkynes, BCN, and derivatives thereof.
- Linkers comprising such reactive groups are useful for conjugating antibodies that have been functionalized with azido groups.
- Such functionalized antibodies include antibodies functionalized with azido-poly ethylene glycol groups.
- such functionalized antibody is derived by reacting an antibody comprising at least one glutamine residue, e.g., heavy chain Q295, with a compound according to the formula H2N-LL-N3, wherein LL is a divalent polyethylene glycol group, in the presence of the enzyme transglutaminase.
- any method known in the art for conjugating a chemical moiety to a peptide, polypeptide or other macromolecule can be used in the context of the present disclosure to make an anti-PRLR ADC as described herein.
- An exemplary method for antibody-drug conjugation via a linker is set forth in Example 6 herein. Variations on this exemplary method will be appreciated by persons of ordinary skill in the art and are contemplated within the scope of the present disclosure.
- cell killing in the sub-nanomolar IC 50 range was obtained with an anti-ErbB2-DMl ADC only with cells that express ErbB2 at levels of greater than about 200X to about 400X above background (see, e.g. , Tables 14-17 herein).
- the ability to kill tumor cells that express relatively low levels of tumor-associated antigen such as PRLR means that the anti-PRLR ADCs of the present disclosure can provide significant therapeutic benefits with a lower dose and/or less frequent dosing than is required for ADCs that target other tumor antigens such as ErbB2.
- the present disclosure provides antibody-drug conjugates (ADCs) comprising an antibody or antigen-binding fragment thereof that specifically binds human PRLR conjugated to a cytotoxic agent, wherein the ADCs effectively kill cells (e.g. , tumor cells) that express low levels of PRLR.
- ADCs effectively kill cells that express low levels of PRLR.
- the methods according to this aspect of the disclosure comprise (1) contacting the cells with an antibody- drug conjugate (ADC) comprising an anti-PRLR antibody conjugated to a cytotoxic agent and (2) contacting the cells with fulvestrant.
- ADC antibody- drug conjugate
- Contacting the cells can be carried out in vitro, or in vivo, e.g. , by administering an anti-PRLR ADC to a subject in need thereof, wherein the administration causes the ADC and fulvestrant to come into contact with cells expressing PRLR.
- a "low level of PRLR” means an expression level of less than about 30-fold above background.
- anti-PRLR ADCs are provided which effectively kill cells that express PRLR at an expression level of less than about 30-fold, 25- fold, 20-fold, 18-fold, 16-fold, 14-fold, 12-fold, 10-fold, 8-fold, or less, above background.
- background means the (non-specific) signal produced when cells are treated with an isotype control antibody (i.e. , not specific for PRLR).
- a "low level of PRLR” can be expressed in terms of the number of PRLR molecules per cell.
- a cell that expresses a "low level" of PRLR expresses less than about 1 million copies of PRLR per cell.
- a "low level" of PRLR means less than about 900,000 copies, less than about 800,000 copies, less than about 700,000 copies, less than about 600,000 copies, less than about 500,000 copies, less than about 400,000 copies, less than about 300,000 copies, less than about 200,000 copies, less than about 100,000 copies, less than about 90,000 copies, less than about 80,000 copies, less than about 70,000 copies, less than about 60,000 copies, less than about 50,000 copies, less than about 40,000 copies, less than about 30,000 copies, less than about 20,000 copies, less than about 10,000 copies of PRLR per cell, less than about 5,000 copies of PRLR per cell, less than about 3,000 copies of PRLR per cell, or less than about 1,000 copies of PRLR per cell.
- anti-PRLR ADCs of the present disclosure were shown to effectively kill MCF7 cells, which only express approximately 3000 copies of PRLR per cell.
- IC5 0 means that the ADC exhibits an IC5 0 of less than about 20 nM, or less than about 1 nM (e.g. , less than about 0.9 nM, less than about 0.8 nM, less than about 0.7 nM, less than about 0.6 nM, less than about 0.5 nM, less than about 0.4 nM, or less than about 0.3 nM) in a tumor cell killing assay, such as the assay defined in Example 7 herein, or a substantially similar assay.
- a tumor cell killing assay such as the assay defined in Example 7 herein, or a substantially similar assay.
- the anti-PRLR antibody component of the ADC can be any anti-PRLR antibody including anti-PRLR antibodies comprising any of the CDR or HCVR/LCVR amino acid sequences as set forth in Table 1 herein.
- the cytotoxic agent component of the ADC can be any cytotoxic agent, such as DM1, or any other cytotoxic agent mentioned herein.
- ADCs useful in the methods of the present disclosure are able to inhibit tumor growth and/or reduce tumor size in PRLR+ tumor-bearing animals.
- anti-PRLR- DM1 ADCs were shown to reduce tumors to undetectable levels in mice bearing PRLR+ breast cancer xenografts.
- methods of using anti-PRLR antibodies and ADCs comprising such antibodies wherein the antibodies or ADCs, when administered in combination with fulvestrant to a PRLR+ tumor-bearing animal (e.g. , at a frequency of about once a week, and a dose of about 1 to 15 mg/kg), inhibit tumor growth and/or reduce tumor size (e.g. , tumor growth inhibition of 100% or greater) by Day 52 post-administration or sooner.
- PRLR belongs to the class I cytokine receptor family.
- ADCs antibody- drug conjugates
- IL-4R and IL-6R also are able to potently kill cell lines expressing relatively low levels of target antigen (see Example 9 herein). This property is in contrast to ADCs against other cell surface-expressed proteins, such as ErbB2, wherein effective cell killing requires high target expression.
- anti-PRLR antibodies are internalized substantially faster than anti-Her2 antibodies on tumor cells (e.g. , T47D tumor cells), and that this property is correlated with faster internalization and degradation of cell surface PRLR compared to cell surface Her2.
- the present inventors conceived that the ability to target and kill cells that express low levels of cell surface antigen may be a common property shared by ADCs directed against class I cytokine receptors in general, and in particular class I cytokine receptors that are rapidly internalized.
- the present disclosure includes methods for targeting class I cytokine receptors (e.g. , rapidly internalizing class I cytokine receptors), and methods for killing cells that express class I cytokine receptors such as cells that express low levels of class I cytokine receptors.
- the methods according to this aspect of the disclosure comprise contacting a cell that expresses a class I cytokine receptor with an ADC comprising an antibody or antigen-binding fragment thereof that specifically binds the class I cytokine receptor.
- the cell to be targeted expresses low levels (as that expression is defined elsewhere herein) of a class I cytokine receptor and/or a class I cytokine receptor that is rapidly internalized and degraded (e.g. , internalized faster than a reference cell surface molecule such as Her2).
- ADCs comprising an antibody or antigen-binding fragment thereof that specifically binds a class I cytokine receptor, conjugated to a cytotoxic agent. Any of the cytotoxic agents, linkers, and/or ADC-related technologies described elsewhere herein can be used in the context of this aspect of the disclosure.
- class I cytokine receptor (also sometimes referred to as a "type I cytokine receptor”) means a transmembrane receptor expressed on the surface of cells that recognizes and responds to cytokines with four alpha-helical strands. As explained below, class I cytokine receptors can be heterodimeric or homodimeric. As used herein, the term “class I cytokine receptor” includes both heterodimeric and homodimeric receptors.
- Heterodimeric class I cytokine receptors consist of a cytokine-specific chain and a "common chain.” Accordingly, such heterodimeric class I cytokine receptors can be classified based on the type of common chain used by the receptor for signaling.
- heterodimeric class I cytokine receptors include: (i) common gamma chain- containing heterodimeric receptors such as IL-2R, IL-4R, IL-7R, IL-9R, IL-13R and IL-15R; (ii) common beta chain-containing heterodimeric receptors such as GM-CSF receptor, IL-3R and IL-5R; and (iii) gpl30-containing heterodimeric receptors such as IL-6R, IL-l lR, CNTF receptor, leukemia inhibitory factor (LIF) receptor, oncostatin M (OSM) receptor, and IL-12 receptor.
- LIF leukemia inhibitory factor
- OSM oncostatin M
- Homodimeric class I cytokine receptors include growth hormone (GH) receptor, erythropoietin (EPO) receptor, G-CSF receptor, leptin receptor, and PRLR.
- the ADC comprises an antibody or antigen-binding fragment thereof that specifically binds a heterodimeric class I cytokine receptor. According to other embodiments of this aspect of the disclosure, the ADC comprises an antibody or antigen-binding fragment thereof that specifically binds a homodimeric class I cytokine receptor.
- the present disclosure includes methods for killing a cell that expresses low levels of a heterodimeric class I cytokine receptor.
- the methods according to this aspect of the disclosure comprise contacting a cell that expresses a low level of a heterodimeric class I cytokine receptor with an ADC comprising an antibody or antigen-binding fragment thereof that specifically binds the heterodimeric class I cytokine receptor.
- the epitope to which the antibodies of the present disclosure bind may consist of a single contiguous sequence of 3 or more (e.g. , 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) amino acids of a PRLR protein.
- the epitope may consist of a plurality of non-contiguous amino acids (or amino acid sequences) of PRLR.
- the epitope is located on or near the prolactin-binding domain of PRLR.
- the epitope is located outside of the prolactin-binding domain of PRLR, e.g. , at a location on the surface of PRLR at which an antibody, when bound to such an epitope, does not interfere with prolactin binding to PRLR.
- the epitope may consist of a plurality of non-contiguous amino acids (or amino acid sequences) located within Domain 1 of PRLR.
- the epitope of PRLR with which the exemplary antibody of the disclosure HIH6958N2 interacts is defined by the amino acid sequence MHECPDYITGGPNSCHFGKQYTSMWRTYIMM (SEQ ID NO:405), which corresponds to amino acids 72-102 of SEQ ID NO:404.
- the present disclosure includes anti-PRLR antibodies that interact with one or more amino acids contained within the Domain 1 amino acid segment consisting of amino acids 72-102 of SEQ ID NO:404 (i.e., the sequence
- the hydrogen/deuterium exchange method involves deuterium-labeling the protein of interest, followed by binding the antibody to the deuterium-labeled protein. Next, the protein/antibody complex is transferred to water to allow hydrogen-deuterium exchange to occur at all residues except for the residues protected by the antibody (which remain deuterium-labeled).
- the target protein After dissociation of the antibody, the target protein is subjected to protease cleavage and mass spectrometry analysis, thereby revealing the deuterium-labeled residues which correspond to the specific amino acids with which the antibody interacts. See, e.g. , Ehring (1999) Analytical Biochemistry 267(2):252- 259; Engen and Smith (2001) Anal. Chem. Z?:256A-265A.
- anti-PRLR antibodies that bind to the same epitope as any of the specific exemplary antibodies described herein (e.g. antibodies comprising any of the amino acid sequences as set forth in Table 1 herein).
- anti-PRLR antibodies that compete for binding to PRLR with any of the specific exemplary antibodies described herein are also provided (e.g. antibodies comprising any of the amino acid sequences as set forth in Table 1 herein).
- test antibody may bind to the same epitope as the epitope bound by the reference anti-PRLR antibody of the disclosure. Additional routine experimentation (e.g. , peptide mutation and binding analyses) can then be carried out to confirm whether the observed lack of binding of the test antibody is in fact due to binding to the same epitope as the reference antibody or if steric blocking (or another phenomenon) is responsible for the lack of observed binding. Experiments of this sort can be performed using ELISA, RIA, Biacore, flow cytometry or any other quantitative or qualitative antibody- binding assay available in the art.
- two antibodies bind to the same (or overlapping) epitope if, e.g. , a 1-, 5-, 10-, 20- or 100-fold excess of one antibody inhibits binding of the other by at least 50% but preferably 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et al., Cancer Res. 1990:50: 1495-1502).
- two antibodies are deemed to bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Two antibodies are deemed to have "overlapping epitopes" if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- the above-described binding methodology is performed in two orientations: In a first orientation, the reference antibody is allowed to bind to a PRLR protein under saturating conditions followed by assessment of binding of the test antibody to the PRLR molecule. In a second orientation, the test antibody is allowed to bind to a PRLR molecule under saturating conditions followed by assessment of binding of the reference antibody to the PRLR molecule. If, in both orientations, only the first (saturating) antibody is capable of binding to the PRLR molecule, then it is concluded that the test antibody and the reference antibody compete for binding to PRLR.
- an antibody that competes for binding with a reference antibody may not necessarily bind to the same epitope as the reference antibody, but may sterically block binding of the reference antibody by binding an overlapping or adjacent epitope.
- the anti-PRLR antibodies of the present disclosure can be fully human antibodies.
- Methods for generating monoclonal antibodies, including fully human monoclonal antibodies are known in the art. Any such known methods can be used in the context of the present disclosure to make human antibodies that specifically bind to human PRLR.
- VELOCIMMUNETM technology for example, or any other similar known method for generating fully human monoclonal antibodies, high affinity chimeric antibodies to PRLR are initially isolated having a human variable region and a mouse constant region. As in the experimental section below, the antibodies are characterized and selected for desirable characteristics, including affinity, ligand blocking activity, selectivity, epitope, etc.
- mouse constant regions are replaced with a desired human constant region, for example wild-type or modified IgGl or IgG4, to generate a fully human anti- PRLR antibody. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region. In certain instances, fully human anti-PRLR antibodies are isolated directly from antigen- positive B cells.
- the anti-PRLR antibodies and antibody fragments described herein encompass proteins having amino acid sequences that vary from those of the described antibodies but that retain the ability to bind human PRLR. Such variant antibodies and antibody fragments comprise one or more additions, deletions, or substitutions of amino acids when compared to parent sequence, but exhibit biological activity that is essentially equivalent to that of the described antibodies.
- the anti-PRLR antibody-encoding DNA sequences of the present disclosure encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to the disclosed sequence, but that encode an anti-PRLR antibody or antibody fragment that is essentially bioequivalent to an anti-PRLR antibody or antibody fragment of the disclosure. Examples of such variant amino acid and DNA sequences are discussed above.
- Two antigen-binding proteins, or antibodies are considered bioequivalent if, for example, they are pharmaceutical equivalents or pharmaceutical alternatives whose rate and extent of absorption do not show a significant difference when administered at the same molar dose under similar experimental conditions, either single does or multiple dose.
- Some antibodies will be considered equivalents or pharmaceutical alternatives if they are equivalent in the extent of their absorption but not in their rate of absorption and yet may be considered bioequivalent because such differences in the rate of absorption are intentional and are reflected in the labeling, are not essential to the attainment of effective body drug
- two antigen-binding proteins are bioequivalent if there are no clinically meaningful differences in their safety, purity, and potency.
- two antigen-binding proteins are bioequivalent if a patient can be switched one or more times between the reference product and the biological product without an expected increase in the risk of adverse effects, including a clinically significant change in immunogenicity, or diminished effectiveness, as compared to continued therapy without such switching.
- two antigen-binding proteins are bioequivalent if they both act by a common mechanism or mechanisms of action for the condition or conditions of use, to the extent that such mechanisms are known.
- Bioequivalence may be demonstrated by in vivo and in vitro methods.
- Bioequivalence measures include, e.g., (a) an in vivo test in humans or other mammals, in which the concentration of the antibody or its metabolites is measured in blood, plasma, serum, or other biological fluid as a function of time; (b) an in vitro test that has been correlated with and is reasonably predictive of human in vivo bioavailability data; (c) an in vivo test in humans or other mammals in which the appropriate acute pharmacological effect of the antibody (or its target) is measured as a function of time; and (d) in a well-controlled clinical trial that establishes safety, efficacy, or bioavailability or bioequivalence of an antibody.
- Bioequivalent variants of anti-PRLR antibodies of the disclosure may be constructed by, for example, making various substitutions of residues or sequences or deleting terminal or internal residues or sequences not needed for biological activity.
- cysteine residues not essential for biological activity can be deleted or replaced with other amino acids to prevent formation of unnecessary or incorrect intramolecular disulfide bridges upon renaturation.
- bioequivalent antibodies may include anti- PRLR antibody variants comprising amino acid changes which modify the glycosylation characteristics of the antibodies, e.g. , mutations which eliminate or remove glycosylation. Species Selectivity and Species Cross-Reactivity
- Methods provided herein utilize anti- PRLR antibodies that bind to human PRLR but not to PRLR from other species.
- the present disclosure also includes anti-PRLR antibodies that bind to human PRLR and to PRLR from one or more non-human species.
- the anti-PRLR antibodies of the disclosure may bind to human PRLR and may bind or not bind, as the case may be, to one or more of mouse, rat, guinea pig, hamster, gerbil, pig, cat, dog, rabbit, goat, sheep, cow, horse, camel, cynomologous, marmoset, rhesus or chimpanzee PRLR.
- anti-PRLR antibodies are provided which specifically bind human PRLR and cynomolgus monkey (e.g. , Macaca fascicularis) PRLR.
- Other anti- PRLR antibodies of the disclosure bind human PRLR but do not bind, or bind only weakly, to cynomolgus monkey PRLR.
- the antibodies useful in the methods of the present disclosure may be monospecific or multispecific (e.g. , bispecific). Multispecific antibodies may be specific for different epitopes of one target polypeptide or may contain antigen-binding domains specific for more than one target polypeptide. See, e.g., Tutt et al., 1991, J. Immunol. 147:60-69; Kufer et al, 2004, Trends Biotechnol. 22:238-244.
- the anti-PRLR antibodies of the present disclosure can be linked to or co-expressed with another functional molecule, e.g., another peptide or protein.
- an antibody or fragment thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody or antibody fragment to produce a bispecific or a multispecific antibody with a second binding specificity.
- bispecific antibodies wherein one arm of an immunoglobulin binds human PRLR, and the other arm of the immunoglobulin is specific for a second antigen.
- the PRLR-binding arm can comprise any of the HCVR/LCVR or CDR amino acid sequences as set forth in Table 1 herein.
- the PRLR- binding arm binds human PRLR and blocks prolactin binding to PRLR.
- the PRLR-binding arm binds human PRLR but does not block prolactin binding to PRLR.
- An exemplary bispecific antibody format that can be used in the context of the present disclosure involves the use of a first immunoglobulin (Ig) CH3 domain and a second Ig CH3 domain, wherein the first and second Ig CH3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the bispecific antibody to Protein A as compared to a bi-specific antibody lacking the amino acid difference.
- the first Ig CH3 domain binds Protein A and the second Ig CH3 domain contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering).
- the second CH3 may further comprise a Y96F modification (by IMGT; Y436F by EU).
- Further modifications that may be found within the second C H 3 include: D16E, L18M, N44S, K52N, V57M, and V82I (by IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU) in the case of IgGl antibodies; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU) in the case of IgG2 antibodies; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (by IMGT;
- bispecific formats that can be used in the context of the present disclosure include, without limitation, e.g. , scFv-based or diabody bispecific formats, IgG-scFv fusions, dual variable domain (DVD)-Ig, Quadroma, knobs-into-holes, common light chain (e.g. , common light chain with knobs-into-holes, etc.), CrossMab, CrossFab, (SEED)body, leucine zipper, Duobody, IgGl/IgG2, dual acting Fab (DAF)-IgG, and Mab 2 bispecific formats (see, e.g. , Klein et al.
- Bispecific antibodies can also be constructed using peptide/nucleic acid conjugation, e.g. , wherein unnatural amino acids with orthogonal chemical reactivity are used to generate site-specific antibody-oligonucleotide conjugates which then self-assemble into multimeric complexes with defined composition, valency and geometry. (See, e.g. , Kazane et al., J. Am. Chem. Soc. [Epub: Dec. 4, 2012]).
- the dose of antibody administered to a patient may vary depending upon the age and the size of the patient, target disease, conditions, route of administration, and the like.
- the preferred dose is typically calculated according to body weight or body surface area.
- it may be advantageous to intravenously administer the antibody of the present disclosure normally at a single dose of about 0.01 to about 20 mg/kg body weight, more preferably about 0.02 to about 7, about 0.03 to about 5, or about 0.05 to about 3 mg/kg body weight.
- Effective dosages and schedules for administering anti-PRLR antibodies may be determined empirically; for example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly.
- interspecies scaling of dosages can be performed using well-known methods in the art (e.g. , Mordenti et al. , 1991, Pharmaceut. Res. ⁇ S: 1351).
- a pharmaceutical composition of the present disclosure can be delivered subcutaneously or intravenously with a standard needle and syringe.
- a pen delivery device readily has applications in delivering a pharmaceutical composition of the present disclosure.
- Such a pen delivery device can be reusable or disposable.
- a reusable pen delivery device generally utilizes a replaceable cartridge that contains a pharmaceutical composition. Once all of the pharmaceutical composition within the cartridge has been administered and the cartridge is empty, the empty cartridge can readily be discarded and replaced with a new cartridge that contains the pharmaceutical composition. The pen delivery device can then be reused.
- a disposable pen delivery device there is no replaceable cartridge. Rather, the disposable pen delivery device comes prefilled with the pharmaceutical composition held in a reservoir within the device. Once the reservoir is emptied of the pharmaceutical composition, the entire device is discarded.
- Examples include, but are not limited to AUTOPENTM (Owen Mumford, Inc., Woodstock, UK), DISETRONICTM pen (Disetronic Medical Systems, Bergdorf,
- HUMALOG MIX 75/25TM pen HUMALOGTM pen
- HUMALIN 70/30TM pen Eli Lilly and Co., Indianapolis, IN
- NOVOPENTM I, II and III Novo Nordisk, Copenhagen, Denmark
- NOVOPEN JUNIORTM Novo Nordisk, Copenhagen, Denmark
- BDTM pen Becton Dickinson, Franklin Lakes, NJ
- OPTIPENTM, OPTIPEN PROTM OPTIPEN
- STARLETTM and OPTICLIKTM (sanofi-aventis, Frankfurt, Germany), to name only a few.
- disposable pen delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present disclosure include, but are not limited to the SOLOSTARTM pen (sanofi-aventis), the FLEXPENTM (Novo Nordisk), and the KWIKPENTM (Eli Lilly), the SURECLICKTM Autoinjector (Amgen, Thousand Oaks, CA), the PENLETTM (Haselmeier, Stuttgart, Germany), the EPIPEN (Dey, L.P.), and the
- HUMIRATM Pen (Abbott Labs, Abbott Park IL), to name only a few.
- the injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, etc. These injectable preparations may be prepared by methods publicly known. For example, the injectable preparations may be prepared, e.g. , by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections.
- aqueous medium for injections there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc., which may be used in combination with an appropriate solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant [e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil)], etc.
- an alcohol e.g., ethanol
- a polyalcohol e.g., propylene glycol, polyethylene glycol
- a nonionic surfactant e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil
- oily medium there are employed, e.g., sesame oil, soybean oil, etc., which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
- a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
- the present disclosure includes methods comprising administering to a subject in need thereof a therapeutic composition comprising an antibody-drug conjugate comprising an anti-PRLR antibody (e.g. , an ADC comprising any of the HCVR/LCVR or CDR sequences as set forth in Table 1 herein) and co-administering to the same subject fulvestrant.
- a therapeutic composition comprising an antibody-drug conjugate comprising an anti-PRLR antibody (e.g. , an ADC comprising any of the HCVR/LCVR or CDR sequences as set forth in Table 1 herein) and co-administering to the same subject fulvestrant.
- the therapeutic composition can comprise any of the anti-PRLR antibodies-drug conjugates, or antigen-binding fragments thereof, or ADCs disclosed herein, and a pharmaceutically acceptable carrier or diluent.
- the ADCs useful according to the methods provided herein can be used, inter alia, for the treatment, prevention and/or amelioration of any disease or disorder associated with or mediated by PRLR expression or activity, or treatable by blocking the interaction between PRLR and prolactin or otherwise inhibiting PRLR activity and/or signaling, and/or promoting receptor internalization and/or decreasing cell surface receptor number.
- the ADCs of the present disclosure are useful for the treatment of tumors that express PRLR and/or that respond to prolactin-mediated signaling, e.g. , breast tumors.
- the ADCs provided herein may also be used to treat primary and/or metastatic tumors arising in the brain and meninges, oropharynx, lung and bronchial tree, gastrointestinal tract, male and female reproductive tract, muscle, bone, skin and appendages, connective tissue, spleen, immune system, blood forming cells and bone marrow, liver and urinary tract, and special sensory organs such as the eye.
- ADCs are used to treat one or more of the following cancers: renal cell carcinoma, pancreatic carcinoma, head and neck cancer, prostate cancer, malignant gliomas, osteosarcoma, colorectal cancer, gastric cancer (e.g.
- the cancer is a PRLR positive breast cancer.
- the anti-PRLR antibodies of the present disclosure are also useful for the treatment or prevention of one or more diseases or disorders selected from the group consisting of endometriosis, adenomyosis, non-hormonal female fertility contraception, benign breast disease and mastalgia, lactation inhibition, benign prostate hyperplasia, fibroids, hyper- and normoprolactinemic hair loss, and as part of hormone therapy to inhibit mammary epithelial cell proliferation.
- diseases or disorders selected from the group consisting of endometriosis, adenomyosis, non-hormonal female fertility contraception, benign breast disease and mastalgia, lactation inhibition, benign prostate hyperplasia, fibroids, hyper- and normoprolactinemic hair loss, and as part of hormone therapy to inhibit mammary epithelial cell proliferation.
- the present disclosure includes methods for identifying patients who are treatable with an ADC of the present disclosure by assaying for high levels of PRLR expression in one or more tissues of the patient such as a tumor tissue.
- the present disclosure includes methods for treating cancers characterized by high level expression of PRLR.
- the present disclosure includes methods of treatment comprising administering an anti-PRLR antibody of the disclosure, or ADC thereof (e.g., any of the anti-PRLR ADCs described elsewhere herein), to a subject with a tumor, wherein the tumor has been identified as expressing high levels of PRLR.
- the tumor is identified as expressing high levels of PRLR by
- immunohistochemistry of a biopsy sample or other imaging techniques such as, e.g. , immuno-PET imaging, etc.
- compositions and therapeutic formulations useful in the methods provided herein where the compositions and formulations comprise any of the anti-PRLR antibody-drug conjugates described herein in combination with one or more additional therapeutically active components, and methods of treatment comprising administering such combinations to subjects in need thereof.
- the anti-PRLR antibody-drug conjugates described herein may be co- formulated with and/or administered in combination with a therapeutically effective amount of fulvestrant. Treatment with both the anti-PRLR antibody-drug conjugate and fulvestrant is termed "co-administration”.
- the anti-PRLR antibodies of the present disclosure may be co-formulated with and/or administered in combination with one or more additional therapeutically active component(s) selected from the group consisting of: an EGFR antagonist (e.g. , an anti-EGFR antibody [e.g.
- cetuximab or panitumumab] or small molecule inhibitor of EGFR e.g., gefitinib or erlotinib]
- an antagonist of another EGFR family member such as Her2/ErbB2, ErbB3 or ErbB4 (e.g. , anti-ErbB2 [e.g. , trastuzumab or T-DMl ⁇ KADCYLA® ⁇ ], anti-ErbB3 or anti-ErbB4 antibody or small molecule inhibitor of ErbB2, ErbB3 or ErbB4 activity)
- an antagonist of EGFRvIII e.g. , an antibody that specifically binds EGFRvIII
- a cMET anagonist e.g.
- an anti-cMET antibody an IGFIR antagonist (e.g. , an anti-IGFIR antibody), a B-raf inhibitor (e.g. , vemurafenib, sorafenib, GDC-0879, PLX-4720), a PDGFR-a inhibitor (e.g. , an anti-PDGFR-a antibody), a PDGFR- ⁇ inhibitor (e.g. , an anti-PDGFR- ⁇ antibody or small molecule kinase inhibitor such as, e.g.
- a PDGF ligand inhibitor e.g., anti-PDGF-A, -B, -C, or -D antibody, aptamer, siRNA, etc.
- a VEGF antagonist e.g. , a VEGF-Trap such as aflibercept, see, e.g. , US 7,087,411 (also referred to herein as a "VEGF-inhibiting fusion protein"
- anti-VEGF antibody e.g. , bevacizumab
- a small molecule kinase inhibitor of VEGF receptor e.g.
- a DLL4 antagonist e.g. , an anti-DLL4 antibody disclosed in US 2009/0142354 such as REGN421
- an Ang2 antagonist e.g. , an anti-Ang2 antibody disclosed in US 2011/0027286 such as H1H685P
- a FOLH1 antagonist e.g. , an anti-FOLHl antibody
- a STEAP1 or STEAP2 antagonist e.g. , an anti-STEAPl antibody or an anti-STEAP2 antibody
- a DLL4 antagonist e.g. , an anti-DLL4 antibody disclosed in US 2009/0142354 such as REGN421
- an Ang2 antagonist e.g. , an anti-Ang2 antibody disclosed in US 2011/0027286 such as H1H685P
- a FOLH1 antagonist e.g. , an anti-FOLHl antibody
- a STEAP1 or STEAP2 antagonist e.g. , an anti-
- TMPRSS2 antagonist e.g. , an anti-TMPRSS2 antibody
- MSLN antagonist e.g. , an anti- MSLN antibody
- CA9 antagonist e.g. , an anti-CA9 antibody
- a uroplakin antagonist e.g. , an anti-uroplakin [e.g. , anti-UPK3A] antibody
- MUC16 antagonist e.g. , an anti-MUC16 antibody
- Tn antigen antagonist e.g. , an anti-Tn antibody
- CLEC12A antagonist e.g. , an anti- CLEC12A antibody
- TNFRSF17 antagonist e.g.
- an anti-TNFRSF17 antibody an anti-TNFRSF17 antibody
- a LGR5 antagonist e.g. , an anti-LGR5 antibody
- a monovalent CD20 antagonist e.g. , a monovalent anti-CD20 antibody such as rituximab
- agents that may be beneficially administered in combination with ADCs described herein include, e.g.
- cytokine inhibitors including small-molecule cytokine inhibitors and antibodies that bind to cytokines such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL- 8, IL-9, IL-11, IL-12, IL-13, IL-17, IL-18, or to their respective receptors.
- cytokines such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL- 8, IL-9, IL-11, IL-12, IL-13, IL-17, IL-18, or to their respective receptors.
- compositions and therapeutic formulations comprising any of the anti- PRLR antibody-drug conjugates described herein can be administered in combination (coadministered) with one or more chemo therapeutic agents.
- chemo therapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CytoxanTM); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide
- lonidamine mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSKTM; razoxane; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; urethan;
- vindesine dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxanes, e.g.
- paclitaxel TexolTM, Bristol-Myers Squibb Oncology, Princeton, N.J.
- docetaxel TaxotereTM; Aventis Antony, France
- chlorambucil gemcitabine
- 6-thioguanine mercaptopurine
- methotrexate platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP- 16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- DMFO difluor
- the anti-PRLR antibody-drug conjugates of the disclosure may also be administered and/or co-formulated in combination with antivirals, antibiotics, analgesics, corticosteroids, steroids, oxygen, antioxidants, COX inhibitors, cardioprotectants, metal chelators, IFN-gamma, and/or NSAIDs.
- the additional therapeutically active component(s), e.g., any of the agents listed above or derivatives thereof, may be administered just prior to, concurrent with, or shortly after the administration of an anti-PRLR antibody of the present disclosure; (for purposes of the present disclosure, such administration regimens are considered the administration of an anti-PRLR antibody "in combination with" an additional therapeutically active component, i.e. "co- administered”).
- the present disclosure includes pharmaceutical compositions in which an anti-PRLR antibody of the present disclosure is co-formulated with one or more of the additional therapeutically active component(s) as described elsewhere herein.
- Co-administration refers to administration of the PRLR antibody-drug conjugate in combination with fulvestrant.
- an anti-PRLR antibody-drug conjugate (or a pharmaceutical composition comprising a combination of an anti-PRLR antibody-drug) and fulvestrant may be administered to the subject at the same time, or at a different point in time, e.g. , on different days separated by a predetermined interval (e.g. , hours, days, weeks or months over a defined time course).
- the methods according to this aspect of the disclosure comprise sequentially administering to a subject one dose or multiple doses of an anti-PRLR antibody- drug conjugate of the disclosure and one dose or multiple doses of fulvestrant.
- an anti-PRLR antibody-drug conjugate can be administered prior to or after administration of fulvestrant.
- multiple doses of an anti-PRLR antibody-drug conjugate may be administered to a subject over a defined time course.
- the methods according to this aspect of the disclosure comprise sequentially administering to a subject multiple doses of an anti- PRLR antibody-drug conjugate of the disclosure and/or sequentially administering to the subject multiple doses of fulvestrant.
- sequentially administering means that each dose of anti-PRLR antibody-drug conjugate and/or fulvestrant is administered to the subject at a different point in time, e.g. , on different days separated by a predetermined interval (e.g. , hours, days, weeks or months).
- the present disclosure includes methods which comprise sequentially administering to the patient a single initial dose of an anti-PRLR antibody-drug conjugate, followed by one or more secondary doses of the anti-PRLR antibody-drug conjugate, and optionally followed by one or more tertiary doses of the anti- PRLR antibody-drug conjugate.
- the present disclosure further includes methods which comprise sequentially administering to the patient a single initial dose of fulvestrant, followed by one or more secondary doses of fulvestrant, and optionally followed by one or more tertiary doses of fulvestrant.
- the terms "initial dose,” “secondary doses,” and “tertiary doses,” refer to the temporal sequence of administration of the therapeutic agents provided herein.
- the “initial dose” is the dose which is administered at the beginning of the treatment regimen (also referred to as the “baseline dose”);
- the “secondary doses” are the doses which are administered after the initial dose;
- the “tertiary doses” are the doses which are administered after the secondary doses.
- the initial, secondary, and tertiary doses may all contain the same amount of anti-PRLR antibody-drug conjugate or same amount of fulvestrant, but generally may differ from one another in terms of frequency of
- the amount of anti-PRLR antibody-drug conjugate contained in the initial, secondary and/or tertiary doses varies from one another (e.g. , adjusted up or down as appropriate) during the course of treatment.
- two or more (e.g. , 2, 3, 4, or 5) doses are administered at the beginning of the treatment regimen as "loading doses" followed by subsequent doses that are administered on a less frequent basis (e.g. , "maintenance doses").
- each secondary and/or tertiary dose is administered 1 to 26 (e.g. , 1 , 11 ⁇ 2, 2, 21 ⁇ 2, 3, 31 ⁇ 2, 4, 41 ⁇ 2, 5, 51 ⁇ 2, 6, 61 ⁇ 2, 7, 71 ⁇ 2, 8, 81 ⁇ 2, 9, 91 ⁇ 2, 10, 101 ⁇ 2, 11, 111 ⁇ 2, 12, 121 ⁇ 2, 13, 131 ⁇ 2, 14, 141 ⁇ 2, 15, 151 ⁇ 2, 16, 161 ⁇ 2, 17, 171 ⁇ 2, 18, 181 ⁇ 2, 19, 191 ⁇ 2, 20, 201 ⁇ 2, 21 , 211 ⁇ 2, 22, 221 ⁇ 2, 23, 231 ⁇ 2, 24, 241 ⁇ 2, 25, 251 ⁇ 2, 26, 261 ⁇ 2, or more) weeks after the immediately preceding dose.
- 1 to 26 e.g. , 1 , 11 ⁇ 2, 2, 21 ⁇ 2, 3, 31 ⁇ 2, 4, 41 ⁇ 2, 5, 51 ⁇ 2, 6, 61 ⁇ 2, 7, 71 ⁇ 2, 8, 81 ⁇ 2, 9, 91 ⁇ 2, 10, 101 ⁇ 2, 11, 111 ⁇ 2, 12, 121 ⁇ 2, 13, 131 ⁇ 2, 14, 141 ⁇ 2, 15, 151 ⁇ 2, 16, 161 ⁇ 2, 17, 171 ⁇
- the immediately preceding dose means, in a sequence of multiple administrations, the dose of anti-PRLR antibody-drug conjugate, or fulvestrant, which is administered to a patient prior to the administration of the very next dose in the sequence with no intervening doses.
- the methods according to this aspect of the disclosure may comprise administering to a patient any number of secondary and/or tertiary doses of an anti-PRLR antibody-drug conjugate or fulvestrant.
- only a single secondary dose is administered to the patient.
- two or more (e.g. , 2, 3, 4, 5, 6, 7, 8, or more) secondary doses are administered to the patient.
- only a single tertiary dose is administered to the patient.
- a single tertiary dose is administered to the patient.
- two or more (e.g. , 2, 3, 4, 5, 6, 7, 8, or more) tertiary doses are administered to the patient.
- the administration regimen may be carried out indefinitely over the lifetime of a particular subject, or until such treatment is no longer therapeutically needed or
- each secondary dose may be administered at the same frequency as the other secondary doses. For example, each secondary dose may be administered to the patient 1 to 2 weeks or 1 to 2 months after the immediately preceding dose. Similarly, in embodiments involving multiple tertiary doses, each tertiary dose may be administered at the same frequency as the other tertiary doses. For example, each tertiary dose may be administered to the patient 2 to 12 weeks after the immediately preceding dose.
- the frequency at which the secondary and/or tertiary doses are administered to a patient can vary over the course of the treatment regimen. The frequency of administration may also be adjusted during the course of treatment by a physician depending on the needs of the individual patient following clinical examination.
- the present disclosure includes administration regimens in which 2 to 6 loading doses are administered to a patient at a first frequency (e.g. , once a week, once every two weeks, once every three weeks, once a month, once every two months, etc.), followed by administration of two or more maintenance doses to the patient on a less frequent basis.
- a first frequency e.g. , once a week, once every two weeks, once every three weeks, once a month, once every two months, etc.
- the maintenance doses may be administered to the patient once every six weeks, once every two months, once every three months, etc.
- Anti-PRLR antibodies were obtained by immunizing a VELOCIMMUNE ® mouse (i. e. , an engineered mouse comprising DNA encoding human immunoglobulin heavy and kappa light chain variable regions) with an immunogen comprising a soluble dimeric ecto domain of human PRLR.
- the antibody immune response was monitored by a PRLR- specific immunoassay.
- a desired immune response was achieved splenocytes were harvested and fused with mouse myeloma cells to preserve their viability and form hybridoma cell lines.
- the hybridoma cell lines were screened and selected to identify cell lines that produce PRLR-specific antibodies.
- several anti-PRLR chimeric antibodies i.e. , antibodies possessing human variable domains and mouse constant domains
- several fully human anti-PRLR antibodies were isolated directly from antigen-positive B cells without fusion to myeloma cells, as described in US 2007/0280945A1.
- Table 1 sets forth the amino acid sequence identifiers of the heavy and light chain variable regions and CDRs of selected anti-PRLR antibodies described herein. The corresponding nucleic acid sequence identifiers are set forth in Table 2. Table 1: Amino Acid Sequence Identifiers
- Antibodies are typically referred to herein according to the following nomenclature: Fc prefix (e.g. "H1H,” “HIM,” “H2M,” etc.), followed by a numerical identifier (e.g. "6762,” “6953,” “6958,” etc.), followed by a “P” or “N” suffix, as shown in Tables 1 and 2.
- Fc prefix e.g. "H1H,” “HIM,” “H2M,” etc.
- a numerical identifier e.g. "6762,” “6953,” “6958,” etc.
- P or “N” suffix
- an "H1H” antibody has a human IgGl Fc
- an "HIM” antibody has a mouse IgGl Fc
- an "H2M” antibody has a mouse IgG2 Fc, (all variable regions are fully human as denoted by the first ⁇ ' in the antibody designation).
- an antibody having a particular Fc isotype can be converted to an antibody with a different Fc isotype (e.g.
- Binding affinities and kinetic constants of human monoclonal anti-PRLR antibodies were determined by surface plasmon resonance at 25°C and 37°C.
- Antibodies expressed as human IgGl Fc (i.e. , "H1H” designations), were captured onto an anti-human Fc sensor surface (mAb-capture format), and soluble monomeric (hPRLR.rnmh; SEQ ID NO:401, or macaca fascicularis (mf) PRLR.mmh; SEQ ID NO:403) or dimeric (hPRLR.mFc ; SEQ ID NO:402) PRLR protein was injected over the sensor surface. Measurements were conducted on a T200 Biacore instrument.
- KD dissociation equilibrium constants
- ti /2 dissociative half-lives
- HEK293/mfPRLR and HEK293/mPRLR were selected for at least 2 weeks in complete growth media plus G418.
- the MFI for each cell line was then converted to Alexa647 molecules of equivalent soluble fluorescence (MESF) via the Quantum Alexa Fluor 647 MESF kit according to manufacturer instructions (Bangs Laboratories, Inc, Fishers, IN).
- the average number of fluorophores per H1H6953N- A647 protein (F/P ratio) was determined via the Simply Cellular anti-Human IgG kit according to manufacture instructions (Bangs Laboratories, Inc, Fishers, IN).
- the MESF values were divided by the F/P ratio to determine the PRLR cell surface copy number or H1H6953N antigen binding capacity on each cell line.
- antibodies displayed strong binding to human and monkey PRLR on engineered cell lines as well as endogenously expressed PRLR.
- T47D PRLR- expressing cells
- 20,000 T47D cells were seeded in collagen coated 96 well plates. The next day, cells were incubated with anti-human PRLR antibodies (10 ⁇ g/ml) for 30 min on ice followed by two PBS washes. Cells were then incubated with alexa488 conjugated anti-hFc Fab secondary antibodies for 30 minutes on ice followed by two additional PBS washes. Antibodies were allowed to internalize for lh at 37°C in internalization buffer (PBS + 2% FBS) or remained at 4°C.
- PBS + 2% FBS internalization buffer
- an engineered cell line was used to determine the ability of anti-PRLR antibodies to block ligand activation of the PRLR receptor. Briefly,
- HEK293/hPRLR/STAT5-Luc cell lines with stable incorporation of a human PRLR expression cassette and the STAT5-dependent luciferase reporter were generated via sequential rounds of Lipofectamine® 2000-mediated transfection (LifeTechnologies, Carlsbad, CA). Cells were selected for at least two weeks in the presence of 500 ⁇ g/mL G418 (hPRLR) and 100 ⁇ g/mL hygromycin B (STAT5-Luc).
- the STAT5-Luc assay utilized 2xl0 5 HEK293/hPRLR/STAT5-Luc cells seeded in complete growth medium on PDL-coated 96 well plates grown overnight at 37°C, 5% CO 2 .
- Luciferase activity was measured with ONE-GloTM reagent (Promega, Madison, WI). Relative light units (RLUs) were measured on a Victor luminometer (Perkin Elmer, Shelton, CT). EC 50 /IC 50 values were determined from a four-parameter logistic equation over an 8-point response curve using GraphPad Prism. Percent blocking and percent activation are reported for the highest antibody dose. Results are shown in Table 7. Table 7: IC 50 and Percent Blocking of PRL-Mediated Signaling by Anti-PRLR
- the data of this Example show that a majority of the anti-PRLR antibodies block PRL-mediated receptor activation. Additionally, a majority of the antibodies inhibit receptor activation more potently than the anti-PRLR Control I antibody. For example, several anti-PRLR antibodies blocked prolactin-mediated signaling with IC 50 values of less than about 1.3 nM. On the other hand, certain anti-PRLR antibodies, despite being able to bind PRLR, did not exhibit prolactin blocking activity. Such non-blocking anti- PRLR antibodies may find uses in various therapeutic contexts where PRLR targeting is desired without interfering with normal prolactin-mediated signaling.
- Selected anti-PRLR antibodies were conjugated to the maytansinoid DM1 through an SMCC linker using methods similar to those set forth in US Patent No. 5,208,020 and US Patent Application Publication No. 2010/0129314, the disclosures of which are incorporated by reference herein in their entireties.
- the conjugates were purified by size exclusion chromatography and sterile filtered. All starting materials and solvents were purchased commercially and used without purification, unless otherwise noted.
- Protein and linker/payload concentrations were determined by UV spectral analysis and MALDI-TOF mass spectrometry. Size-exclusion HPLC established that all conjugates used were >95% monomeric, and RP-HPLC established that there was ⁇ 0.5% unconjugated linker pay load. Yields are reported in Table 8 and 9 based on protein. All conjugated antibodies were analyzed by UV for linker pay load loading values according to Hamblett et al, 2004, Clinical Cancer Research 10(20):7063-7070, and by mass difference, native versus conjugated. Table 8: Protein Concentrations for Anti-PRLR Unconjugated Antibodies
- This Example illustrates the conjugation of anti-PRLR antibodies with DM1 through an SMCC linker.
- the payload: antibody molar ratio was calculated to be from about 2.3 to about 3.8 for the conjugated antibodies of this Example. Percent yields for the antibodies ranged from around 50% to 70%.
- PRLR-overexpressing cells including HEK293, PC3, MCF7 and NCI-N87, were generated to assess the ability of anti-PRLR conjugated antibodies to reduce cell viability.
- PC3 and T47D cells with overexpressed ErbB2 were also generated, as well as an MCF7 cell line over-expressing both hPRLR and hErbB2.
- Lipofectamine® 2000-mediated transfection methodology was utilized to generate HEK293 cells expressing human PRLR (HEK293/hPRLR) or human ErbB2
- HEK293/hErbB2 Lipofectamine LTX with Plus Reagent was used to generate PC3 cells expressing human PRLR (PC3/hPRLR) or human ErbB2 (PC3/hErbB2). Lentiviral-mediated transduction was utilized to generate MCF7 cells expressing human PRLR (MCF7/hPRLR), NCI-N87 cells expressing human PRLR (NCI-N87/hPRLR), T47D cells over-expressing human ErbB2 (T47D/hErbB2), and MCF7 cells expressing both human PRLR and human ErbB2 (MCF7/hPRLR/hErbB2). All lines were selected for at least two weeks in complete growth media plus appropriate selection reagents. Stably expressing populations were enriched for PRLR expression via FACS using the anti PRLR antibody Control I.
- exogenous PRLR surface expression ranged from 6-fold to 55-fold over background, with most engineered cells exhibiting 12-fold to 18-fold PRLR expression over background.
- Endogenous PRLR expression was 3 -fold over background in MCF7 cells but was not detected in parental HEK293, PC3 and NCI-N87 lines.
- Endogenous PRLR expression was 12-fold over background in the T47D cell line and 10-fold over background in the T47D#11 variant cell line.
- ErbB2 expression was detected in all PRLR-expressing cell lines, and ranged from 18-fold to 1400-fold above background.
- the 293, PC3 and T47D cells were incubated with CCK8 (Dojindo, Rockville, MD) for the final 1-3 hours and the absorbance at 450nm (OD 450 ) was determined on a Flexstation3 (Molecular Devices, Sunnyvale, CA). MCF7 cells were treated with Hoechst 33342 nuclear stain while being fixed with 4% formaldehyde. Images were acquired on the ImageXpress micro XL (Molecular Devices, Sunnyvale, CA) and nuclear counts were determined via Columbus image analysis software (Perkin Elmer, Shelton, CT).
- IC 50 values were determined from a four-parameter logistic equation over a 10-point response curve (GraphPad Prism). IC 50 values and percent cell killing are shown in Tables 11 and 12.
- Isotype ctrl-DMl 100 60 100 93 125 78 110 63
- IC 50 values are in nM; ND: not determined
- IC 50 values are in nM [00201] As summarized in Tables 11 and 12, several anti-PRLR-DMl antibody-drug conjugates potently reduced cell viability in multiple cell backgrounds, with IC 50 values as low as 100 pM.
- An exemplary anti-PRLR conjugated antibody, H1H6958N2-DM1 reduced the cell viability of HEK293, PC3 and MCF7-PRLR expressing cells with sub-nM IC 50 s ranging from 100 pM to 460 pM, and killed endogenously expressing T47D cells with an IC 50 of 1.3 nM.
- the similarly conjugated anti-PRLR Control I antibody (Control I-DM1) was several fold less potent than H1H6958N2-DM1 across all cell lines. Non-binding isotype controls and unconjugated antibodies had no impact on cell viability.
- IC 50 values are in nM
- IC 50 values are in nM
- IC 50 values are in nM Table 17: Cell Kill Potency of Anti-PRLR-DMl and Anti-ErbB2-DMl Antibody-Drug
- IC 50 values are in nM
- Anti-PRLR-DMl antibodies effectively killed cells even with relatively low levels of PRLR expression.
- H1H6953N-DM1 inhibited the growth of T47D cells (expressing PRLR at only 12X above background) with an IC 50 of 1.3 nM and showed 78% killing.
- This same antibody also inhibited the growth of 293/hPRLR cells (expressing PRLR at 18X above background) with and IC 50 of 0.43 nM and showed 93% killing.
- Equivalent killing with the anti-ErbB2-DMl antibody (“control ⁇ ") was observed only in cells that express the target antigen at levels greater than about 200X to about 400X above background (see e.g.
- T47D cell viability IC5 0 S ranged from 0.6 nM to 3.4nM and MCF7/hPRLR cell viability IC50s ranged from 0.2 nM to 0.8 nM.
- mice All mice were obtained from Taconic (Hudson, NY). Each bolus of cells was supplemented with a 90-day estrogen release pellet (1.7 mg/pellet; Alternative Research America, Sarasota FL). Once tumors had reached an average volume of 250mm 3 , mice were randomized into groups of seven and dosed with anti-PRLR antibody-drug conjugates or control reagents. Control reagents included PBS vehicle, free methyl-disulfide DM1 (DM1- SMe) and isotype Control 1-DMl.
- DM1- SMe free methyl-disulfide DM1
- mice were dosed once a week for a total of three weeks with tumor volumes and body weights being monitored twice weekly throughout the study.
- Test ADCs were dosed at 5 and/or 15 mg/kg in the multi-dose studies.
- Test ADCs were dosed at 1, 2.5, 5, and 15 mg/kg in the single-dose studies.
- Average tumor size as well as tumor growth inhibition relative to the vehicle treated group were calculated for each group. Tumors were measured with calipers twice a week until the average size of the vehicle group reached 1000mm 3 . Tumor size was calculated using the formula (length x width 2 )/2.
- Table 22 Tumor Size and Tumor Growth Inhibition Following Multi-Dose Administration of Anti-PRLR Antibody-Drug Conjugates and Controls - MCF7/PRLR tumors (TRIAL #2)
- Table 23 Tumor Size and Tumor Growth Inhibition Following Multi-Dose Administration of Anti-PRLR Antibody-Drug Conjugates and Controls - PC3/PRLR tumors (TRIAL #1)
- Table 24 Tumor Size and Tumor Growth Inhibition Following Multi-Dose Administration of Anti-PRLR Antibody-Drug Conjugates and Controls - PC3/PRLR tumors (TRIAL #2)
- Table 25 Tumor Size and Tumor Growth Inhibition Following Multi-Dose Administration of Anti-PRLR Antibody-Drug Conjugates and Controls - T47D#11 tumors
- Table 26 Tumor Size and Tumor Growth Inhibition Following Single Dose Administration of Anti-PRLR Antibody-Drug Conjugates and Controls - MCF7/PRLR tumors
- exemplary anti-PRLR antibodies conjugated to DM1 were initially assessed for the ability to reduce MCF7/PRLR and PC3/PRLR tumor volume in multi-dose studies.
- H1H6958N2-DM1, H1H6953N- DM1 and H1H6975N-DM1 antibodies potently inhibited MCF7/PRLR tumor growth at both 5 and 15 mg/kg doses.
- all three DM1 conjugated antibodies reduced tumors to undetectable levels, with a percent reduction in tumor volume of about 133-135%.
- H1H6765P-DM1 and H1H6782P-DM1 after 15 days of tumor growth. At the highest dose administered, tumor inhibition across trials ranged from 38-98%. (Table 24). In comparison, an Isotype-control conjugated to DM1 produced only 16% tumor inhibition with final tumor volumes not significantly different to vehicle controls.
- anti-PRLR-DMl conjugated antibodies exhibited 89-100% tumor inhibition whereas at 15 mg/kg DM1- conjugated antibodies resulted in 106-112 % tumor growth inhibition.
- unconjugated anti-PRLR antibodies were not observed to have any anti-tumor efficacy in this endogenous tumor model, indicating the role of the DM1 conjugate in producing anti-tumor efficacy.
- efficacy of anti-PRLR ADC was very specific as control ADC failed to have any effect on tumor growth.
- anti-PRLR DMl-conjugated antibody H1H6958N2 was assessed in MCF7/PRLR xenografted mice in a single-dose study. (Table 26). As in multiple-dose studies, established tumors were allowed to grow to approximately 200 mm 3 before a single dose was administered. Here, H1H6958N2-DM1 was given at 1, 2.5, 5 and 15 mg/kg. As summarized in Table 26, a dose dependent anti-tumor effect was seen across the wide range used in this study. Anti-tumor effect was observed at all doses, with 1 mg/kg causing a significant decrease in tumor volume relative to vehicle control tumors.
- PRLR belongs to the class I cytokine receptor family, which includes IL-4R and IL-6R. Similar to PRLR, IL-4R and IL-6R are single-pass transmembrane receptors; IL-4R mediates IL-4 and IL-13 signaling, while IL-6R mediates IL-6 signaling via a co-complex with the gpl30 receptor.
- ADCs directed against class I cytokine receptors may be used to effectively kill cells, including cells that express low-levels of target antigen, the cell-killing ability of ADCs directed against IL-4R and IL-6R was evaluated.
- HEK293 and Ramos cells endogenously expressed IL- 4R at levels 2-fold and 4-fold over background, respectively, while the engineered
- HEK293/IL-4R cell line expressed IL-4R at levels 50-fold above background. IL-4R expression was undetectable over background on KG-1 cells. IL-6R expression was detected at 7-fold above background levels in KG-1 cells, and not on HEK293 or Ramos cell lines.
- exemplary anti-IL-4R (H4H083P2) and anti-IL-6R (VV6A9-5) antibodies were conjugated to the cytotoxic drug DM1 and their potency in cytotoxicity assays was evaluated.
- HEK293/IL-4R, Ramos or KG-1 cell lines, as well as HEK293 parental cells were seeded in PDL-coated 96-well plates at 1500 to 10,000 cells per well.
- ADCs or free DM1 (as the methyl disulfide derivative DMl-SMe) were added to the cells at final concentrations ranging from 300 nM to 15 pM and incubated for 3 days.
- this Example demonstrates that anti-IL-4R and anti-IL-6R antibody drug conjugates exhibited potent and reproducible cytotoxicity even on cell lines expressing modest receptor levels. This result is similar to what was observed with anti- PRLR ADCs where potent cell killing was obtained even on cells expressing low levels of PRLR (see, e.g. , Example 7 herein). Thus, this Example provides further support for the inventive concept that anti-class I cytokine receptor ADCs in general may be effective therapeutic agents against cell lines and tumors that express class I cytokine receptors even at low levels.
- H/D hydrogen/deuterium
- hPRLR-mmH myc-myc-hexahistidine tag
- the resulting peptides were desalted using ZipTip ® chromatographic pipette tips and immediately analyzed by UltrafleXtreme matrix assisted laser desorption ionization time of flight (MALDI-TOF)-TOF mass spectrometry (MS).
- MALDI-TOF UltrafleXtreme matrix assisted laser desorption ionization time of flight
- MS mass spectrometry
- This epitope is located within the fibronectin-like type III domain 1 ("Domain 1") of the extracellular domain of PRLR.
- Domain 1 fibronectin-like type III domain 1
- the present Example in conjunction with other working examples set forth herein, identifies Domain 1 of the PRLR extracellular domain as a particularly effective target for antibodies and ADCs that are useful for treating PRLR-related diseases and disorders.
- RNAscope In Situ Hybridization technology Advanced Cell Diagnostics
- FFPE embedded samples were from Breast Tumor Micro-Arrays (TMAs) obtained from Indivumed.
- TMAs Breast Tumor Micro-Arrays
- Tumor sections were assessed for PRLR RNA expression using specific RNA Scope probes and developed using Diaminobenzidine chromogenic stains according to standard protocols. Images were scanned on an Aperio XT Scan scope at 40x (Leica Systems) and PRLR expression was assessed in the samples qualitatively.
- PRLR expression was heterogeneous across some tumors (data not shown). No correlation between PRLR expression and hormone receptor or HER2 status of the tumors was observed, with PRLR found in both hormone receptor positive tumors and ER/PR/HER2 "triple negative" tumors. These data are consistent with analysis of PRLR mRNA levels in human breast cancer from public gene expression databases (data not shown).
- ELISA-based blocking assays were developed to determine the ability of H1H6958N2 and H1H6958N2-DM1 to block binding of human and cynomolgus monkey PRLR to immobilized human PRL.
- Dimeric forms of human or cynomolgus monkey (Macaca fascicularis) PRLR and monomeric human PRL were used in this assay.
- human or monkey PRLR at concentrations ranging from 3.38pM to 200nM was added to the plates previously coated in 1 ⁇ g/mL PRL.
- H1H6958N2 and H1H6958N2-DM1 were determined in a luciferase reporter assay using the HEK293 cell line engineered to constitutively express PRLR and stably transduced with a lucifierase reporter construct comprising 5 tandem STAT5 binding sites derived from the promoter of the human interleukin-2 receptor a gene [STAT5 response element (x5) - luciferase] (John et al., The EMBO Journal, 1996, 15(20): 5627-5635).
- STAT5 transcription factors are known mediators of intracellular signal transduction downstream of PRLR (Fang et al., BMC Biotechnology, 2008, 8: 11.
- human PRL was added to the reporter cells at concentrations ranging from 0.8pM to ⁇ .
- cells were incubated for 6 hours at 37°C and 5% CO 2 and then equilibrated to room temperature for 15 minutes. Luciferase activity was measured using the ONE-Glo substrate and measuring luminescence.
- mAbs or ADCs were added at concentrations ranging from 3.3pM to 200nM (molarity indicates antibody concentration for both ADC and mAb), followed by the addition of a constant concentration of 2nM PRL. Plates were incubated at 37°C and 5% CO 2 for 5 hours and equilibrated to room temperature for 10 minutes. Luciferase activity was again measured using the ONE-Glo substrate and measuring luminescence.
- H1H6958N2-DM1 blocked the binding of human or monkey PRLR to monomeric human PRL ligand by ELISA ( Figure 1).
- human or monkey PRLR bound to human PRL in a dose-dependent manner, with EC5 0 values of 4.9 and 5.7nM, respectively (solid black squares in insets in Figure 1A and IB).
- H1H6958N2-DM1 and H1H6958N2 blocked the binding of ⁇ human PRLR to immobilized human PRL with IC5 0 values of 4.4nM and 5.0nM, respectively ( Figure 1A).
- H1H6958N2-DM1 and H1H6958N2 blocked the binding of monkey PRLR to human PRL with IC 50 values of 4.2nM and 5.8nM, respectively ( Figure IB).
- Control antibody and control ADC did not demonstrate any blocking activity under identical assay conditions.
- H1H6958N2-DM1 also blocked PRL induced STAT5 activity
- a HEK293/PRLR/STAT5-Luc reporter cell line was generated.
- 2.1 nM of human PRL was determined to be the concentration required for stimulation of human PRLR signaling to 50% of the maximum activity level (EC 50 ) ( Figure 1C).
- Both H1H6958N2 and H1H6958N2-DM1 effectively blocked PLR-induced luciferase activity in a dose- dependent manner, with 0.4 nM of H1H6958N2 and H1H6958N2-DM1 required for a 50% reduction of PRLR signaling (IC 50 ) in the presence of a constant concentration of 2 nM PRL.
- neither control mAb nor control ADC blocked PRL- induced PRLR-STAT5 signaling.
- H1H6958N2-DM1 effectively blocks PRL binding to PRLR and blocks PRL-induced STAT5 signaling.
- H1H6958N2-DM1 has Anti-Tumor Activity Against MCF7 and MCF7/PRLR Breast Cancer Xenografts
- H1H6958N2-DM1 Activity of H1H6958N2-DM1 in a tumor expressing low levels of the receptor was assessed using NCr nude mice bearing established MCF7 tumor xenografts. Although this tumor cell line was not inhibited by H1H6958N2-DM1 in vitro (see above), moderate in vivo anti-tumor activity was observed following a single dose of 5 or 10 mg/kg H1H6958N2- DM1 ( Figure 2A). At the highest dose assessed, (15 mg/kg), H1H6958N2-DM1 significantly inhibited the growth of the MCF7 tumors relative to control ADC. Repeat treatment of MCF7 tumors in a subsequent study resulted in more pronounced anti-tumor effects than observed in the single dose study. Here, both 10 and 15 mg/kg H1H6958N2-DM1 significantly inhibited MCF7 tumor growth relative to control ADC, although some anti-tumor activity was induced by control ADC relative to vehicle control ( Figure 2B).
- H1H6958N2-DM1 The therapeutic efficacy of H1H6958N2-DM1 was next assessed in the MCF7/PRLR tumor xenograft expressing high levels of PRLR.
- treatment with a single dose of H1H6958N2-DM1 at 2.5 - 15 mg/kg was active, with significant antitumor efficacy observed at all doses. Increased activity at 10 and 15 mg/kg was observed, with these doses causing eradication of the tumors over the course of the study (Figure 2C).
- Administration of three once-weekly doses demonstrated further significant anti-tumor activity, with repeat doses of 5 and 15 mg/kg H1H6958N2-DM1 leading to tumor eradication in this model (Figure 2D).
- No anti-tumor activity was observed for control ADC in this model and unconjugated H1H6958N2 that was assessed in this study also failed to induce any inhibition of tumor growth.
- MCF7 xenografts showed a clear response to H1H6958N2-DM1 in vivo despite expressing moderate levels of the PRLR and being insensitive to ADC in vitro.
- Example 14 H1H6958N2-DM1 Anti-Tumor Activity against T47DvII Breast Cancer Xenografts and Combination with Fulvestrant Increases Activity
- the T47Dvl 1 model was used to assess the activity of H1H6958N2-DM1 in a model with significant levels of endogenous PRLR.
- parental T47D cells are poorly tumorigenic, in vivo passaging was employed to develop a variant with consistent tumorigenicity.
- lOxlO 6 parental T47D cells were implanted subcutaneously (SC) into the left flank of female C.B.-17 SCID mice (Taconic, Hudson NY). Tumors were supplemented with a 90-day release 1.7 mg estrogen pellet (Innovative Research America). Where T47D tumors were observed, they were excised and cut into 3 mm fragments and subsequently implanted into the left flank of separate female C.B.-17 SCID mice.
- mice were implanted with 7.5 xlO 6 T47Dvl l cells into the left flank of female C.B.-17 SCID mice supplemented with a 90-day release 0.72 mg/pellet estrogen pellet.
- the selective estrogen receptor down-regulator (SERD) fulvestrant (Faslodex, Astra Zeneca) was administered subcutaneously in its recommended vehicle (10% w/v Alcohol, 10% w/v Benzyl Alcohol, and 15% w/v Benzyl Benzoate, made up to 100% w/v with Castor Oil) once weekly for the duration of studies. Tumor size and body weight were measured in vivo twice per week throughout the duration of the study.
- H1H6958N2-DM1 caused tumor regression. Complete regressions were apparent for some tumors that received the highest dose of ADC (Figure 3B). No activity of control ADC was apparent in the T47Dvl l model, and unconjugated H1H6958N2 again had no effect on tumor growth.
- tumor growth inhibition was calculated according to the following formula: (l-((Tf ma i-Ti n itiai)/(Cf ma r Cinitiai))*100, where T (treated group) and C (control group) represent the mean tumor mass on the day the vehicle group reached 1000mm 3 .
- mice were implanted with T47DvII cells and tumors were grown for 15 days where mice were randomized based on tumor volume and dosed intravenously with either vehicle, H1H6958N2-DM1 at 5 or 15 mg/kg or Control ADC at 15 mg/kg (N 4-5). At 24, 48 or 72 hours post-treatment, mice were euthanized and tumors processed as FFPE samples for IHC analysis.
- Example 16 H1H6958N2-DM1 Anti-Tumor Activity against TM00107 Patient Derived Xenograft Tumor
- Efficacy of H1H6958N2-DM1 was also assessed in a patient derived xenograft (PDX) model of breast cancer that may better represent the response in patients.
- PDX patient derived xenograft
- NSG NOD SCID gamma mice bearing tumor fragments of the TM00107 PDX breast cancer tumor were sourced from The Jackson Laboratories.
- the TM00107 PDX model was derived from an ER+/-/PR-/HER2- metastatic breast adenocarcinoma. PRLR expression was confirmed by microarray analysis and immunohistochemistry on tumor sample slides provided by The Jackson Laboratory (data not shown).
- mice that received vehicle control were euthanized at day 30 post-implantation due to large tumor volume.
- a moderate but significant (p ⁇ 0.01) decrease in average tumor volumes of mice treated with 20 mg/kg H1H6958N2-DM1 was observed compared to animals administered 20 mg/kg control ADC ( Figure 6A).
- a trend towards inhibition of tumor growth was observed in mice treated with the lower dose of 10 mg/kg H1H6958N2-DM1 compared to vehicle control mice, however, no significant difference in average tumor volume was observed.
- the paclitaxel treatment did not have an effect on tumor growth.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Emergency Medicine (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17817499.1A EP3548514A1 (en) | 2016-11-29 | 2017-11-28 | Methods of treating prlr positive breast cancer |
| CN201780084656.8A CN110382534B (zh) | 2016-11-29 | 2017-11-28 | 治疗prlr阳性乳腺癌的方法 |
| KR1020197018219A KR20190091290A (ko) | 2016-11-29 | 2017-11-28 | Prlr 양성 유방암 치료 방법 |
| MX2019006131A MX2019006131A (es) | 2016-11-29 | 2017-11-28 | Metodos para tratar cancer de mama positivo para prlr. |
| JP2019528685A JP7174699B2 (ja) | 2016-11-29 | 2017-11-28 | Prlr陽性乳癌の治療方法 |
| EA201900312A EA201900312A1 (ru) | 2016-11-29 | 2017-11-28 | Способы лечения пролактин-рецептор положительного рака молочной железы |
| CA3044534A CA3044534A1 (en) | 2016-11-29 | 2017-11-28 | Methods of treating prlr positive breast cancer |
| IL266917A IL266917B2 (en) | 2016-11-29 | 2017-11-28 | Anti-human prolactin receptor (prlr) antibody-drug conjugates and use thereof in combination therapy of prlr positive breast cancer |
| AU2017366873A AU2017366873A1 (en) | 2016-11-29 | 2017-11-28 | Methods of treating PRLR positive breast cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662427534P | 2016-11-29 | 2016-11-29 | |
| US62/427,534 | 2016-11-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018102304A1 true WO2018102304A1 (en) | 2018-06-07 |
Family
ID=60703124
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/063476 Ceased WO2018102304A1 (en) | 2016-11-29 | 2017-11-28 | Methods of treating prlr positive breast cancer |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US10925971B2 (https=) |
| EP (1) | EP3548514A1 (https=) |
| JP (1) | JP7174699B2 (https=) |
| KR (1) | KR20190091290A (https=) |
| CN (1) | CN110382534B (https=) |
| AU (1) | AU2017366873A1 (https=) |
| CA (1) | CA3044534A1 (https=) |
| EA (1) | EA201900312A1 (https=) |
| IL (1) | IL266917B2 (https=) |
| MX (1) | MX2019006131A (https=) |
| WO (1) | WO2018102304A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10112999B2 (en) | 2017-04-06 | 2018-10-30 | Abbvie Inc. | Anti-PRLR antibody-drug conjugates (ADC) and uses thereof |
| WO2019157224A1 (en) | 2018-02-07 | 2019-08-15 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for therapeutic protein delivery |
| US11352446B2 (en) | 2016-04-28 | 2022-06-07 | Regeneron Pharmaceuticals, Inc. | Methods of making multispecific antigen-binding molecules |
| US11578135B2 (en) | 2012-03-14 | 2023-02-14 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules binding to a target and an internalizing effector protein that is CD63 and uses thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EA201991673A1 (ru) * | 2017-02-10 | 2020-01-17 | Регенерон Фармасьютикалз, Инк. | Меченные радиоактивным изотопом антитела к lag3 для иммуно-пэт-визуализации |
| KR20240105964A (ko) * | 2022-12-29 | 2024-07-08 | 주식회사 삼양홀딩스 | 약동학적 특성이 우수한 풀베스트란트의 약학 조성물 및 그 제조 방법 |
| CN118834297A (zh) * | 2023-04-24 | 2024-10-25 | 深圳真实生物医药科技有限公司 | 泌乳素受体抗体及其用途 |
| WO2025192691A1 (ja) * | 2024-03-14 | 2025-09-18 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
Citations (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US7087411B2 (en) | 1999-06-08 | 2006-08-08 | Regeneron Pharmaceuticals, Inc. | Fusion protein capable of binding VEGF |
| US20070280945A1 (en) | 2006-06-02 | 2007-12-06 | Sean Stevens | High affinity antibodies to human IL-6 receptor |
| WO2008002295A1 (en) | 2006-06-27 | 2008-01-03 | Thomson Licensing | Performance aware peer-to-peer video-on-demand |
| US7422899B2 (en) | 2005-10-05 | 2008-09-09 | Biogen Idec Ma Inc. | Antibodies to the human prolactin receptor |
| US20090142354A1 (en) | 2006-12-14 | 2009-06-04 | Regeneron Pharmaceuticals, Inc. | Human antibodies to human delta like ligand 4 |
| US7608693B2 (en) | 2006-10-02 | 2009-10-27 | Regeneron Pharmaceuticals, Inc. | High affinity human antibodies to human IL-4 receptor |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
| US20110027286A1 (en) | 2009-07-29 | 2011-02-03 | Regeneron Pharmaceuticals, Inc. | High Affinity Human Antibodies to Human Angiopoietin-2 |
| WO2014145090A1 (en) | 2013-03-15 | 2014-09-18 | Regeneron Pharmaceuticals, Inc. | Biologically active molecules, conjugates thereof, and therapeutic uses |
| WO2015026907A1 (en) * | 2013-08-21 | 2015-02-26 | Regeneron Pharmaceuticals, Inc. | Anti-prlr antibodies and uses thereof |
| US20150056222A1 (en) * | 2013-08-21 | 2015-02-26 | Regeneron Pharmaceuticals, Inc. | Anti-prlr antibodies and uses thereof |
| WO2015031396A1 (en) | 2013-08-26 | 2015-03-05 | Regeneron Pharmaceuticals, Inc. | Pharmaceutical compositions comprising macrolide diastereomers, methods of their synthesis and therapeutic uses |
| WO2016160615A1 (en) | 2015-03-27 | 2016-10-06 | Regeneron Pharmaceuticals, Inc. | Maytansinoid derivatives, conjugates thereof, and methods of use |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6429186B1 (en) | 1991-05-10 | 2002-08-06 | Genentech, Inc. | Ligand antagonists for treatment of breast cancer |
| ATE366114T1 (de) | 1998-05-12 | 2007-07-15 | Greenville Hospital System | Verwendung von anti-prolaktin agentien zur behandlung von krebs |
| US6867187B2 (en) | 2000-12-22 | 2005-03-15 | Trustees Of The University Of Pennsylvania | Composition and method for modulating somatolactogenic function |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US8088387B2 (en) | 2003-10-10 | 2012-01-03 | Immunogen Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US20080038369A1 (en) | 2003-12-11 | 2008-02-14 | Clark Ross G | Methods And Compositions For The Treatment Of Prolactin-Receptor Related Disorders |
| US8754031B2 (en) | 2004-03-08 | 2014-06-17 | Oncolix, Inc. | Use of prolactin receptor antagonists in combination with an agent that inactivates the HER2/neu signaling pathway |
| US20070092920A1 (en) | 2005-10-24 | 2007-04-26 | Clevenger Charles V | Serum Prolactin Binding Protein in Epithelial Carcinoma |
| WO2009010398A1 (en) | 2007-07-18 | 2009-01-22 | Novo Nordisk A/S | Stabilized prolactin receptor antagonists |
| EP2332995A1 (en) | 2009-12-10 | 2011-06-15 | Bayer Schering Pharma Aktiengesellschaft | Neutralizing prolactin receptor antibodies and their therapeutic use |
| WO2012136519A1 (en) | 2011-04-06 | 2012-10-11 | Bayer Pharma Aktiengesellschaft | Use of neutralizing prolactin receptor antibodies for the treatment and prevention of antiestrogen-resistant breast cancer |
| EP2530089A1 (en) | 2011-06-03 | 2012-12-05 | Bayer Pharma Aktiengesellschaft | Neutralising prolactin receptor antibody Mat3 and its therapeutical use |
| CN102746402A (zh) | 2012-07-09 | 2012-10-24 | 南京医科大学 | 全人源抗人催乳素受体单链抗体及其应用 |
| US8883979B2 (en) | 2012-08-31 | 2014-11-11 | Bayer Healthcare Llc | Anti-prolactin receptor antibody formulations |
| CA2896058A1 (en) | 2012-12-24 | 2014-07-03 | Abbvie Inc. | Prolactin receptor binding proteins and uses thereof |
| TW201513882A (zh) | 2013-03-15 | 2015-04-16 | Bayer Healthcare Llc | 抗-催乳激素受體抗體調配物 |
-
2017
- 2017-11-28 EP EP17817499.1A patent/EP3548514A1/en not_active Withdrawn
- 2017-11-28 MX MX2019006131A patent/MX2019006131A/es unknown
- 2017-11-28 CN CN201780084656.8A patent/CN110382534B/zh not_active Expired - Fee Related
- 2017-11-28 WO PCT/US2017/063476 patent/WO2018102304A1/en not_active Ceased
- 2017-11-28 US US15/824,546 patent/US10925971B2/en not_active Expired - Fee Related
- 2017-11-28 IL IL266917A patent/IL266917B2/en unknown
- 2017-11-28 EA EA201900312A patent/EA201900312A1/ru unknown
- 2017-11-28 JP JP2019528685A patent/JP7174699B2/ja active Active
- 2017-11-28 KR KR1020197018219A patent/KR20190091290A/ko not_active Ceased
- 2017-11-28 AU AU2017366873A patent/AU2017366873A1/en not_active Abandoned
- 2017-11-28 CA CA3044534A patent/CA3044534A1/en active Pending
Patent Citations (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US7087411B2 (en) | 1999-06-08 | 2006-08-08 | Regeneron Pharmaceuticals, Inc. | Fusion protein capable of binding VEGF |
| US7422899B2 (en) | 2005-10-05 | 2008-09-09 | Biogen Idec Ma Inc. | Antibodies to the human prolactin receptor |
| US7582298B2 (en) | 2006-06-02 | 2009-09-01 | Regeneron Pharmaceuticals, Inc. | High affinity antibodies to human IL-6 receptor |
| US20070280945A1 (en) | 2006-06-02 | 2007-12-06 | Sean Stevens | High affinity antibodies to human IL-6 receptor |
| WO2008002295A1 (en) | 2006-06-27 | 2008-01-03 | Thomson Licensing | Performance aware peer-to-peer video-on-demand |
| US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
| US7608693B2 (en) | 2006-10-02 | 2009-10-27 | Regeneron Pharmaceuticals, Inc. | High affinity human antibodies to human IL-4 receptor |
| US20090142354A1 (en) | 2006-12-14 | 2009-06-04 | Regeneron Pharmaceuticals, Inc. | Human antibodies to human delta like ligand 4 |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| US20110027286A1 (en) | 2009-07-29 | 2011-02-03 | Regeneron Pharmaceuticals, Inc. | High Affinity Human Antibodies to Human Angiopoietin-2 |
| WO2014145090A1 (en) | 2013-03-15 | 2014-09-18 | Regeneron Pharmaceuticals, Inc. | Biologically active molecules, conjugates thereof, and therapeutic uses |
| WO2015026907A1 (en) * | 2013-08-21 | 2015-02-26 | Regeneron Pharmaceuticals, Inc. | Anti-prlr antibodies and uses thereof |
| US20150056222A1 (en) * | 2013-08-21 | 2015-02-26 | Regeneron Pharmaceuticals, Inc. | Anti-prlr antibodies and uses thereof |
| US9302015B2 (en) | 2013-08-21 | 2016-04-05 | Regeneron Pharmaceuticals, Inc. | Anti-PRLR antibodies and methods for killing PRLR-expressing cells |
| WO2015031396A1 (en) | 2013-08-26 | 2015-03-05 | Regeneron Pharmaceuticals, Inc. | Pharmaceutical compositions comprising macrolide diastereomers, methods of their synthesis and therapeutic uses |
| WO2016160615A1 (en) | 2015-03-27 | 2016-10-06 | Regeneron Pharmaceuticals, Inc. | Maytansinoid derivatives, conjugates thereof, and methods of use |
Non-Patent Citations (42)
| Title |
|---|
| ALI MOHAMED ET AL: "Breast Cancer Theme Issue: REVIEW: Targeted Therapy for Breast Cancer", 4 October 2013 (2013-10-04), XP055187688, Retrieved from the Internet <URL:http://www.sciencedirect.com/science/article/pii/S0002944013005269/pdfft?md5=197eb4dc4bcffbf60d4affc13690840c&pid=1-s2.0-S0002944013005269-main.pdf> [retrieved on 20150506] * |
| AL-LAZIKANI ET AL., J. MOL. BIOL., vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 402 |
| ANGAL ET AL., MOLECULAR IMMUNOLOGY, vol. 30, 1993, pages 105 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 - 4289 |
| CHRISTIANE OTTO ET AL: "A Neutralizing Prolactin Receptor Antibody Whose In Vivo Application Mimics the Phenotype of Female Prolactin Receptor-Deficient Mice", ENDOCRINOLOGY, vol. 156, no. 11, 1 November 2015 (2015-11-01), US, pages 4365 - 4373, XP055444583, ISSN: 0013-7227, DOI: 10.1210/en.2015-1277 * |
| CIARA C. O'SULLIVAN ET AL: "Targeting Prolactin Receptor (PRLR) Signaling in PRLR-Positive Breast and Prostate Cancer", THE ONCOLOGIST, vol. 21, no. 5, 22 April 2016 (2016-04-22), US, pages 523 - 526, XP055444381, ISSN: 1083-7159, DOI: 10.1634/theoncologist.2016-0108 * |
| CLYNES ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 95, 1998, pages 652 - 656 |
| DAMIANO; WASSERMAN, CLIN. CANCER RES., vol. 19, no. 7, April 2013 (2013-04-01), pages 1644 - 1650 |
| DENNLER ET AL., BIOCONJUGATE CHEM., vol. 25, 2014, pages 569 - 578 |
| EHRING, ANALYTICAL BIOCHEMISTRY, vol. 267, no. 2, 1999, pages 252 - 259 |
| ENGEN; SMITH, ANAL. CHEM., vol. 73, 2001, pages 256A - 265A |
| FANG ET AL., BMC BIOTECHNOLOGY, vol. 8, 2008, pages 11 |
| GONNET ET AL., SCIENCE, vol. 256, 1992, pages 1443 - 1445 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| HAMBLETT ET AL., CLINICAL CANCER RESEARCH, vol. 10, no. 20, 2004, pages 7063 - 7070 |
| J C SINGH ET AL: "HER2-positive advanced breast cancer: optimizing patient outcomes and opportunities for drug development", BRITISH JOURNAL OF CANCER, vol. 111, no. 10, 15 July 2014 (2014-07-15), GB, pages 1888 - 1898, XP055251792, ISSN: 0007-0920, DOI: 10.1038/bjc.2014.388 * |
| J. S. DAMIANO ET AL: "Neutralization of Prolactin Receptor Function by Monoclonal Antibody LFA102, a Novel Potential Therapeutic for the Treatment of Breast Cancer", MOLECULAR CANCER THERAPEUTICS, vol. 12, no. 3, 27 December 2012 (2012-12-27), pages 295 - 305, XP055153202, ISSN: 1535-7163, DOI: 10.1158/1535-7163.MCT-12-0886 * |
| JOHN ET AL., THE EMBO JOURNAL, vol. 15, no. 20, 1996, pages 5627 - 5635 |
| JUNGHANS ET AL., CANCER RES., vol. 50, 1990, pages 1495 - 1502 |
| KABAT: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KAZANE ET AL., J. AM. CHEM. SOC., 4 December 2012 (2012-12-04) |
| KLEIN ET AL., MABS, vol. 4, no. 6, 2012, pages 1 - 11 |
| KUFER ET AL., TRENDS BIOTECHNOL., vol. 22, 2004, pages 238 - 244 |
| LANGER AND WISE: "Medical Applications of Controlled Release", 1974, CRC PRES. |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| MARCUS P. KELLY ET AL: "Preclinical Activity of the Novel Anti-Prolactin Receptor (PRLR) Antibody-Drug Conjugate REGN2878-DM1 in PRLR-Positive Breast Cancers", MOLECULAR CANCER THERAPEUTICS, vol. 16, no. 7, 4 April 2017 (2017-04-04), US, pages 1299 - 1311, XP055443941, ISSN: 1535-7163, DOI: 10.1158/1535-7163.MCT-16-0839 * |
| MARTIN ET AL., PROC. NATL. ACAD. SCI., vol. 86, 1989, pages 9268 - 9272 |
| MORDENTI ET AL., PHARMACEUT. RES., vol. 8, 1991, pages 1351 |
| PEARSON, METHODS MOL. BIOL., vol. 24, 1994, pages 307 - 331 |
| POWELL ET AL.: "Compendium of excipients for parenteral formulations", J PHARM SCI TECHNOL, vol. 52, 1998, pages 238 - 311, XP009119027 |
| REDDY ET AL., J. IMMUNOL., vol. 164, 2000, pages 1925 - 1933 |
| REINEKE, METHODS MOL BIOL, vol. 248, 2004, pages 443 - 463 |
| SAPRA, PHARMACOL. & THERAPEUTICS, vol. 138, 2013, pages 452 - 469 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201 |
| SHIELD ET AL., JBC, vol. 277, 2002, pages 26733 |
| SWAMINATHAN ET AL., J. MAMMARY GLAND BIOL. NEOPLASIA, vol. 13, no. 1, 2009, pages 81 - 91 |
| TAYLOR ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 6287 - 6295 |
| TOMER, PROTEIN SCIENCE, vol. 9, 2000, pages 487 - 496 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 - 69 |
| WU ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11578135B2 (en) | 2012-03-14 | 2023-02-14 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules binding to a target and an internalizing effector protein that is CD63 and uses thereof |
| US11352446B2 (en) | 2016-04-28 | 2022-06-07 | Regeneron Pharmaceuticals, Inc. | Methods of making multispecific antigen-binding molecules |
| US10112999B2 (en) | 2017-04-06 | 2018-10-30 | Abbvie Inc. | Anti-PRLR antibody-drug conjugates (ADC) and uses thereof |
| WO2019157224A1 (en) | 2018-02-07 | 2019-08-15 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for therapeutic protein delivery |
| US12258597B2 (en) | 2018-02-07 | 2025-03-25 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for therapeutic protein delivery |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110382534A (zh) | 2019-10-25 |
| US20180185504A1 (en) | 2018-07-05 |
| KR20190091290A (ko) | 2019-08-05 |
| US10925971B2 (en) | 2021-02-23 |
| CA3044534A1 (en) | 2018-06-07 |
| IL266917A (en) | 2019-07-31 |
| EA201900312A1 (ru) | 2019-12-30 |
| EP3548514A1 (en) | 2019-10-09 |
| MX2019006131A (es) | 2019-08-21 |
| IL266917B2 (en) | 2023-10-01 |
| CN110382534B (zh) | 2023-05-09 |
| IL266917B1 (en) | 2023-06-01 |
| JP7174699B2 (ja) | 2022-11-17 |
| AU2017366873A1 (en) | 2019-06-13 |
| JP2019535797A (ja) | 2019-12-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10683354B2 (en) | Antibody-drug conjugates comprising anti-prolactin receptor (PRLR) antibodies and methods of use thereof to kill PRLR-expressing cells | |
| US11608380B2 (en) | Anti-EGFRvIII antibodies and uses thereof | |
| US9545451B2 (en) | Anti-PRLR antibodies and methods for killing PRLR-expressing cells | |
| US10925971B2 (en) | Methods of treating PRLR positive breast cancer | |
| HK1220206B (en) | Anti-prlr antibodies and uses thereof | |
| EA040545B1 (ru) | Анти-prlr антитела и их применение | |
| BR112016003441B1 (pt) | Anticorpo isolado ou fragmento de ligação de antígeno do mesmo, conjugado de droga para anticorpo, usos dos mesmos, e, composição farmacêutica | |
| HK1232899B (en) | Anti-egfrviii antibodies and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17817499 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3044534 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019528685 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017366873 Country of ref document: AU Date of ref document: 20171128 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197018219 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017817499 Country of ref document: EP Effective date: 20190701 |