WO2018083126A1 - Polypeptide variants and uses thereof - Google Patents
Polypeptide variants and uses thereof Download PDFInfo
- Publication number
- WO2018083126A1 WO2018083126A1 PCT/EP2017/077971 EP2017077971W WO2018083126A1 WO 2018083126 A1 WO2018083126 A1 WO 2018083126A1 EP 2017077971 W EP2017077971 W EP 2017077971W WO 2018083126 A1 WO2018083126 A1 WO 2018083126A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mutation
- antibody
- polypeptide
- region
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2893—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD52
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/528—CH4 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention concerns Fc region-containing polypeptides, such as antibodies, that have decreased Fc effector functions such as, decreased binding to Clq, decreased complement-dependent cytotoxicity (CDC) and may also have decreased activation of other effector functions resulting from one or more amino acid modifications in the Fc-region.
- Fc effector functions such as, decreased binding to Clq, decreased complement-dependent cytotoxicity (CDC) and may also have decreased activation of other effector functions resulting from one or more amino acid modifications in the Fc-region.
- Fc-mediated effector functions of monoclonal antibodies such as complement- dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC) and antibody-dependent cell-mediated phagocytosis (ADCP) contribute to the therapeutic window defined by efficacy and toxicity.
- CDC is initiated by binding of Clq to the Fc regions of antibodies.
- Clq is a multimeric protein consisting of six globular binding heads attached to a stalk. The individual globular binding heads have low affinity for IgG; and Clq must gain avidity by binding multiple IgGl molecules on a cell surface to trigger the classical complement pathway.
- ADCC and ADCP are initiated by binding of the IgG Fc region to Fey receptors (FcyR) on effector cells.
- IgG hexamerization upon target binding on the cell surface has been shown to support avid Clq binding.
- the hexamerization is mediated through intermolecular non-covalent Fc-Fc interactions, and Fc-Fc interactions can be enhanced by point mutations in the CH3 domain, including E345R and E430G.
- WO2013/004842 discloses antibodies or polypeptides comprising variant Fc regions having one or more amino acid modifications resulting in modified effector functions such as complement-dependent cytotoxicity (CDC).
- WO2014/108198 discloses polypeptides such as antibodies comprising variant Fc regions having one or more amino acid modifications resulting in increased complement-dependent cytotoxicity (CDC).
- WO2012/130831 concerns Fc region-containing polypeptides that have altered effector function as a consequence of one or more amino acid substitutions in the Fc region of the polypeptide. These polypeptides exhibit reduced affinity to the human FcyRIIIa and/or FcyRIIa and /or FcyRI compared to a polypeptide comprising the wildtype IgG Fc region, and exhibit reduced ADCC induced by said polypeptide to at least 20% of the ADCC induced by the polypeptide comprising a wild-type human IgG Fc region. WO2012/130831 does not disclose Fc region-containing polypeptides which have enhanced Fc-Fc interactions and/or enhanced ability to form hexamers.
- Enhanced Fc-Fc interactions between antibodies can be used to amplify the effect of the antibody binding to its target on a cell surface, but in instances where the target cell is an effector cell such as a T cell, NK cell or other effector cells where the mechanism of action involves binding to an effector cell (e.g. such as in a bispecific antibody), then the interaction with Clq or Fc-gammaR and/or activation of Fc effector functions such as CDC and/or ADCC may be unwanted. Therefore there is a need for antibodies with enhanced Fc-Fc interactions, but that does not engage Clq binding and/or have Fc-gammaR interactions and thereby activate Fc effector functions such as CDC and/or ADCC.
- a variant polypeptide or antibody comprising an Fc region of a human IgG and an antigen binding region, which polypeptide has increased Fc-Fc interactions and reduced effector functions such as CDC and/or ADCC compared to a parent polypeptide, where the parent polypeptide is a human IgG of the same isotype and having the same antigen binding region, with a first mutation which is an Fc-Fc enhancing mutation in an amino acid position corresponding to E345, E430 or S440 in human IgGl, with the proviso that the mutation in position S440 is S440Y or S440W.
- the invention provides for polypeptides or antibodies having an Fc region and an antigen binding region where the Fc region has a first mutation which is an Fc-Fc enhancing mutation and a second mutation which decreases Clq binding and/or FcgammaR binding and/orFc effector functions such as CDC and/or ADCC activity.
- the inventors of the present invention surprisingly found that by introducing a second mutation in the Fc region corresponding to amino acid position E322 or P329 in the Fc region of a human IgG, the oligomerization capability of the first mutation could be maintained while effector functions such as, CDC, and/or ADCC activity were decreased.
- polypeptides or antibodies of the invention are capable of a more stable binding interaction between the Fc regions of two polypeptides or antibody molecules when bound to the target on a cell surface, which leads to an enhanced oligomerization, such as hexamer formation, without enhancing Fc mediated effector functions.
- the polypeptides or antibodies of the invention further have decreased Clq binding and/or decreased FcgammaR binding compared to their parent polypeptide or parent antibody which comprises a first mutation but not a second mutation.
- the polypeptides or antibodies of the invention have decreased Fc effector functions compared to their parent polypeptide or parent antibody which comprises a first mutation but not a second mutation.
- Some polypeptides or antibodies of the invention have a decreased Fc effector function such as CDC compared to a parent polypeptide or parent antibody. Some polypeptides or antibodies of the invention have a decreased Fc effector function such as ADCC compared to a parent polypeptide or parent antibody. Some polypeptides or antibodies of the invention have a decreased Fc effector function such as CDC and ADCC compared to a parent polypeptide or parent antibody Some polypeptides or antibodies of the invention further have a decreased Fc effector response compared to an identical polypeptide or antibody which does not comprise a first and a second mutation, i.e. a wild type Fc region . Some polypeptides of the invention have reduced Clq binding and/or reduced FcgammaR binding.
- Some polypeptides or antibodies of the invention have a reduced CDC response. Some polypeptides or antibodies of the invention have a reduced ADCC response. Some polypeptides or antibodies of the invention are characterized by having both a reduced ADCC and CDC response, and/or other reduced effector responses.
- the present invention provides for a polypeptide or an antibody comprising an Fc region of a human IgG and an antigen binding region, wherein the Fc region comprises a CH2 and CH3 domain, said Fc region comprising a (i) first mutation and a (ii) second mutation corresponding to the following amino acid positions in human IgGl according to EU numbering (Edelman et al., Proc Natl Acad Sci U S A. 1969 May;63(l) :78-85; Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition. 1991 NIH Publication No. 91-3242) :
- the inventors of the present invention in a first aspect of the invention found that introducing a second mutation in one of the amino acid positions corresponding to K322 or P329 in the Fc region of a polypeptide or an antibody having a first mutation, where the first mutation enhances Fc-Fc interactions and thus enhanced oligomerization upon target binding, the second mutation was able to reduce Fc effector functions.
- the mutation corresponding to amino acid position K322 or P329 in the Fc region of a polypeptide or an antibody has the effect of reducing one or more Fc effector functions to a level that is decreased compared to a parent polypeptide or parent antibody having the identical first mutation, but not the second mutation.
- the polypeptide or antibody has at least one first mutation which may be selected from one of the following positions E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, and the polypeptide or antibody has at least one second mutation which may be selected from one of the following positions K322 or P329.
- the first mutation is selected from the group consisting of: E430G, E345K, E430S, E430F, E430T, E345Q, E345R, E345Y, S440W and S440Y. In one embodiment of the present invention, the first mutation is selected from E430G or E345K. In a preferred embodiment the first mutation is E430G.
- the second mutation is selected from the group consisting of: K322E, K322D, K322N, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, P329A and P329Y.
- the second mutation is at amino acid position P329, with the proviso that the second mutation is not P329A.
- the second mutation is at amino acid position P329, with the proviso that the second mutation is not P329A or P329G.
- the Fc region does not comprise a mutation in the amino acid positions corresponding to L234 and L235. That is, in one embodiment of the present invention the Fc region comprises the wild type amino acids L and L in the positons corresponding to L234 and L235 in human IgGl, wherein the positions are according to EU numbering.
- the present invention relates to a method of decreasing an Fc effector function of a polypeptide or antibody comprising an Fc region of a human IgG and an antigen binding region, wherein the Fc region comprises a CH2 and CH3 domain with a (i) first mutation corresponding to the following amino acid positions in human IgGl according to EU numbering : E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, which method comprises introducing a (ii) second mutation corresponding to the following amino acid positions in human IgGl according to EU numbering : K322 or P329.
- the inventors of the present invention found that by introducing a second mutation in one of the amino acid positions corresponding to K322 or P329 of a polypeptide or antibody having a first mutation corresponding to one of the amino acid positions E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, which leads to enhanced oligomerization upon target binding on a cell surface and enhanced Fc effector functions, one or more of the effector functions could be decreased .
- the second mutation may decrease the Fc effector function of a polypeptide or antibody to a level that is comparable to, or less than, the level of a parent polypeptide with a first mutation at a position corresponding to E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W.
- the present invention relates to a composition comprising at least one polypeptide or antibody as described herein.
- the present invention relates to a polypeptide, antibody or a composition as described herein for use as a medicament.
- the present invention relates to a polypeptide, antibody or a composition as described herein for use in the treatment of cancer, autoimmune disease, inflammatory disease or infectious disease.
- the present invention relates to a method of treating an individual having a disease comprising administering to said individual an effective amount of a polypeptide, an antibody or composition as described herein.
- Figure 1 shows the effect of Clq binding inhibition mutations (D270A/K322A indicated as AA) in the Fc domain of IgGl on the CDC efficacy of IgG-005 variants with and without mutation(s) for enhanced Fc-Fc interactions (E430G indicated as G; E345R indicated as R, E345R/E430G/S440Y indicated as RGY).
- CD38-positive Daudi cells were incubated with concentration series of CD38 (mutant) antibody in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- the IgGl-bl2 mAb against HIV gpl20, and mutants thereof were used as a non-binding isotype control mAb. Representative examples are shown .
- Figure 2 shows the effect of the single amino acid substitutions in the human IgGl Clq binding site on the CDC efficacy of IgG-005 variants with the E430G mutation for enhanced Fc-Fc interactions.
- A For the CDC assay, Daudi cells were incubated with a concentration series of IgGl-005-E430G with the D270R, K322E, P329D or P329R mutation in the presence of 20% pooled NHS.
- CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- Pl propidium iodide
- Binding of Clq to cell-bound IgGl-005-E430G antibodies with the K322E, P329D or P329R mutation was analyzed by flowcytometric analysis on FACS and represented by the mean fluorescence intensity (MFI) of FITC-labelled rabbit-anti-HuClq antibody.
- Figure 3 shows the effect of substituting amino acid K322 on the CDC efficacy of IgG-005-E430G with enhanced Fc-Fc interactions.
- Daudi cells were incubated with a concentration series of the CD38 antibody variants in the presence of 20% pooled NHS.
- CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- Antibody IgGl-bl2-E430G against HIV gpl20 was used as a non-binding isotype control with Fc-Fc enhancing mutation.
- Figure 4 shows the biophysical characterization of IgGl-005-E430G antibody variants with the additional mutation K322D, K322E or K322N by capillary electrophoresis sodium dodecyl sulfate (CE-SDS) in (A) and high-performance size exclusion chromatography (HP-SEC) in (B).
- CE-SDS capillary electrophoresis sodium dodecyl sulfate
- HP-SEC high-performance size exclusion chromatography
- Figure 5 shows the effect of substituting amino acid P329 on the CDC efficacy of IgG-005-E430G with enhanced Fc-Fc interactions.
- Daudi cells were incubated with a concentration series of the CD38 antibodies in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- Antibody IgGl-b l2-E430G against HIV gpl20 was used as a non-binding isotype control with Fc-Fc enhancing mutation.
- Figure 6 shows the effect of substituting amino acid P329 on FcyRIIIa activation by IgG-005-E430G with enhanced Fc-Fc interactions as determined in a Bioluminescent ADCC Reporter BioAssay.
- FcyRIIIa activation by antibodies bound to Daudi cells was quantified using FcyRIIIa-expressing Jurkat reporter cells that express luciferase upon FcyRIIIa binding.
- the production of luciferase is presented by relative luminescence units (RLU). For each data point, the mean and standard deviation of duplicates is presented. A representative example of two experiments is shown.
- FIG. 7 shows the effect of mutations K322E, P329A, P329D, P329K and P329R on the ADCC-mediated killing by IgGl-005-E430G.
- ADCC of Daudi cells was determined in an in vitro 51 Cr-release assay with freshly isolated PBMC from healthy human donors at an E:T ratio 100: 1.
- Antibody IgGl-bl2 against HIV gpl20 was used as a non-binding isotype control. For each data point, the mean and standard deviation of 5 replicate samples is presented. A representative example with PBMC of one donor is shown.
- Figure 8 shows the effect of introducing the P329D mutation on Clq binding or the CDC efficacy of different variants of IgG-005 with enhanced Fc-Fc interactions (E345K, E345R and E345R/E430G/S440Y indicated as RGY).
- E345K, E345R and E345R/E430G/S440Y indicated as RGY.
- Clq binding to cell- bound antibodies was analyzed by flow cytometric analysis on FACS and represented by the mean fluorescence intensity (MFI) of FITC-labelled rabbit-anti-HuClq antibody.
- MFI mean fluorescence intensity
- An in vitro CDC assay on Daudi cells was performed in the presence of 20% pooled normal human serum (NHS). CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- FIG. 9 shows the biophysical characterization of IgGl-005-RGY antibody variants with the additional mutation K322E or P329D by HP-SEC in (A), CE-SDS in (B) and native MS in (C).
- Figure 10 shows the effect of the P329D and K322E mutation on Fc-Fc interactions and clustering of saturating concentrations of agonistic DR5 antibodies with the E430G mutation for enhanced Fc-Fc interactions.
- A The involvement of Fc-Fc interactions in the induction of apoptosis by agonistic DR5 antibodies with the E430G mutation is shown in a 3-days viability assay on BxPC-3 human cancer cells with inhibition of killing in the presence of the Fc-binding peptide DCAWHLGELVWCT.
- Figure 11 shows the clearance rate of 500 ⁇ g i.v. administered antibody in SCID mice.
- A Total human IgG in serum samples was determined by ELISA and plotted in a concentration versus time curve. Each data point represents the mean +/- standard deviation of triplicate samples.
- B Clearance until day 21 after administration of the antibody was determined following the formula D*1.000/AUC with D, injected dose and AUC, area under the curve of the concentration-time curve. A representative example of two independent ELISA experiments is shown.
- Figure 12 shows the effect of substituting amino acid P329 on the CDC efficacy of IgGl-005-E430G with enhanced Fc-Fc interactions.
- Daudi cells were incubated with a concentration series of the CD38 antibodies in the presence of 20% pooled normal human serum (NHS). CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- Antibody IgGl-bl2 against HIV gpl20 was used as a non-binding isotype control.
- Figure 13 shows the effect of substituting amino acid P329 on the CDC efficacy of different IgG isotype variants of Campath-E430G with enhanced Fc-Fc interactions.
- Wien 133 cells were incubated with a concentration series of the CD52 antibodies in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as the area under dose-response curves, normalized relative to non-binding control antibody IgGl-bl2 (0%) and IgGl-Campath (100%).
- Figure 14 shows the effect of substituting amino acid K322 on the CDC efficacy of IgG isotype variants of Campath-E430G with enhanced Fc-Fc interactions.
- Wien 133 cells were incubated with a concentration series of the CD52 antibodies in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as the area under dose-response curves, normalized relative to non-binding control antibody IgGl-bl2 (0%) and IgGl-Campath (100%).
- Figure 15 shows the effect of substituting amino acid P329 (top) or K322 (bottom) on the CDC efficacy of IgGl-Campath variants with different Fc-Fc interaction enhancing mutations.
- Wien 133 cells were incubated with a concentration series of the CD52 antibodies in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as the area under dose-response curves, normalized relative to non-binding control antibody IgGl-bl2 (0%) and IgGl-Campath ( 100%).
- Figure 16 shows the effect of substituting amino acid K322 or P329 on the CDC efficacy of anti-CD20 antibodies with enhanced Fc-Fc interactions.
- Wien 133 cells were incubated with a concentration series of the CD20 antibodies in the presence of 20% pooled normal human serum (NHS). CDC efficacy is presented as the percentage lysis determined by the percentage propidium iodide (Pl)-positive cells.
- Antibody IgGl-b l2 was used as a non-binding isotype control.
- Figure 17 shows the effect of substituting amino acid K322 or P329 on the FcyR binding of anti-CD38 IgGl-005 antibodies with E430G-enhanced Fc-Fc interactions measured by ELISA.
- a concentration series of the indicated antibodies was captured on the wells of a microtiter plate and incubated with a fixed concentration FcyRIIA, FcyRIIB or FcyRIII, or added to wells coated with FcyRI.
- Variants P329D-E430G, P329K-E430G and P329R-E430G reduced FcyRI binding to background levels; K322E-E430G retained binding to all tested FcyR variants similar to wild type (WT) IgGl-005.
- Figure 18 shows the effect of substituting amino acid P329 on the CDC efficacy of IgGl-Campath or IgGl-l lB8 variants with an Fc-Fc interaction enhancing mutation.
- Wien 133 cells were incubated with a concentration series of mixtures of CD20 and CD52 antibodies in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as (top panel) percentage lysis determined by the percentage propidium iodide (Pl)-positive cells and (bottom panel) the area under the dose response-response curves, normalized relative to non-binding control antibody IgGl- bl2 (0%) and the mixture of IgGl-Campath-E430G + IgGl-l lB8-E430G (100%).
- Figure 19 shows the effect of substituting amino acid K322 on the CDC efficacy of IgGl-Campath or IgGl-l lB8 variants with an Fc-Fc interaction enhancing mutation.
- Wien 133 cells were incubated with a concentration series of mixtures of CD20 and CD52 antibodies in the presence of 20% pooled normal human serum (NHS).
- NHS pooled normal human serum
- CDC efficacy is presented as (top panel) percentage lysis determined by the percentage propidium iodide (Pl)-positive cells and (bottom panel) the area under the dose response-response curves, normalized relative to non-binding control antibody IgGl- bl2 (0%) and the mixture of IgGl-Campath-E430G + IgGl-l lB8-E430G (100%).
- Figure 20 shows the effect of substituting amino acids K322, K439, and S440 on CDC efficacy by IgGl-Campath or IgGl-l lB8 variants with an Fc-Fc interaction enhancing mutation.
- Daudi, Raji, Ramos, REH, U266B1, U-698-M, and Wien 133 cells were incubated with 30.0 ⁇ / ⁇ of CD20 and CD52 antibodies as single agents or mixtures in the presence of 20% pooled normal human serum (NHS).
- CDC efficacy is presented as percentage lysis determined by the percentage propidium iodide (PI)- positive cells normalized relative to non-binding control antibody IgG l-bl2 (0%) and either IgG l-Campath-E430G ( 100%, for REH, U266B1, and Wien 133 cells) or IgG l- 11B8-E430G ( 100%, for Daudi, Raji, Ramos, and U-698-M cells) depending on which antibody induced the h ighest lysis.
- PI propidium iodide
- Figure 21 shows the effect of substituting amino acid K322 or P329 on the relative OX40 response of IgG l-SF2 variants with Fc-Fc-enhancing mutation E345R.
- Thaw- and-Use GloResponse NFKB- IUC2/OX40 Jurkat cells were incubated for 5 hours with 2.5 ⁇ g/mL antibody in the presence of 5% serum (final) from different sources.
- OX40 assay responses were recorded by luminescence detected after stimulation of OX40 by anti-OX40 antibodies or 1.5 ⁇ g/mL OX40 ligand, which induce the expression of a luciferase reporter gene.
- Luminescence signals were normalized relative to the responses measured for control incubations without antibody (0%) and with OX40 ligand ( 100%) .
- FBS fetal bovine serum
- NHS normal human serum
- WT wild type IgG l-SF2 reference antibody.
- Figure 22 Sequence alignment of the human IgGl, IgG lf, IgG2, IgG3, IgG4, IgAl, IgA2, IgD, IgE and IgM Fc segments corresponding to residues P247 to K447 in the IgGl heavy chain, using Clustal 2.1 software, as numbered by the EU numbering as set forth in Kabat.
- the sequences shown represent residues 130 to 330 of the human IgGl heavy chain constant region (SEQ ID NO : l ; UniProt accession No.
- parent polypeptide or "parent antibody” is to be understood as a polypeptide or antibody, which is identical to a polypeptide or antibody according to the invention, but where the parent polypeptide or parent antibody has a first mutation which is an Fc-Fc enhancing mutation e.g . in position E345, E430 or S440 and as a result thereof increased Fc-Fc-mediated oligomerization, increased Fc effector function such as CDC and may also have other enhanced effector functions.
- Fc-Fc enhancing mutation e.g . in position E345, E430 or S440
- Fc effector function such as CDC and may also have other enhanced effector functions.
- polypeptide comprising an Fc-region of an immunoglobulin and a binding region refers in the context of the present invention to a polypeptide which comprises an Fc-region of an immunoglobulin and a binding region which is capable of binding to any molecule, such as a polypeptide, e.g. present on a cell, bacterium, or virion.
- the Fc-region of an immunoglobulin is defined as the fragment of an antibody which would be typically generated after digestion of an antibody with papain (which is known for someone skilled in the art) which includes the two CH2- CH3 regions of an immunoglobulin and a connecting region, e.g. a hinge region.
- the constant domain of an antibody heavy chain defines the antibody isotype, e.g.
- the Fc-region mediates the effector functions of antibodies with cell surface receptors called Fc receptors and proteins of the complement system.
- the binding region may be a polypeptide sequence, such as a protein, protein ligand, receptor, an antigen-binding region, or a ligand-binding region capable of binding to a cell, bacterium, or virion. If the binding region is e.g.
- the "polypeptide comprising an Fc-region of an immunoglobulin and a binding region” may have been prepared as a fusion protein of Fc-region of an immunoglobulin and said binding region.
- the binding region is an antigen-binding region
- the "polypeptide comprising an Fc-domain of an immunoglobulin and a binding region” may be an antibody, like a chimeric, humanized, or human antibody or a heavy chain only antibody or a ScFv-Fc-fusion.
- the polypeptide comprising an Fc-region of an immunoglobulin and a binding region may typically comprise a connecting region, e.g.
- the "polypeptide comprising a Fc-region of an immunoglobulin and a binding region” may be a "polypeptide comprising at least an Fc-region of an immunoglobulin and a binding region".
- the term "Fc-region of an immunoglobulin” means in the context of the present invention that a connecting region, e.g . hinge depending on the subtype of antibody, and the CH2 and CH3 region of an immunoglobulin are present, e.g. a human IgGl, IgG2, IgG3, IgG4, IgD, IgAl, IgGA2, IgM, or IgE.
- the polypeptide is not limited to human origin but can be of any origin, such as e.g. mouse or cynomolgus origin.
- Fc-region Fc region
- Fc-domain Fc domain
- Fc domain Fc domain
- parent polypeptide or “parent antibody”
- parent polypeptide is to be understood as a polypeptide or antibody, which is identical to a polypeptide or antibody according to the invention, but where the parent polypeptide or parent antibody is without a second mutation, but does have a first mutation which is an Fc-Fc enhancing mutation e.g.
- parent polypeptide or parent antibody refers to a polypeptide or antibody with a first Fc-Fc enhancing mutation, but not a second mutation decreasing Fc effector function(s).
- a polypeptide or antibody accordingly comprises one or more mutations as compared to a "parent polypeptide” or a "parent antibody”.
- hinge region as used herein is intended to refer to the hinge region of an immunoglobulin heavy chain.
- the hinge region of a human IgGl antibody corresponds to amino acids 216-230 according to the EU numbering.
- CH2 region or "CH2 domain” as used herein is intended to refer the CH2 region of an immunoglobulin heavy chain.
- CH2 region of a human IgGl antibody corresponds to amino acids 231-340 according to the EU numbering.
- the CH2 region may also be any of the other subtypes as described herein.
- CH3 region or "CH3 domain” as used herein is intended to refer the CH3 region of an immunoglobulin heavy chain.
- the CH3 region of a human IgGl antibody corresponds to amino acids 341-447 according to the EU numbering.
- the CH3 region may also be any of the other subtypes as described herein.
- immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four potentially interconnected by disulfide bonds.
- L light
- H heavy
- each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- VH heavy chain variable region
- the heavy chain constant region typically is comprised of three domains, CH I, CH2, and CH3.
- Each light chain typically is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region typically is comprised of one domain, CL.
- the VH and VL regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
- CDRs complementarity determining regions
- Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J . Mol. Biol. 196, 901 917 (1987)).
- FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 see also Chothia and Lesk J . Mol. Biol. 196, 901 917 (1987).
- reference to amino acid positions in the constant region in the present invention is according to the EU-numbering (Edelman et al., Proc Natl Acad Sci U S A. 1969 May;63( l) :78-85; Kabat et al., Sequences of proteins of immunological interest. 5th Edition - 1991 NIH Publication No. 91-3242).
- antibody in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen.
- the antibody of the present invention comprises an Fc-domain of an immunoglobulin and an antigen-binding region.
- An antibody generally contains two CH2-CH3 regions and a connecting region, e.g. a hinge region, e.g. at least an Fc-domain.
- the antibody of the present invention may comprise an Fc region and an antigen-binding region.
- the variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
- the constant or "Fc” regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as Clq, the first component in the classical pathway of complement activation.
- An antibody may also be a multispecific antibody, such as a bispecific antibody or similar molecule.
- the term "bispecific antibody” refers to an antibody having specificities for at least two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.
- antibody herein includes fragments of an antibody which comprise at least a portion of an Fc-region and which retain the ability to specifically bind to the antigen. Such fragments may be provided by any known technique, such as enzymatic cleavage, peptide synthesis and recombinant expression techniques. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term "Ab” or “antibody” include, without limitation, monovalent antibodies (described in WO2007059782 by Genmab); heavy- chain antibodies, consisting only of two heavy chains and naturally occurring in e.g.
- antibody also includes polyclonal antibodies, monoclonal antibodies (such as human monoclonal antibodies), antibody mixtures (recombinant polyclonals) for instance generated by technologies exploited by Symphogen and Merus (Oligoclonics), multimeric Fc proteins as described in WO2015/158867, fusion proteins as described in WO2014/031646 and antibody-like polypeptides, such as chimeric antibodies and humanized antibodies.
- An antibody as generated can potentially possess any isotype.
- full-length antibody when used herein, refers to an antibody which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype.
- human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies of the invent2ion may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g ., mutations, insertions or deletions introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- chimeric antibody refers to an antibody in which both chain types are chimeric as a result of antibody engineering.
- a chimeric chain is a chain that contains a foreign variable domain (originating from a non-human species, or synthetic or engineered from any species including human) linked to a constant region of human origin.
- the variable domain of a chimeric chain has a V region amino acid sequence which, analyzed as a whole, is closer to non-human species than to human.
- humanized antibody refers to an antibody in which both chain types are humanized as a result of antibody engineering.
- a humanized chain is typically a chain in which the complementarity determining regions (CDR) of the variable domains are foreign (originating from one species other than human, or synthetic) whereas the remainder of the chain is of human origin. Humanization assessment is based on the resulting amino acid sequence, and not on the methodology per se, which allows protocols other than grafting to be used.
- the variable domain of a humanized chain has a V region amino acid sequence which, analyzed as a whole, is closer to human than to other species.
- monoclonal antibody refers to a preparation of Ab molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to Abs displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
- the human mAbs may be generated by a hybridoma which includes a B cell obtained from a transgenic or trans-chromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene repertoire and a light chain transgene repertoire, rearranged to produce a functional human antibody and fused to an immortalized cell.
- isotype refers to the immunoglobulin class (for instance IgGl, IgG2, IgG3, IgG4, IgD, IgAl, IgGA2, IgE, or IgM or any allotypes thereof such as IgGlm(za) and IgGlm(f)) that is encoded by heavy chain constant region genes. Further, each heavy chain isotype can be combined with either a kappa ( ⁇ ) or lambda ( ⁇ ) light chain.
- mixed isotype used herein refers to Fc region of an immunoglobulin generated by combining structural features of one isotype with the analogous region from another isotype thereby generating a hybrid isotype.
- a mixed isotype may comprise an Fc region having a sequence comprised of two or more isotypes selected from the following IgGl, IgG2, IgG3, IgG4, IgD, IgAl, IgGA2, IgE, or IgM thereby generating combinations such as e.g. IgGl/IgG3, IgGl/IgG4, IgG2/IgG3, IgG2/IgG4 or IgGl/IgA.
- antigen binding region refers to a region of an antibody which is capable of binding to the antigen. This binding region is typically defined by the VH and VL domains of the antibody which may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
- the antigen can be any molecule, such as a polypeptide, e.g. present on a cell, bacterium, or virion.
- target refers to a molecule to which the antigen binding region of the antibody binds.
- the target includes any antigen towards which the raised antibody is directed.
- antigen and target may in relation to an antibody be used interchangeably and constitute the same meaning and purpose with respect to any aspect or embodiment of the present invention.
- epitope means a protein determinant capable of specific binding to an antibody variable domain .
- Epitopes usually consist of surface groupings of molecules such as amino acids, sugar side chains or a combination thereof and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- the epitope may comprise amino acid residues directly involved in the binding (also called immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding.
- antibody variant or “variant of a parent antibody” of the present invention is an antibody molecule which comprises one or more mutations as compared to a "parent antibody”.
- the different terms may be used interchangeably and constitute the same meaning and purpose with respect to any aspect or embodiment of the present invention..
- a variant of a polypeptide comprising an Fc-region of an immunoglobulin and a binding region or "a variant of a parent polypeptide comprising an Fc-region of an immunoglobulin and a binding region” of the present invention is a "polypeptide comprising an Fc-region of an immunoglobulin and a binding region", which comprises one or more mutations as compared to a "parent polypeptide comprising an Fc-region of an immunoglobulin and a binding region".
- the different terms may be used interchangeably and constitute the same meaning and purpose with respect to any aspect or embodiment of the present invention.
- Exemplary mutations include amino acid deletions, insertions, and substitutions of amino acids in the parent amino acid sequence.
- Amino acid substitutions may exchange a native amino acid for another naturally- occurring amino acid, or for a non-naturally-occurring amino acid derivative.
- the amino acid substitution may be conservative or non-conservative.
- conservative substitutions may be defined by substitutions within the classes of amino acids reflected in one or more of the following three tables:
- Residues involved in turn formation A, C, D, E, G, H, K, N, Q, R, S, P, and T
- the three letter code, or one letter code, are used, including the codes Xaa and X to indicate amino acid residue. Accordingly, the notation "E345R” or “Glu345Arg” means, that the variant comprises a substitution of Glutamic acid with Arginine in the variant amino acid position corresponding to the amino acid in position 345 in the parent antibody.
- the variant comprises an insertion of an amino acid, for example:
- the substitution of Glutamic acid for Arginine, Lysine or Tryptophan in position 345 the substitution of Glutamic acid for Arginine, Lysine or Tryptophan in position 345 :
- Glu345Arg, Lys,Trp or "E345R,K,W” or “E345R/K/W” or “E345 to R, K or W” may be used interchangeably in the context of the invention.
- a substitution embraces a substitution into any one of the other nineteen natural amino acids, or into other amino acids, such as non- natural amino acids.
- a substitution of amino acid E in position 345 includes each of the following substitutions: 345A, 345C, 345D, 345G, 345H, 345F, 3451, 345K, 345L, 345M, 345N, 345P, 345Q, 345R, 345S, 345T, 345V, 345W, and 345Y. This is equivalent to the designation 345X, wherein the X designates any amino acid.
- substitutions can also be designated E345A, E345C, etc, or E345A,C,etc, or E345A/C/etc.
- effector cell refers to an immune cell which is involved in the effector phase of an immune response, as opposed to the recognition and activation phases of an immune response.
- exemplary immune cells include a cell of a myeloid or lymphoid origin, for instance lymphocytes (such as B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, polymorphonuclear cells, such as neutrophils, granulocytes, mast cells, and basophils.
- lymphocytes such as B cells and T cells including cytolytic T cells (CTLs)
- killer cells such as B cells and T cells including cytolytic T cells (CTLs)
- killer cells such as B cells and T cells including cytolytic T cells (CTLs)
- killer cells such as B cells and T cells including cytolytic T cells (CTLs)
- killer cells such as B cells and T cells including cytolytic T cells (CTLs)
- killer cells such as B
- an effector cell such as, e.g., a natural killer cell, is capable of inducing ADCC.
- ADCC e.g., monocytes, macrophages, neutrophils, dendritic cells and Kupffer cells which express FcRs, are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens.
- the ADCC can be further enhanced by antibody driven classical complement activation resulting in the deposition of activated C3 fragments on the target cell.
- C3 cleavage products are ligands to complement receptors (CRs), such as CR3, expressed on myeloid cells. The recognition of complement fragments by CRs on effector cells may promote enhanced Fc receptor-mediated ADCC.
- CRs complement receptors
- antibody driven classical complement activation leads to C3 fragments on the target cell. These C3 cleavage products may promote direct complement-dependent cellular cytotoxicity (CDCC).
- an effector cell may phagocytose a target antigen, target particle or target cell.
- the expression of a particular FcR or complement receptor on an effector cell may be regulated by humoral factors such as cytokines.
- cytokines For example, expression of FcyRI has been found to be up-regulated by interferon y (IFN y) and/or G-CSF. This enhanced expression increases the cytotoxic activity of FcyRI-bearing cells against targets.
- An effector cell can phagocytose a target antigen or phagocytose or lyse a target cell.
- antibody driven classical complement activation leads to C3 fragments on the target cell. These C3 cleavage products may promote direct phagocytosis by effector cells or indirectly by enhancing antibody mediated phagocytosis.
- Fc effector functions is intended to refer to functions that are a consequence of binding a polypeptide or antibody to its target, such as an antigen, on a cell membrane wherein the Fc effector function is attributable to the Fc region of the polypeptide or antibody.
- Fc effector functions include (i) Clq-binding, (ii) complement activation, (iii) complement- dependent cytotoxicity (CDC), (iv) antibody-dependent cell-mediated cytotoxity (ADCC), (v) Fc-gamma receptor-binding, (vi) antibody-dependent cellular phagocytosis (ADCP), (vii) complement-dependent cellular cytotoxicity (CDCC), (viii) complement-enhanced cytotoxicity, (ix) binding to complement receptor of an opsonized antibody mediated by the antibody, (x) opsonisation, and (xi) a combination of any of (i) to (x) .
- decreased Fc effector function(s) is intended to refer to an Fc effector function that is decreased for a polypeptide or an antibody when directly compared to the Fc effector function of the parent polypeptide or antibody in the same assay.
- clustering-dependent functions is intended to refer to functions that are a consequence of the formation of antigen complexes after oligomerization of polypeptides or antibodies bound to their antigens, optionally on a cell, on a cell membrane, on a virion, or on another particle.
- clustering-dependent effector functions include (i) antibody oligomer formation, (ii) antibody oligomer stability, (iii) antigen oligomer formation, (iv) antigen oligomer stability, (v) induction of apoptosis, (vi) proliferation modulation, such as proliferation reduction, inhibition or stimulation, (vii) modulation of signaling, such as protein phosphorylation reduction, inhibition or stimulation, and (viii) a combination of any of (i) to (vii).
- vector is intended to refer to a nucleic acid molecule capable of inducing transcription of a nucleic acid segment ligated into the vector.
- plasmid which is in the form of a circular double stranded DNA loop.
- viral vector Another type of vector is a viral vector, wherein the nucleic acid segment may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (for instance bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors such as non-episomal mammalian vectors
- Other vectors may be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, “expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the present invention is intended to include such other forms of expression vectors, such as viral vectors (such as replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- Recombinant host cell (or simply "host cell”), as used herein, is intended to refer to a cell into which an expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell, but also to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- Recombinant host cells include, for example, transfectomas, such as CHO cells, HEK-293 cells, PER.C6, NSO cells, and lymphocytic cells, and prokaryotic cells such as E. coli and other eukaryotic hosts such as plant cells and fungi.
- transfectoma includes recombinant eukaryotic host cells expressing the Ab or a target antigen, such as CHO cells, PER.C6, NSO cells, HEK-293 cells, plant cells, or fungi, including yeast cells.
- preparation refers to preparations of antibody variants and mixtures of different antibody variants which can have an increased ability to form oligomers when interacting with antigen associated with a cell (e.g ., an antigen expressed on the surface of the cell), a cell membrane, a virion or other structure, which may result in enhanced signaling and/or activation by the antigen.
- a cell e.g ., an antigen expressed on the surface of the cell
- a cell membrane e.g ., a cell membrane, a virion or other structure, which may result in enhanced signaling and/or activation by the antigen.
- the term "affinity" is the strength of binding of one molecule, e.g. an antibody, to another, e.g. a target or antigen, at a single site, such as the monovalent binding of an individual antigen binding site of an antibody to an antigen.
- the term “avidity” refers to the combined strength of multiple binding sites between two structures, such as between multiple antigen binding sites of antibodies simultaneously interacting with a target or e.g. between antibody and Clq.
- the two structures When more than one binding interactions are present, the two structures will only dissociate when all binding sites dissociate, and thus, the dissociation rate will be slower than for the individual binding sites, and thereby providing a greater effective total binding strength (avidity) compared to the strength of binding of the individual binding sites (affinity).
- oligomer refers to a molecule that consists of more than one but a limited number of monomer units (e.g . antibodies) in contrast to a polymer that, at least in principle, consists of an unlimited number of monomers.
- exemplary oligomers are dimers, trimers, tetramers, pentamers and hexamers. Greek prefixes are often used to designate the number of monomer units in the oligomer, for example a tetramer being composed of four units and a hexamer of six units.
- oligomerization is intended to refer to a process that converts monomers to a finite degree of polymerization.
- polypeptides, antibodies and/or other dimeric proteins comprising target- binding regions according to the invention can form oligomers, such as hexamers, via non-covalent association of Fc-regions after target binding, e.g., at a cell surface.
- the oligomerization of antibodies can be evaluated for example in a cell viability assay using anti-DR5 antibodies containing an Fc-Fc enhancing mutation such as E430G or E345R (as described in Examples 13).
- Fc-Fc-mediated oligomerization of polypeptides or antibodies occurs after target binding on a (cell) surface through the intermolecular association of Fc-regions between neighboring polypeptides or antibodies and is increased by introduction of a first mutation in an amino acid corresponding to E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W.
- the formation of Fc-Fc-mediated oligomerization upon target binding on a (cell) surface may be determined in an assay using the following peptide DCAWHLGELVWCT, which blocks Fc-Fc interactions.
- the induction of oligomerization can be assessed by comparing the response of the following groups in an assay; group I) an antibody with a wild type Fc-region, group II) an antibody which is identical to the antibody in group I) except that it comprises a first mutation according to the invention e.g. E430G, group III) the DCAWHLGELVWCT peptide in combination with an antibody which is identical to the antibody in Group I) except that it comprises a first mutation according to the invention e.g. E430G, group IV) an antibody which is identical to the antibody in group I) except that it comprises a first mutation according to the invention e.g . E430G and a second mutation according to the invention e.g. P329D.
- a suitable assay for determining oligomerization may be a viability assay as described in Example 13.
- a viability assay may be performed on BxPC-3 cells in the presence of antibody according to the assay groups described above, i .e. group I, group II, group III and/or group IV.
- the BxPC-3 cells are incubated with 5 ⁇ g/mL or 10 ⁇ g/mL of antibody according to the assay groups described above for 3 days at 37°C.
- the percentage of viable cells may be determined in a CellTiter-Glo luminescent cell viability assay (Promega, Cat no G7571) .
- a suitable assay for determining oligomerization may be an NFAT reporter bioassay.
- An NFAT reporter bioassay may be performed using Jurkat NFAT reporter cells stably expressing the target antigen which is clear to the person skilled in the art, such as NFKB-IUC2/OX40 Jurkat cells that express a luciferase reporter gene under the control of N FAT response elements a nd have membrane expression of OX40, in the presence of the assay groups described above, i.e.
- the NFKB-IUC2/OX40 Jurkat cells are incubated with 1.5 or 5 ⁇ g/mL of antibody according to the assay groups described above for 1 day at 37 Q C.
- the luciferase expression induced by activation of OX40 may be determined by measuring luminescence signal .
- the term "clustering”, as used herein, is intended to refer to oligomerization of antibodies, polypeptides, antigens or other proteins through non-covalent interactions.
- Fc-Fc enhancing is intended to refer to increasing the binding strength between, or stabilizing the interaction between, the Fc regions of two Fc-region containing antibodies or polypeptides so that the polypeptides form oligomers upon target binding.
- Clq binding is intended to refer to the binding of Clq in the context of the binding of Clq to an antibody bound to its antigen.
- the antibody bound to its antigen is to be understood as happening both in vivo and in vitro in the context described herein.
- Clq binding can be evaluated for example by using antibody immobilized on artificial surfaces or by using antibody bound to a predetermined antigen on a cellular or virion surface (as described in Examples 3 and 11) .
- the binding of Clq to an antibody oligomer is to be understood herein as a multivalent interaction resulting in high avidity binding.
- a decrease in Clq binding may be measured by comparing the Clq binding of the polypeptide or antibody to the Clq binding of its parent polypeptide or antibody without the second mutation within the same assay, as exemplified in Example 3.
- cells of a suitable origin expressing the target antigen to which the antigen-binding region of the antibody binds may be used in this assay, such a cell line or cell type will be clear to the skilled person.
- cancer cells may be suitable in the present assay e.g . BxPC-3 human pancreatic cancer cells (ATCC CRL-1687).
- T cells may be suitable in the present assay e.g. Jurkat human T cells (ATCC TIB-152).
- Decreased Clq binding of antibodies according to the invention may be assessed by incubating the appropriate cells at a concentration of lxlO 6 mL in polystyrene round-bottom 96-well plates with i) a concentration series (0.0003-100 ⁇ g/mL) for an antibody comprising a first and a second mutation according to the invention in the presence of 20% C4-depleted serum; and ii) a concentration series (0.0003- 100 ⁇ g/mL) for a parent antibody comprising a first mutation, but not a second mutation, in the presence of 20% C4-depleted, serum, wherein the antibodies in i) and ii) are incubated with the appropriate cells for 30 min at 4°C, followed by incubating with a labeled anti-human Clq antibody e.g.
- Clq binding enzyme-linked immunosorbent assay by coating 96-well Microlon ELISA plates (Greiner, Cat no 655092) with i) a dilution series (0.001 - 20 of an antibody comprising a first and a second mutation according to the invention; and ii) a dilution series (0.001 - 20 g/mL) of an antibody comprising a first mutation, but not a second mutation, in 100 ⁇ _ PBS and incubating overnight at 4°C, followed by subsequent incubations, with washings in between, with 200 MLJwell 0.5x PBS supplemented with 0.025% Tween 20 and 0.1% gelatin for 1 hour at RT (blocking), 100 ⁇ _ 3% NHS (Sanquin, Ref.
- ELISA Clq binding enzyme-linked immunosorbent assay
- complement activation refers to the activation of the classical complement pathway, which is initiated by a large macromolecular complex called CI binding to antibody-antigen complexes on a surface.
- CI is a complex, which consists of 6 recognition proteins Clq and a hetero-tetramer of serine proteases, Clr2Cls2.
- CI is the first protein complex in the early events of the classical complement cascade that involves a series of cleavage reactions that starts with the cleavage of C4 into C4a and C4b and C2 into C2a and C2b.
- C4b is deposited and forms together with C2a an enzymatic active convertase called C3 convertase, which cleaves complement component C3 into C3b and C3a, which forms a C5 convertase
- C3 convertase cleaves complement component C3 into C3b and C3a
- C5 convertase This C5 convertase splits C5 in C5a and C5b and the last component is deposited on the membrane and that in turn triggers the late events of complement activation in which terminal complement components C5b, C6, C7, C8 and C9 assemble into the membrane attack complex (MAC).
- the complement cascade results in the creation of pores due to which causes cell lysis, also known as complement-dependent cytotoxicity (CDC).
- Complement activation can be evaluated by using Clq efficacy, CDC kinetics CDC assays (as described in WO2013/004842, WO2014/108198) or by the method Cellular deposition of C3b and C4b described in Beurskens et al April 1, 2012 vol. 188 no. 7 3532-3541.
- CDC complement-dependent cytotoxicity
- in vitro assay such as a CDC assay in which normal human serum is used as a complement source, as described in Example 2, 3, 4, and 6 or in a Clq concentration series.
- a decrease in CDC activity for example resulting from the introduction of a second mutation in a polypeptide or antibody, may be measured by comparing the CDC activity of the polypeptide or antibody to the CDC activity of its parent polypeptide or antibody without the second mutation within the same assay, as exemplified in Example 3 and 4.
- ADCC antibody-dependent cell-mediated cytotoxicity
- ADCC antibody-dependent cell-mediated cytotoxicity
- a decrease in ADCC activity for example resulting from the introduction of a second mutation in a polypeptide or antibody, may be measured by comparing the ADCC activity of the polypeptide or antibody to the ADCC activity of its parent polypeptide or antibody without the second mutation within the same assay, as exemplified in Example 10 and 9.
- ADCP antibody-dependent cellular phagocytosis
- the internalized antibody-coated target cells or virions are contained in a vesicle called a phagosome, which then fuses with one or more lysosomes to form a phagolysosome.
- ADCP may be evaluated by using an in vitro cytotoxicity assay with macrophages as effector cells and video microscopy as described by van Bij et al. in Journal of Hepatology Volume 53, Issue 4, October 2010, Pages 677-685.
- CDCC complement-dependent cellular cytotoxicity
- plasma half-life indicates the time it takes to reduce the concentration of polypeptide in the blood plasma to one half of its initial concentration during elimination (after the distribution phase).
- the distribution phase will typically be 1 - 3 days during which phase there is about 50% decrease in blood plasma concentration due to redistribution between plasma and tissues.
- the plasma half-life can be measured by methods well-known in the art.
- plasma clearance rate is a quantitative measure of the rate at which a polypeptide is removed from the blood upon administration to a living organism.
- the plasma clearance rate may be calculated as the dose/AUC (mL/day/kg), wherein the AUC value (area under the curve) is determined from a concentration-time curve.
- antibody-drug conjugate refers to an antibody or Fc-containing polypeptide having specificity for at least one type of malignant cell, a drug, and a linker coupling the drug to e.g. the antibody.
- the linker is cleavable or non-cleavable in the presence of the malignant cell; wherein the antibody-drug conjugate kills the malignant cell.
- antibody-drug conjugate uptake refers to the process in which antibody-drug conjugates are bound to a target on a cell followed by uptake/engulfment by the cell membrane and thereby are drawn into the cell.
- Antibody-drug conjugate uptake may be evaluated as "antibody-mediated internalization and cell killing by anti-TF ADC in an in vitro killing assay" as described in WO 2011/157741.
- apoptosis refers to the process of programmed cell death (PCD) that may occur in a cell. Biochemical events lead to characteristic cell changes (morphology) and death . These changes include blebbing, cell shrinkage, nuclear fragmentation, chromatin condensation, and chromosomal DNA fragmentation. Binding of an antibody to a certain receptor may induce apoptosis.
- PCD programmed cell death
- PCD programmed cell-death
- the occurrence of any form of PCD in a cell or tissue may be determined by staining the cell or tissue with conjugated Annexin V, correlating to phosphatidylserine exposure.
- Annexin V refers to a protein of the annexin group that binds phosphatidylserine (PS) on the cell surface.
- Fc-receptor binding may be indirectly measured as described in Example 9.
- Fc-receptor binding may be directly measured as described in Example 21.
- a decrease in Fc-receptor binding for example resulting from the introduction of a second mutation in a test antibody or polypeptide, can be measured by comparing the ADCC activity of the polypeptide or antibody to the ADCC activity of its parent polypeptide or antibody without that additional mutation within the same assay, as exemplified in Example 21.
- Fc-gamma receptor Fc-gamma receptor
- Fc-gammaR Fc-gammaR
- Fey receptor FcyR
- This class of receptors includes several family members, FcyRI (CD64), FcyRIIA (CD32), FcyRIIB (CD32), FcyRIIIA (CD16a), FcyRIIIB (CD16b), which differ in their antibody affinities due to their different molecular structure.
- FcyRI binds to IgG more strongly than FcyRII or FcyRIII does.
- FcRn neonatal Fc receptor which is an Fc receptor. It was first discovered in rodents as a unique receptor capable of transporting IgG from mother's milk across the epithelium of newborn rodent's gut into the newborn's bloodstream. Further studies revealed a similar receptor in humans. In humans, however, it is found in the placenta to help facilitate transport of mother's IgG to the growing fetus and it has also been shown to play a role in monitoring IgG turnover. FcRn binds IgG at acidic pH of 6.0-6.5 but not at neutral or higher pH.
- FcRn can bind IgG from the intestinal lumen (the inside of the gut) at a slightly acidic pH and ensure efficient unidirectional transport to the basolateral side (inside the body) where the pH is neutral to basic (pH 7.0- 7.5).
- This receptor also plays a role in adult salvage of IgG through its occurrence in the pathway of endocytosis in endothelial cells.
- FcRn receptors in the acidic endosomes bind to IgG internalized through pinocytosis, recycling it to the cell surface, releasing it at the basic pH of blood, thereby preventing it from undergoing lysosomal degradation. This mechanism may provide an explanation for the greater half-life of IgG in the blood compared to other isotypes.
- Protein A is intended to refer to a 56 kDa MSCRAMM surface protein originally found in the cell wall of the bacterium Staphylococcus aureus. It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two-component system called ArlS-ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins. It is composed of five homologous Ig-binding domains that fold into a three-helix bundle. Each domain is able to bind proteins from many of mammalian species, most notably IgGs.
- IgG molecules bind the bacteria via their Fc region instead of solely via their Fab regions, by which the bacteria disrupts opsonization, complement activation and phagocytosis.
- Protein G is intended to refer to an immunoglobulin-binding protein expressed in group C and G Streptococcal bacteria much like Protein A but with differing specificities. It is a 65-kDa (G148 protein G) and a 58 kDa (C40 protein G) cell surface protein that has found application in purifying antibodies through its binding to the Fc region.
- the present invention is based on the finding of a need for polypeptides and antibody therapeutics which has enhanced Fc-Fc interactions when bound to the corresponding antigen on the surface of a target cell and which thus forms oligomers upon binding to the antigen, but which do not have the enhanced Fc effector functions such as CDC and/or ADCC, which is normally found for polypeptides and antibodies which forms oligomers such as hexamers upon binding.
- the inventors found that by introducing a second mutation corresponding to the following amino acid positions K322 or P329 in the Fc region of a polypeptide or antibody having a first mutation corresponding to one of the following amino acid positions E430, E345 or S440, the enhanced Fc-Fc interactions could be maintained while the Fc effector functions, such as CDC and/or ADCC were decreased compared to a parent of the same polypeptide or antibody only having the first mutation and without a second mutation. In some embodiments one or more effector functions may even be decreased to a level below what is found for a wild type polypeptide or antibody, i.e. without the first and second mutation, but otherwise identical.
- the introduction of a second mutation reduced the Fc effector functions to a level that is comparable to, or less than, the level found in a wild type polypeptide or antibody. In some embodiments, the introduction of a second mutation reduced the Fc effector functions to a level that is comparable to, or less than, the level found for an identical antibody or polypeptide only having the first mutation, i.e. a parent polypeptide or antibody.
- the present invention provides for a polypeptide or an antibody comprising an Fc region of a human IgG and an antigen binding region, wherein the Fc region comprises a CH2 and CH3 domain, said Fc region comprises, a (i) first mutation and a (ii) second mutation corresponding to the following amino acid positions in human IgGl according to EU numbering :
- the first mutation according to the invention which is in one of the following amino acid positions E430, E345 or S440 introduces the effect of enhanced Fc-Fc interactions and oligomerization in the polypeptide or antibody.
- the enhanced oligomerization occurs when the antigen binding region of the polypeptide or antibody is bound to the corresponding target antigen.
- the enhanced oligomerization generates oligomers, such as e.g. hexamers.
- the generation of oligomeric structures, such as hexamers has the effect of increasing Fc effector functions, such as e.g. CDC and/or ADCC, by increasing Clq binding avidity of the polypeptide or antibody.
- the second mutation according to the invention which is in one of the following amino acid positions; K322 or P329 introduces the effect of decreased Fc effector functions in the polypeptide or antibody.
- decreased Fc effector functions may for instance be decreased Clq binding or CDC activity.
- the second mutation is able to counteract the enhanced Fc effector function introduced by the first mutation and thereby generate a polypeptide or antibody having enhanced Fc-Fc interactions and oligomerization, but not having increased Fc effector functions. That is, the Fc effector function is decreased compared to a polypeptide or antibody having the first mutation but not having the second mutation.
- the introduction of the first and second mutation may increase the level of oligomerization, while decreasing the level of CDC to a level that is less than that found for the wild type polypeptide or antibody.
- Polypeptides or antibodies according to the present invention are of a particular advantage when Fc effector functions are undesirably e.g . when activating an effector cell.
- the Fc region does not comprise a mutation in the amino acid positions corresponding to L234 and L235. That is, in one embodiment of the present invention the Fc region comprises the wild type amino acids L and L in the positons corresponding to L234 and L235 in human IgGl, wherein the positions are according to EU numbering.
- the Fc region comprises a first and a second mutation, with the proviso that the Fc region comprises L and L in the positions corresponding to L234 and L235.
- the first mutation is selected from the group consisting of: E430G, E345K, E430S, E430F, E430T, E345Q, E345R, E345Y, S440W and S440Y.
- the first mutation is selected from E430G or E345K.
- the polypeptide comprises at least one mutation which is an Fc-Fc enhancing mutation and at least one mutation which decreases an Fc effector function. That is in one embodiment of the invention the polypeptide comprises at least one i) first mutation at an amino acid position corresponding to E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, and at least one ii) second mutation at an amino acid position corresponding to K322 or P329.
- the polypeptides or antibodies comprise an Fc region comprising a first heavy chain and a second heavy chain, wherein one of the above mentioned first mutations may be present in the first and/or the second heavy chain.
- the polypeptides or antibodies comprise an Fc region comprising a first heavy chain and a second heavy chain, wherein the first mutation is present in both the first and second heavy chain.
- the polypeptides or antibodies comprise an Fc region comprising a first heavy chain and a second heavy chain, wherein the first mutation and second mutation is present in both the first and second heavy chain .
- the polypeptides or antibodies comprise an Fc region comprising a first heavy chain and a second heavy chain, wherein the first mutation is present in the first and second heavy chain and the second mutation is present in both the first and second heavy chain.
- the second mutation is selected from the group consisting of: K322E, K322D, K322N, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W and P329Y.
- the second mutation is K322E.
- embodiments are provided that allow for inhibition of one or more Fc effector function(s) .
- the second mutation decreases the Fc effector function increased by the first mutation.
- the second mutation decreases partially the Fc effector function that is increased by the first mutation.
- the second mutation in a polypeptide or antibody is able to decrease an Fc effector function to a level that is lower than what is found for a polypeptide or antibody with a first mutation, but without a second mutation, i.e. a parent polypeptide or parent antibody .
- the second mutation in a polypeptide or antibody is able to decrease an Fc effector function to a level that is , comparable to, or lower, than what is found for a polypeptide or antibody without a first and a second mutation, i.e. a wild type polypeptide or antibody.
- the polypeptide or antibody comprises an Fc region comprising a first heavy chain and a second heavy chain, wherein one of the above mentioned second mutations is present in the first and/or the second heavy chain.
- the second mutation is selected from the group of K322E, K322D, and K322N, and decreases CDC, CDCC, and/or Clq binding. In one embodiment the second mutation is selected from the group of K322E, K322D, and K322N, and decreases Clq binding. In one embodiment the second mutation is K322E, and decreases CDC, CDCC, and/or Clq binding. In one embodiment the second mutation is K322E and decreases Clq binding.
- the second mutation is selected from the group of P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y, and decreases ADCC, ADCP, FcyR binding, CDC, CDCC, and/or Clq binding.
- the second mutation is selected from the group of P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y, and decreases ADCC, FcyR binding, CDC, and/or Clq binding.
- the second mutation is selected from the group of P329R, P329K, P329D, P329E, and P329G, and decreases ADCC, ADCP, FcyR binding, CDC, CDCC and/or Clq binding.
- the second mutation is P329R, and decreases ADCC, ADCP, FcyR binding, CDC, CDCC, and/or Clq binding. In one embodiment the second mutation is P329R, and decreases ADCC, ADCP, FcyR binding, CDC, CDCC, and/or Clq binding. In one embodiment the second mutation is P329R, and decreases ADCC, FcyR binding, CDC, and/or Clq binding. In one embodiment the second mutation is P329K, and decreases ADCC, FcyR binding, CDC, and/or Clq binding. In one embodiment the second mutation is P329D, and decreases ADCC, FcyR binding, CDC, and/or Clq binding.
- the second mutation is P329E, and decreases ADCC, FcyR binding, CDC, and/or Clq binding. In one embodiment the second mutation is P329G, and decreases ADCC, FcyR binding, CDC, and/or Clq binding.
- the second mutation is P329A. In one embodiment the second mutation is P329A, which decreases ADCC, but not CDC.
- the second mutation is at position P329, with the proviso that the second mutation is not P329A.
- the second mutation is at amino acid position P329, with the proviso that the second mutation is not P329A or P329G.
- the polypeptide or antibody comprises a second mutation that is P329R, with the proviso that the polypeptide or antibody does not comprise a mutation in the positions corresponding to L234 and L235 in human IgGl.
- the second mutation is selected from the group consisting of: P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y.
- the second mutation is selected from the group consisting of: P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y.
- the second mutation is selected from the group of: P329R, P329K and P329D.
- the first mutation is in the amino acid position corresponding to E430 and the second mutation is selected from one of the groups consisting of:
- the Fc region comprises a first mutation in the amino acid position corresponding to E430 and the second mutation is selected from one of the groups consisting of:
- the first mutation is in the amino acid position corresponding to E430 and the second mutation is selected from one of the groups consisting of:
- the first mutation is in the amino acid position corresponding to E430 and the second mutation is selected from one of the groups consisting of:
- the first mutation is selected from the group consisting of: E430G, E430S, E430F and E430T; and the second mutation is selected from one of the groups consisting of:
- the first mutation is E430G and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the Fc region comprises a first mutation which is E430G and a second mutation which is selected from the group consisting of: K322E, P329R, P329K and P329D, wherein the Fc region comprises amino acids L and L in the positions corresponding to L234 and L235.
- the first mutation is E430G and the second mutation is K322E. In one embodiment of the invention the first mutation is E430G and the second mutation is K322D. In one embodiment of the invention the first mutation is E430G and the second mutation is K322N. In one embodiment of the invention the first mutation is E430G and the second mutation is P329H. In one embodiment of the invention the first mutation is E430G and the second mutation is P329K. In one embodiment of the invention the first mutation is E430G and the second mutation is P329R. In one embodiment of the invention the first mutation is E430G and the second mutation is P329D. In one embodiment of the invention the first mutation is E430G and the second mutation is P329E.
- the first mutation is E430G and the second mutation is P329M. In one embodiment of the invention the first mutation is E430G and the second mutation is P329F. In one embodiment of the invention the first mutation is E430G and the second mutation is P329G. In one embodiment of the invention the first mutation is E430G and the second mutation is P329I. In one embodiment of the invention the first mutation is E430G and the second mutation is P329L. In one embodiment of the invention the first mutation is E430G and the second mutation is P329N. In one embodiment of the invention the first mutation is E430G and the second mutation is P329Q. In one embodiment of the invention the first mutation is E430G and the second mutation is P329S.
- the first mutation is E430G and the second mutation is P329T. In one embodiment of the invention the first mutation is E430G and the second mutation is P329V. In one embodiment of the invention the first mutation is E430G and the second mutation is P329W. In one embodiment of the invention the first mutation is E430G and the second mutation is P329Y. In one embodiment of the invention the first mutation is E430G and the second mutation is P329A.
- the first mutation is in the amino acid position corresponding to E345 and the second mutation is selected from one of the groups consisting of:
- the Fc region comprises a first mutation in the amino acid position corresponding to E345 and the second mutation is selected from one of the groups consisting of:
- the first mutation is in the amino acid position corresponding to E345 and the second mutation is selected from one of the groups consisting of:
- the first mutation is in the amino acid position corresponding to E345 and the second mutation is selected from one of the groups consisting of:
- the first mutation is selected from the group consisting of: E345K, E345R and E345Y; and the second mutation is selected from one of the groups consisting of:
- the first mutation is E345K and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E345K and the second mutation is K322E. In one embodiment of the invention the first mutation is E345K and the second mutation is K322D. In one embodiment of the invention the first mutation is E345K and the second mutation is K322N. In one embodiment of the invention the first mutation is E345K and the second mutation is P329H. In one embodiment of the invention the first mutation is E345K and the second mutation is P329K. In one embodiment of the invention the first mutation is E345K and the second mutation is P329R. In one embodiment of the invention the first mutation is E345K and the second mutation is P329D.
- the first mutation is E345K and the second mutation is P329E. In one embodiment of the invention the first mutation is E345K and the second mutation is P329M . In one embodiment of the invention the first mutation is E345K and the second mutation is P329F. In one embodiment of the invention the first mutation is E345K and the second mutation is P329G. In one embodiment of the invention the first mutation is E345K and the second mutation is P329I. In one embodiment of the invention the first mutation is E345K and the second mutation is P329L. In one embodiment of the invention the first mutation is E345K and the second mutation is P329N.
- the first mutation is E345K and the second mutation is P329Q. In one embodiment of the invention the first mutation is E345K and the second mutation is P329S. In one embodiment of the invention the first mutation is E345K and the second mutation is P329T. In one embodiment of the invention the first mutation is E345K and the second mutation is P329V. In one embodiment of the invention the first mutation is E345K and the second mutation is P329W. In one embodiment of the invention the first mutation is E345K and the second mutation is P329Y. In one embodiment of the invention the first mutation is E345K and the second mutation is P329A.
- the first mutation is E430S and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E430S and the second mutation is K322E. In one embodimen2t of the invention the first mutation is E430S and the second mutation is K322D. In one embodiment of the invention the first mutation is E430S and the second mutation is K322N. In one embodiment of the invention the first mutation is E430S and the second mutation is P329H. In one embodiment of the invention the first mutation is E430S and the second mutation is P329K. In one embodiment of the invention the first mutation is E430S and the second mutation is P329R. In one embodiment of the invention the first mutation is E430S and the second mutation is P329D. In one embodiment of the invention the first mutation is E430S and the second mutation is P329E.
- the first mutation is E430S and the second mutation is P329M . In one embodiment of the invention the first mutation is E430S and the second mutation is P329F. In one embodiment of the invention the first mutation is E430S and the second mutation is P329G. In one embodiment of the invention the first mutation is E430S and the second mutation is P329I. In one embodiment of the invention the first mutation is E430S and the second mutation is P329L. In one embodiment of the invention the first mutation is E430S and the second mutation is P329N. In one embodiment of the invention the first mutation is E430S and the second mutation is P329Q. In one embodiment of the invention the first mutation is E430S and the second mutation is P329S.
- the first mutation is E430S and the second mutation is P329T. In one embodiment of the invention the first mutation is E430S and the second mutation is P329V. In one embodiment of the invention the first mutation is E430S and the second mutation is P329W. In one embodiment of the invention the first mutation is E430S and the second mutation is P329Y. In one embodiment of the invention the first mutation is E430S and the second mutation is P329A.
- the first mutation is E430F and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E430F and the second mutation is K322E. In one embodiment of the invention the first mutation is E430F and the second mutation is K322D. In one embodiment of the invention the first mutation is E430F and the second mutation is K322N. In one embodiment of the invention the first mutation is E430F and the second mutation is P329H. In one embodiment of the invention the first mutation is E430F and the second mutation is P329K. In one embodiment of the invention the first mutation is E430F and the second mutation is P329R. In one embodiment of the invention the first mutation is E430F and the second mutation is P329D. In one embodiment of the invention the first mutation is E430F and the second mutation is P329E.
- the first mutation is E430F and the second mutation is P329M . In one embodiment of the invention the first mutation is E430F and the second mutation is P329F. In one embodiment of the invention the first mutation is E430F and the second mutation is P329G. In one embodiment of the invention the first mutation is E430F and the second mutation is P329I. In one embodiment of the invention the first mutation is E430F and the second mutation is P329L. In one embodiment of the invention the first mutation is E430F and the second mutation is P329N. In one embodiment of the invention the first mutation is E430F and the second mutation is P329Q. In one embodiment of the invention the first mutation is E430F and the second mutation is P329S.
- the first mutation is E430F and the second mutation is P329T. In one embodiment of the invention the first mutation is E430F and the second mutation is P329V. In one embodiment of the invention the first mutation is E430F and the second mutation is P329W. In one embodiment of the invention the first mutation is E430F and the second mutation is P329Y. In one embodiment of the invention the first mutation is E430F and the second mutation is P329A.
- the first mutation is E430T and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E430T and the second mutation is K322E. In one embodiment of the invention the first mutation is E430T and the second mutation is K322D. In one embodiment of the invention the first mutation is E430T and the second mutation is K322N. In one embodiment of the invention the first mutation is E430T and the second mutation is P329H. In one embodiment of the invention the first mutation is E430T and the second mutation is P329K. In one embodiment of the invention the first mutation is E430T and the second mutation is P329R. In one embodiment of the invention the first mutation is E430T and the second mutation is P329D. In one embodiment of the invention the first mutation is E430T and the second mutation is P329E.
- the first mutation is E430T and the second mutation is P329M . In one embodiment of the invention the first mutation is E430T and the second mutation is P329F. In one embodiment of the invention the first mutation is E430T and the second mutation is P329G. In one embodiment of the invention the first mutation is E430T and the second mutation is P329I. In one embodiment of the invention the first mutation is E430T and the second mutation is P329L. In one embodiment of the invention the first mutation is E430T and the second mutation is P329N. In one embodiment of the invention the first mutation is E430T and the second mutation is P329Q. In one embodiment of the invention the first mutation is E430T and the second mutation is P329S.
- the first mutation is E430T and the second mutation is P329T. In one embodiment of the invention the first mutation is E430T and the second mutation is P329V. In one embodiment of the invention the first mutation is E430T and the second mutation is P329W. In one embodiment of the invention the first mutation is E430T and the second mutation is P329Y. In one embodiment of the invention the first mutation is E430T and the second mutation is P329A.
- the first mutation is E345Q and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E345Q and the second mutation is K322E.
- the first mutation is E345Q and the second mutation is K322D.
- the first mutation is E345Q and the second mutation is K322N.
- the first mutation is E345Q and the second mutation is P329H.
- the first mutation is E345Q and the second mutation is P329K.
- the first mutation is E345Q and the second mutation is P329R. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329D. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329E. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329M. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329F. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329G. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329I. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329L.
- the first mutation is E345Q and the second mutation is P329N. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329Q. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329S. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329T. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329V. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329W. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329Y. In one embodiment of the invention the first mutation is E345Q and the second mutation is P329A.
- the first mutation is E345R and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E345R and the second mutation is K322E. In one embodiment of the invention the first mutation is E345R and the second mutation is K322D. In one embodiment of the invention the first mutation is E345R and the second mutation is K322N. In one embodiment of the invention the first mutation is E345R and the second mutation is P329H. In one embodiment of the invention the first mutation is E345R and the second mutation is P329K. In one embodiment of the invention the first mutation is E345R and the second mutation is P329R. In one embodiment of the invention the first mutation is E345R and the second mutation is P329D.
- the first mutation is E345R and the second mutation is P329E. In one embodiment of the invention the first mutation is E345R and the second mutation is P329M. In one embodiment of the invention the first mutation is E345R and the second mutation is P329F. In one embodiment of the invention the first mutation is E345R and the second mutation is P329G. In one embodiment of the invention the first mutation is E345R and the second mutation is P329I. In one embodiment of the invention the first mutation is E345R and the second mutation is P329L. In one embodiment of the invention the first mutation is E345R and the second mutation is P329N. In one embodiment of the invention the first mutation is E345R and the second mutation is P329Q.
- the first mutation is E345R and the second mutation is P329S. In one embodiment of the invention the first mutation is E345R and the second mutation is P329T. In one embodiment of the invention the first mutation is E345R and the second mutation is P329V. In one embodiment of the invention the first mutation is E345R and the second mutation is P329W. In one embodiment of the invention the first mutation is E345R and the second mutation is P329Y. In one embodiment of the invention the first mutation is E345R and the second mutation is P329A.
- the first mutation is E345Y and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is E345Y and the second mutation is K322E. In one embodiment of the invention the first mutation is E345Y and the second mutation is K322D. In one embodiment of the invention the first mutation is E345Y and the second mutation is K322N. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329H. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329K. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329R. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329D.
- the first mutation is E345Y and the second mutation is P329E. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329M. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329F. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329G. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329I. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329L. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329N. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329Q.
- the first mutation is E345Y and the second mutation is P329S. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329T. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329V. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329W. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329Y. In one embodiment of the invention the first mutation is E345Y and the second mutation is P329A.
- the first mutation is selected from the group consisting of: S440Y and S440W
- the second mutation is selected from one of the groups consisting of:
- the first mutation is selected from the group consisting of: S440Y and S440W
- the second mutation is selected from one of the groups consisting of:
- the first mutation is selected from the group consisting of: S440Y and S440W
- the second mutation is selected from one of the groups consisting of:
- the first mutation is selected from the group consisting of: S440Y and S440W and the second mutation is selected from one of the groups consisting of:
- the first mutation is S440W and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is S440W and the second mutation is K322E. In one embodiment of the invention the first mutation is S440W and the second mutation is K322D. In one embodiment of the invention the first mutation is S440W and the second mutation is K322N. In one embodiment of the invention the first mutation is S440W and the second mutation is P329H. In one embodiment of the invention the first mutation is S440W and the second mutation is P329K. In one embodiment of the invention the first mutation is S440W and the second mutation is P329R. In one embodiment of the invention the first mutation is S440W and the second mutation is P329D. In one embodiment of the invention the first mutation is S440W and the second mutation is P329E.
- the first mutation is S440W and the second mutation is P329M . In one embodiment of the invention the first mutation is S440W and the second mutation is P329F. In one embodiment of the invention the first mutation is S440W and the second mutation is P329G. In one embodiment of the invention the first mutation is S440W and the second mutation is P329I. In one embodiment of the invention the first mutation is S440W and the second mutation is P329L. In one embodiment of the invention the first mutation is S440W and the second mutation is P329N . In one embodiment of the invention the first mutation is S440W and the second mutation is P329Q. In one embodiment of the invention the first mutation is S440W and the second mutation is P329S.
- the first mutation is S440W and the second mutation is P329T. In one embodiment of the invention the first mutation is S440W and the second mutation is P329V. In one embodiment of the invention the first mutation is S440W and the second mutation is P329W. In one embodiment of the invention the first mutation is S440W and the second mutation is P329Y. In one embodiment of the invention the first mutation is S440W and the second mutation is P329A.
- the first mutation is S440Y and the second mutation is selected from the group consisting of: K322E, P329R, P329K and P329D.
- the first mutation is S440Y and the second mutation is K322E. In one embodiment of the invention the first mutation is S440Y and the second mutation is K322D. In one embodiment of the invention the first mutation is S440Y and the second mutation is K322N. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329H. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329K. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329R. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329D. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329E.
- the first mutation is S440Y and the second mutation is P329M . In one embodiment of the invention the first mutation is S440Y and the second mutation is P329F. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329G. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329I. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329L. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329N. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329Q. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329S.
- the first mutation is S440Y and the second mutation is P329T. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329V. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329W. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329Y. In one embodiment of the invention the first mutation is S440Y and the second mutation is P329A.
- the Fc region comprises one or more further mutations.
- the Fc region comprises a CH2 domain, a CH3 domain and optionally a hinge region.
- the Fc region comprises one or more further mutations in the CH2 or CH3 domain.
- the one or more further mutations are in the CH2 domain.
- the one or more further mutations are in the CH3 domain.
- the Fc region comprises:
- the Fc region comprises a further mutation in the CH3 domain corresponding to K439 or where the first mutation is not at position S440 the further mutation may be at position S440. In one embodiment of the invention the Fc region comprises a further mutation in the CH3 domain corresponding to one of the following position S440 or K439, with the proviso that the first mutation is not in S440.
- Polypeptides or antibodies comprising a first and a second mutation according to the present invention and a further mutation at position S440, such as S440K do not form oligomers with polypeptides or antibodies comprising a further mutation at position S440, such as S440K.
- the further mutation is selected from S440K or K439E.
- Polypeptides or antibodies comprising a further mutation that is K439E or S440K do not form oligomers with polypeptides having the same identical mutation.
- K439E and S440K can be viewed as complementary mutations, thus an Fc region comprising a K439E mutation will not form Fc-Fc interactions with another Fc region comprising a K439E mutation.
- An Fc region comprising a K439E mutation will however form Fc-Fc interactions with another Fc region comprising a S440K mutation.
- Fc regions comprising the S440K mutation which will not form Fc-Fc interactions with another Fc region comprising the S440K mutation.
- a polypeptide or an antibody comprising a K439E mutation will form oligomers with a polypeptide or antibody comprising a S440K mutation in an alternating pattern.
- the Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the Fc region comprises a (i) first mutation in the amino acid position corresponding to E430 and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutation is selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the Fc region comprises a (i) first mutation in the amino acid position corresponding to E430 and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutation is selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- Fc region comprises the wild type amino acids L and L in the positions corresponding to L234 and L235.
- the Fc region comprises (i) a first mutation, and (ii) a second mutation, and (ii) a further mutation, wherein the mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the Fc region comprises a (i) first mutation in the amino acid position corresponding to E345 and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutation is selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the Fc region comprises the wild type amino acids L and L in the positions corresponding to L234 and L235.
- the Fc region comprises (i) a first mutation, and (ii) a second mutation, and (iii) a further mutation, wherein the first, second and further mutation are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the Fc region comprises (i) a first mutation, and (ii) a second mutation, and (iii) a further mutation, wherein the first, second and further mutation are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the Fc region comprises a further mutation which is a hexamerization-inhibiting mutation corresponding to K439E or S440K in human IgGl, according to EU numbering. That is, in one embodiment of the present invention the Fc region comprises a hexamerization enhancing mutation, such as E430G, and a hexamerization-inhibiting mutation, such as K439E. In one embodiment of the present invention the Fc region comprises a hexamerization enhancing mutation such as E345K and a hexamerization-inhibiting mutation, such as K439E.
- the Fc region comprises a hexamerization enhancing mutation such as E430G and a hexamerization-inhibiting mutation, such as S440K.
- the Fc region comprises a hexamerization enhancing mutation such as E345K and a hexamerization-inhibiting mutation, such as S440K.
- the polypeptide or antibody according to the invention has at least a first and a second mutation, but as described above may also have additional mutations to introduce additional functions into the polypeptide or antibody.
- the Fc region comprises at most ten mutations, such as nine mutations, such as eight mutations, such as seven mutations, such as six mutations, such as five mutations, such as four mutations, such as three mutations or such as two mutations.
- polypeptides or antibodies of the invention allow for polypeptides or antibodies of the invention to have additional mutations which introduces additional features into the polypeptide or antibody.
- additional mutations also allow for a variation in the Fc region at positions which are not involved in Fc-Fc interaction, as well as in positions not involved in Fc effector functions. Further, additional mutations may also be due to allelic variations.
- the polypeptide or antibody has an Fc effector function decreased by at least 20% compared to a parent polypeptide or antibody which is identical to the antibody except that it does not comprise the second mutation. That is the polypeptide or antibody having a first and a second mutation where the second mutation is having the effect of decreasing the effector function of the polypeptide or antibody by at least 20% compared to a parent polypeptide or antibody having only the first mutation.
- the polypeptide or antibody has an Fc effector function decreased by at least 30%, at least 40%, at least 50% at least 60 %, at least 70% at least 80 %, at least 90%, at least 95% compared to a parent polypeptide or antibody having only the first mutation.
- the polypeptide or antibody does not induce an Fc effector function.
- a decrease in Fc effector functions or activity of a polypeptide having a first and second mutation is to be understood as when the polypeptide is compared to a parent polypeptide having the identical antigen binding region and an Fc region having the same first mutation, but lacking the second mutation in the Fc region.
- a decrease in Fc effector functions or activity of a polypeptide having a first and second mutation is to be understood as when the polypeptide is compared to a parent polypeptide having the identical antigen binding region and an Fc region and not having the first and second mutation in the Fc region, that is, a wild type antibody.
- the second mutation decreases at least one effector function. In one embodiment according to the invention the second mutations decrease more than one effector function. In one embodiment according to the invention the second mutation decreases CDC activity. In one embodiment according to the invention the second mutation decreases ADCC activity. In another embodiment the second mutation decreases CDC and ADCC activity. In one embodiment according to the invention the second mutation decreases FcyRIIIa signaling. In a further embodiment according to the invention the second mutation decrease the CDC activity but not ADCC activity or FcyRIIIa signaling. That is in some embodiments according to the invention the second mutation decreases on or more effector functions, while having no decreasing effect on other effector functions. In one embodiment according to the invention the second mutation decreases CDC activity, but still retained considerable ADCC activity.
- the Fc effector function is selected from the following group; complement-dependent cytotoxicity (CDC), complement-dependent cell-mediated cytotoxicity, complement activation, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis, Clq binding and FcyR binding.
- the Fc effector function is FcyRIIIa signaling. That is the second mutation according to the invention is able to decrease at least one Fc effector function.
- Some second mutations show a decrease in more than one effector function.
- Particular mutations which decrease the CDC activity were also characterized by a decreased ADCC activity and decreased FcyRIIIa binding, such mutations include mutations selected from the group comprising : P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y.
- mutations include the ones from the group comprising : P329A.
- Some second mutations showed no FcyRIa binding such as P329R and P329K.
- Some second mutations showed some decrease binding to FcyRIa binding such as P329G and P329A.
- novel polypeptide or antibody-based therapeutics having decreased Fc effector functions is provided.
- the invention also provides for more selective Fc effector function capabilities of Fc-Fc enhanced polypeptides or antibodies.
- the polypeptide is an antibody, monospecific antibody, bispecific antibody or multispecific antibody. In one embodiment the polypeptide is a monospecific polypeptide, a bispecific polypeptide or a multispecific polypeptide.
- the polypeptide of the invention is not limited to antibodies which have a natural, e.g. a human Fc domain but it may also be an antibody having other mutations than those of the present invention, such as e.g. mutations that affect glycosylation or enables the antibody to be a bispecific antibody.
- naturally antibody is meant any antibody which does not comprise any genetically introduced mutations.
- An antibody which comprises naturally occurring modifications, e.g. different allotypes, is thus to be understood as a "natural antibody” in the sense of the present invention, and can thereby be understood as a parent antibody.
- Such antibodies may serve as a template for the one or more mutations according to the present invention, and thereby providing the variant antibodies of the invention.
- An example of a parent antibody comprising other mutations than those of the present invention is the bispecific antibody as described in WO2011/131746 (Genmab), utilizing reducing conditions to promote half-molecule exchange of two antibodies comprising IgG4-like CH3 regions, thus forming bispecific antibodies without concomitant formation of aggregates.
- parent antibodies include but are not limited to bispecific antibodies such as heterodimeric bispecifics: Triomabs (Fresenius); bispecific IgGl and IgG2 (Rinat neurosciences Corporation); FcAAdp (Regeneron); Knobs-into-holes (Genentech); Electrostatic steering (Amgen, Chugai, Oncomed); SEEDbodies (Merck); Azymetric scaffold (Zymeworks); mAb-Fv (Xencor); and LUZ-Y (Genentech).
- Other exemplary parent antibody formats include, without limitation, a wild type antibody, a full-length antibody or Fc-containing antibody fragment, a human antibody, humanized antibody, chimeric antibody or any combination thereof.
- the polypeptide or antibody may be any human antibody of any isotype, e.g. IgGl, IgG2, IgG3, IgG4, IgE, IgD, IgM, or IgA, optionally a human full-length antibody, such as a human full-length IgGl antibody.
- the polypeptide or antibody comprises an Fc region comprising an Fc segment as disclosed in Figure 22, wherein the Fc segment further comprises a first mutation, a second mutation and/or a further mutation or third mutation as disclosed herein.
- the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 1, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 2, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 3, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO : 4, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 5, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 6, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein. In one embodiment of the invention the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 7, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein. In one embodiment of the invention the polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 8, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO : 9, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- polypeptide or antibody comprises an Fc region comprising an Fc segment in SEQ ID NO: 10, wherein the Fc segment further comprises a first mutation a second mutation and/or a further mutation or a third mutations as disclosed herein.
- the polypeptide or antibody is a human IgGl antibody, e.g. the IgGlm(za) or IgGlm(f) allotype.
- the polypeptide or antibody has an Fc region that is a human IgGl, IgG2, IgG3, IgG4, IgE, IgD, IgM, IgA isotype or a mixed isotype. That is the Fc region of a polypeptide or antibody according to the invention has at least a first and a second mutation introduced into the Fc region corresponding to a human IgGl, IgG2, IgG3, IgG4, IgE, IgD, IgM, IgA isotype or a mixed isotype.
- the Fc region is a mixed isotype selected form the following group: IgGl/IgG2, IgGl/IgG3, IgGl/IgG4, IgG2/IgG3, IgG2/IgG4 and IgG3/IgG4.
- the Fc region is comprised of amino acid sequence form more than one isotype.
- the polypeptide or antibody has an Fc region that is a human IgGl, IgG2, IgG3 or IgG4.
- the polypeptide or antibody has an Fc region that is a human IgGl isotype.
- the polypeptide or antibody has an Fc region that is an IgGlm(f), IgGlm(a), IgGlm(z), IgGlm(x) allotype or mixed allotype.
- the polypeptide or antibody is a human antibody, humanized antibody or chimeric antibody.
- the tumor necrosis factor receptor superfamily (TNFRSF) is a group of cytokine receptors characterized by the ability to bind ligands of the tumor necrosis factor superfamily (TNFSF) via an extracellular cysteine-rich domain.
- TNFSF tumor necrosis factor receptor superfamily
- the TNFRSF include the following list of 29 proteins; TNFR1 (Uniprot P19438), FAS (Uniprot P25445), DR3 (Uniprot Q93038), DR4(Uniprot 000220), DR5 (Uniprot 014763), DR6 (Uniprot 075509), NGFR (Uniprot P08138), EDAR (Uniprot Q9UNE0), DcRl (Uniprot Q14798), DcR2(Uniprot Q9UBN6), DcR3 (Uniprot 095407), OPG (Uniprot 000300), TROY (Uniprot Q92956), XEDAR (Uniprot Q9HAV5), LTbR (Uniprot P36941), HVEM (Uniprot Q92956), TWEAKR (Uniprot Q9NP84), CD120b (Uniprot P20333), OX40 (Uniprot P
- TNFRSF are involved in apoptosis and contains an intracellular death domain such as FAS, DR4, DR5, TNFR1, DR6, DR3, EDAR and NGFR.
- Other TNFRSF are involved in other signal transduction pathways, such as proliferation, survival, and differentiation such as DcRl, DcR2, DcR3, OPG, TROY, XEDAR, LTbR, HVEM, TWEAKR, CD120b, OX40, CD40, CD27, CD30, 4-lBB, RANK, TACI, BLySR, BCMA, GITR, RELT.
- TNF receptors are expressed in a wide variety of tissues in mammals, especially in leukocytes.
- the antigen binding region binds to a member of the TNFR-SF. In one embodiment the antigen binding region binds to a member of the TNFR-SF which does not comprise an intracellular death domain.
- the TNFR-SF is selected from the group of: OX40, CD40, CD30, CD27, 4-lBB, RANK, TACI, BLySR, BCMA, RELT and GITR. In one embodiment the TNFR-SF is selected form the group of: FAS, DR4, DR4, TNFR1, DR6, DR3, EDAR, and NGFR.
- the polypeptide or antibody according to the invention may bind any target, examples of such targets or antigens according to the invention may be, and is not limited to, directed against are: TNFR1, FAS, DR3, DR4, DR5, DR6, NGFR, EDAR, DcRl, DcR2, DcR3, OPG, TROY, XEDAR, LTbR, HVEM, TWEAKR, CD120b, OX40, CD40, CD27, CD30, 4-lBB, RANK, TACI, BLySR, BCMA, GITR, RELT.
- Multispecific antibodies are: TNFR1, FAS, DR3, DR4, DR5, DR6, NGFR, EDAR, DcRl, DcR2, DcR3, OPG, TROY, XEDAR, LTbR, HVEM, TWEAKR, CD120b, OX40, CD40, CD27, CD30, 4-lBB, RANK, TACI,
- the present invention provides a polypeptide or antibody comprising a first Fc region of a human IgG and a first antigen binding region, a second Fc region of a human IgG and a second antigen binding region, wherein said first and second Fc regions comprises a (i) first mutation and a (ii) second mutation and a (iii) third mutation corresponding to the following positions in human IgGl according to EU numbering :
- the third mutation is different from the first Fc region and the second Fc region so that if the first Fc region has a mutation in position F405 then second Fc region has a mutation in K409 and vice versa .
- first Fc region and the second Fc region are not identical due to the (iii) third mutation is not located in the same position in the first and second Fc region.
- the variant of the present invention is an antibody selected from a monospecific antibody, bispecific antibody or multispecific antibody.
- the bispecific antibody has the format described in WO 2011/131746.
- the invention in another aspect, relates to a polypeptide or antibody which is a bispecific polypeptide or antibody comprising a first antigen-binding region, a second antigen-binding region and an Fc region comprising a first CH2-CH3 heavy chain of an immunoglobulin and a second CH2-CH3 heavy chain of an immunoglobulin, wherein2 the first and second antigen-binding regions bind different epitopes on the same or on different antigens, and wherein the first and/or second CH2-CH3 heavy chain comprises,
- the first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue selected from those corresponding to K409, T366, L368, K370, D399, F405, and Y407 in the Fc region of a human IgGl; and the secondCH2-CH3 heavy chain comprises a third mutation in an amino acid residue selected from those corresponding to F405, T366, L368, K370, D399, Y407 and K409 in the Fc region of a human IgGl, and wherein the third mutation in the first polypeptide is different from the further mutation in the second polypeptide.
- the bispecific antibody of the present invention is not limited to a particular format and it may be any of those described herein.
- the first CH2-CH3 heavy chain comprises a third mutation in the amino acid residue corresponding to K409, such as K409R;
- the second CH2-CH3 heavy chain comprises a third mutation in the amino acid residue corresponding to F405, such as F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprise
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second Fc region comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- the first and/or second CH2-CH3 heavy chain comprises
- first CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to K409R; and the second CH2-CH3 heavy chain comprises a third mutation in an amino acid residue corresponding to F405L.
- a polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- the present invention relates to a method of decreasing an Fc effector function of a polypeptide or antibody comprising an Fc region of a human immunoglobulin and an antigen binding region, wherein the Fc region comprises a CH2 and CH3 domain, said Fc region comprising a (i) first mutation corresponding to the following positions in human IgG l according to EU numbering : E430, E345 or S440, which method comprises introducing a (ii) second mutation corresponding to the following positions in human IgGl according to EU numbering : K322 or P329.
- the first mutation according to the invention which is in one of the following positions E430, E345 or S440 introduces the effect of enhanced Fc-Fc interactions of the polypeptide or antibody.
- the second mutation according to the invention which is in one of the following positions K322 or P329 introduces the effect of decreased Fc effector functions in the polypeptide or antibody as also described above.
- the first mutation is selected from the group consisting of: E430G, E345K, E430S, E430F, E430T, E345Q, E345R, E345Y, S440W and S440Y.
- the first mutation enhances Fc-Fc interactions.
- the first mutation is selected from E430G or E345K.
- the present invention relates to a method of decreasing an Fc effector function or activity of a polypeptide or antibody having a first Fc-Fc enhancing mutation by introducing a second mutation .
- the method of decreasing an Fc effector function is determined when the polypeptide or antibody is compared to a parent polypeptide or antibody having the identical antigen binding region and an Fc region having the identical first mutation in the Fc region, but lacking the second mutation in the Fc region.
- the method for decreasing the Fc effector function or activity reduces the effector functions to a level which is lower or comparable to the level of a parent polypeptide or antibody having the identical antigen binding region and Fc region but not having the first and second mutation in the Fc region.
- the second mutation is selected from the group consisting of: K322E, K322D, K322N, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W and P329Y.
- the method relates to decreasing an Fc effector function such as CDC, CDCC and/or Clq binding wherein the method comprises introducing a second mutation selected from the following group of K322E, K322D and K322N.
- the method relates to decreasing an Fc effector function such as ADCC, ADCP, FcyR binding, CDC CDCC and /or Clq binding wherein the method comprises introducing a second mutation selected from the following group of P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y
- the second mutation is selected from the group of: K322E, P329R, P329K and P329D.
- the second mutation is at position P329, with the proviso that the second mutation is not P329A.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to E322E.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to E322D. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to E322N. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329H.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329K. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329R. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329D.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329E. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329M. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329F.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329G. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329I. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329L.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329N. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329Q. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329S.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329T. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329V. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329W. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation corresponding to P329Y.
- the present invention relates to a method of decreasing an effector function of a polypeptide or an antibody wherein the Fc region comprises a first mutation corresponding to E430G, which method comprises introducing a second mutation selected from the group consisting of: K322E, P329R, P329K and P329D.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to E322E.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to E322D. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to E322N. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329H.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329K. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329R. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329D.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329E. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329M. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329F.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329G. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329I. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329L.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329N. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329Q. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329S.
- the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329T. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329V. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329W. In one embodiment the present invention relates to a method of decreasing an effector function of a polypeptide or antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation corresponding to P329Y.
- the present invention relates to a method of decreasing an effector function of a polypeptide or an antibody wherein the Fc region comprises a first mutation corresponding to E345K, which method comprises introducing a second mutation selected from the group consisting of: K322E, P329R, P329K and P329D.
- the present invention relates to a method wherein the Fc region comprises one or more further mutations in the CH3 domain. In one embodiment, the present invention relates to a method wherein the Fc region comprises a further mutation in the CH3 domain corresponding to one of the following positions in human IgGl according to EU numbering : S440 or K439. In one embodiment of the invention the Fc region comprises a further mutation in the CH3 domain corresponding to one of the following position S440 or K439, with the proviso that the further mutation is not in position S440 if the first mutation is in S440.
- Polypeptides or antibodies comprising a first and a second mutation according to the present invention and a further mutation at position S440 such as S440K do not form oligomers with polypeptides or antibodies comprising a mutation at position S440 such as S440K.
- Polypeptides or antibodies comprising a first and a second mutation according to the present invention and a further mutation at position K439 such as K439E do not form oligomers with polypeptides or antibodies comprising a mutation at position K439 such as K439E.
- a method is provided that allows for the formation of oligomers between polypeptides or antibodies wherein a first polypeptide or antibody comprises a K439E mutation and the second polypeptide or antibody comprises a S440K mutation.
- oligomers such as e.g. hexamers can be forced to be formed in certain patterns of first and second polypeptides. This may be of interest in methods where the polypeptides bind different targets or epitopes and oligomers should be formed in combinations of these different targets or epitopes.
- the present invention relates to a method wherein the further mutation is selected from S440K or K439E.
- the present invention relates to a method of decreasing an Fc effector function, wherein the Fc effector function is decreased by at least 20% compared to a parent polypeptide or parent antibody which is identical to the polypeptide or with an identical first mutation, but without a second mutation.
- the polypeptide or antibody has an Fc effector function decreased by at least 30%, at least 40%, at least 50% at least 60 %, at least 70% at least 80 %, at least 90%, at least 95% compared to a parent polypeptide or antibody having only the first mutation.
- the present invention relates to a method of decreasing an Fc effector function, wherein the Fc effector function is selected from the following group; complement dependent cytotoxicity (CDC), complement dependent cell- mediated cytotoxicity (CDCC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody dependent cell-mediated phagocytosis (ADCP), Clq binding and FcyR binding.
- the Fc effector function is selected from the following group; complement dependent cytotoxicity (CDC), complement dependent cell- mediated cytotoxicity (CDCC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody dependent cell-mediated phagocytosis (ADCP), Clq binding and FcyR binding.
- the present invention relates to a method of decreasing ADCC, wherein ADCC is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation.
- the present invention relates to a method of decreasing CDC, wherein CDC is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation .
- the present invention relates to a method of decreasing Clq binding, wherein Clq binding is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation.
- the present invention relates to a method of decreasing Fc- gamma receptor binding, wherein Fc-gamma receptor binding is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation.
- the present invention relates to a method of decreasing Fc- gamma receptor binding, wherein Fc-gamma receptor binding is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the first and second mutation.
- the present invention relates to a method of decreasing Fc-gamma receptor I binding, wherein Fc-gamma receptor I binding is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation.
- the present invention relates to a method of decreasing Fc-gamma receptor I binding, wherein Fc-gamma receptor I binding is decreased by at least 20%, at least 50%, at least 60%, at least, 70%, at least, 80%, at least, 90%, at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the first and second mutation.
- the present invention relates to a method of decreasing Fc-gamma receptor I binding, wherein Fc-gamma receptor I binding is decreased by at least, 70%, preferably at least, 80%, more preferably at least, 90% or at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the second mutation.
- the present invention relates to a method of decreasing Fc-gamma receptor I binding, wherein Fc-gamma receptor I binding is decreased by at least, 70%, preferably at least, 80%, more preferably at least, 90% or at least 100% compared to a comparison antibody which is identical to the antibody except that it does not comprise the first and second mutation.
- the method comprises decreasing Fc-gamma receptor I binding to a level that is decreased compared to a wild type Fc region.
- polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody comprising a first antigen-binding region, a second antigen-binding region and an Fc region comprising a first CH2-CH3 heavy chain of an immunoglobulin and a second CH2-CH3 heavy chain of an immunoglobulin.
- the invention also relates to compositions comprising polypeptides or antibodies described herein and variations hereof. Specific aspects and embodiments will be described below. Furthermore, such polypeptide or antibody may be obtained according to any method described herein.
- the present invention relates to a composition comprising at least one polypeptide or antibody described herein.
- the composition comprises one or more polypeptides or antibodies according to any aspect or embodiment described herein.
- the composition comprises a first polypeptide or antibody and a second polypeptide or antibody as described in any aspect or embodiment herein.
- the composition comprises a first and a second polypeptide or antibody, wherein the first and the second polypeptide or antibody comprises an Fc region comprising,
- the composition comprises a first polypeptide or antibody and a second polypeptide or antibody wherein the first and second polypeptide or antibody comprises a i) first mutation, a ii) second mutation and iii) a further mutation wherein the first and the second polypeptide or antibody does not comprise the same further mutation.
- the composition comprises a first polypeptide or antibody comprising a first Fc region and a second polypeptide or antibody comprising a second Fc region.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation, (ii) a second mutation, (iii) a further mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first and second Fc-region comprises (i) a first mutation, (iii) a further mutation, and the first and/or second Fc region comprises (ii) a second mutation, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering : (i) a first mutation E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation in the amino acid position corresponding to E430, and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation in the amino acid position corresponding to E345, and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E430G mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E430G mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G mutation and (ii) a second K322E mutation, and ( iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G mutation and (ii) a second P329K mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G mutation and (ii) a second P329R mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G mutation and (ii) a second P329D mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E345K mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E345K mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K mutation and (ii) a second K322E mutation, and ( iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K mutation and (ii) a second P329K mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K mutation and (ii) a second P329R mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of: (iii) K439E and S440K, wherein the first and the second Fc region do not comprise the same further mutation.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K mutation and (ii) a second P329D mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E345R mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- K322E, K322D, K322N P329A, P329H, P329K, P329R, P329D, P329E, P329F, P329G, P329I, P329L, P329M, P329N, P329Q, P329S, P329T, P329V, P329W, and P329Y;
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc region, wherein the first Fc region comprises (i) a first E345R mutation and (ii) a second mutation, and (iii) a further mutation, wherein the second and further mutations are selected from the following groups consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345R mutation and (ii) a second K322E mutation, and ( iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345R mutation and (ii) a second P329K mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345R mutation and (ii) a second P329R mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345R mutation and (ii) a second P329D mutation, and (iii) a further mutation, wherein the further mutations are selected from the group consisting of:
- composition comprises a first and a second polypeptide or antibody, wherein the first and the second polypeptide or antibody comprises an Fc region comprising,
- first or the second polypeptide or antibody comprises a second mutation that decreases Fc effector functions.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc region, a second polypeptide or antibody comprising a second antigen-binding region and a second Fc region, wherein the first and second Fc region comprises (i) a first mutation in an amino acid position selected from the group consisting of: E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, (ii) a second mutation, (iii) a further mutation E, wherein the mutations corresponds to the following amino acid positions in human IgGl, according to EU numbering :
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first mutation in an amino acid position selected from the group consisting of: E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, and ii) a second mutation in an amino acid positon selected from the group of: E322 and P329, and a iii) further K439E mutation; and the second Fc-region comprises i) a first mutation in an amino acid position selected from the group consisting of: E430 and E345, and a further S440K mutation.
- the first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first mutation in an amino acid position selected from the group consisting of: E430 or E345, and ii) a second mutation in an amino acid positon selected from the group of: E322 and P329, and a iii) further S440K mutation; and the second Fc-region comprises i) a first mutation in an amino acid position selected from the group consisting of: E430, E345 or S440, with the proviso that the mutation in S440 is S440Y or S440W, and a further K439E mutation.
- the first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second E322E mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E430G mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second E322E mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E430G mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329R mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E430G mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329R mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E430G mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329K mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E430G mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329K mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E430G mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329D mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E430G mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E430G and ii) a second P329D mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E430G mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second E322E mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E345K mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second E322E mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E345K mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329R mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E345K mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329R mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E345K mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329K mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E345K mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329K mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E345K mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329D mutation, and iii) a further K439E mutation; and the second Fc-region comprises i) a first E345K mutation, and a further S440K mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a first polypeptide or antibody comprising a first antigen-binding region and a first Fc-region, a second polypeptide or antibody comprising second antigen-binding region and a second Fc- region, wherein the first Fc-region comprises (i) a first E345K and ii) a second P329D mutation, and iii) a further S440K mutation; and the second Fc-region comprises i) a first E345K mutation, and a further K322E mutation.
- first polypeptide or antibody has a decreased Fc effector function.
- the composition comprises a polypeptide or antibody capable of binding to a member of the Tumor Necrosis Factor Receptor Superfamily (TNFR-SF) .
- TNFR-SF Tumor Necrosis Factor Receptor Superfamily
- the composition comprises a polypeptide or antibody capable of binding to a member of the TNFR-SF with an intracellular death domain selected from the following group consisting of: TNFR1, FAS, DR3, DR4, DR5, DR6, NGFR and EDAR.
- the composition comprises a polypeptide or antibody capable of binding to a member of the TNFR-SF without an intracellular death domain selected form the following group consisting of: DcRl, DcR2, DcR3, OPG, TROY, XEDAR, LTbR, HVEM, TWEAK R, CD120b, OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR, RELT.
- a polypeptide or antibody capable of binding to a member of the TNFR-SF without an intracellular death domain selected form the following group consisting of: DcRl, DcR2, DcR3, OPG, TROY, XEDAR, LTbR, HVEM, TWEAK R, CD120b, OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR, RELT.
- the composition comprises a polypeptide or antibody capable of binding to a member of the TNFR-SF belonging to the group of immune activators consisting of: OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR and RELT.
- the composition comprises a polypeptide or antibody wherein a first polypeptide and a second polypeptide bind different epitopes on one or more members of the TNFR-SF without an intracellular death domain, selected from the following group consisting of: OX40, CD40, CD27, CD30, 4- IBB, RANK, TACI, BLySR, BCMA, GITR and RELT.
- the composition comprises a polypeptide or antibody wherein a first polypeptide binding to one member of the TNFR-SF without an intracellular death domain selected form the following group consisting of: OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR and RELT does not block binding of said second antibody binding to one member of the TNFR-SF without an intracellular death domain selected from the following group consisting of: OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR and RELT.
- a first polypeptide binding to one member of the TNFR-SF without an intracellular death domain selected form the following group consisting of: OX40, CD40, CD27, CD30, 4-1BB, RANK, TACI, BLySR, BCMA, GITR and RELT.
- the composition comprising a first polypeptide or antibody and a second polypeptide or antibody are present in the composition at a 1:49 to 49:1 molar ratio, such as a 1:1 molar ratio, a 1:2 molar ratio, a 1:3 molar ratio, a 1:4 molar ratio, a 1:5 molar ratio, a 1:6 molar ratio, a 1:7 molar ratio, a 1:8 molar ratio, a 1:9 molar ratio, a 1:10 molar ratio, a 1:15 molar ratio, a 1:20 molar ratio, a 1:25 molar ratio, a 1:30 molar ratio, a 1:35 molar ratio, a 1:40 molar ratio, a 1:45 molar ratio, a 1:50 molar ratio, a 50:1 molar ratio, a 45:1 molar ratio, a 40:1 molar ratio,
- the composition according to any aspect or embodiment is a pharmaceutical composition.
- polypeptides, antibodies, bispecific antibodies or compositions according to any aspect or embodiment of the present invention may be used as a medicament, i.e. for therapeutic applications.
- the present invention provides a polypeptide, antibody or a composition according to any aspect or embodiment disclosed herein for use as a medicament.
- the present invention provides a polypeptide, antibody or a composition according to any aspect or embodiment disclosed herein for use in the treatment of cancer, autoimmune disease, inflammatory disease or infectious disease.
- the present invention relates to a method of treating an individual having a disease comprising administering to the individual an effective amount of a polypeptide, antibody or composition according to any aspect or embodiment disclosed herein.
- the disease is selected from the group of: cancer, autoimmune disease, inflammatory disease and infectious disease.
- the method according to any aspect or embodiment disclosed herein relates to further administering an additional therapeutic agent.
- the additional therapeutic agent is one or more anti-cancer agent(s) selected from the group consisting of chemotherapeutics (including but not limited to paclitaxel, temozolomide, cisplatin, carboplatin, oxaliplatin, irinotecan, doxorubicin, gemcitabine, 5-fluorouracil, pemetrexed), kinase inhibitors (including but not limited to sorafenib, sunitinib or everolimus), apoptosis- modulating agents (including but not limited to recombinant human TRAIL or birinapant), RAS inhibitors, proteasome inhibitors (including but not limited to bortezomib), histon deacetylase inhibitors (including but not limited to vorinostat), nutraceuticals, cytokines (including but not limited to IFN- ⁇ ), antibodies or antibody mimetics (including but not limited to anti-EGFR, anti-IGF-
- a polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- the invention also relates to kit-of-parts for simultaneous, separate or sequential use in therapy comprising polypeptides or antibodies described herein. Furthermore, such variants may be obtained according to any method described herein.
- the present invention relates to a kit of parts comprising a polypeptide, antibody or composition according to any aspect or embodiment described herein, wherein said polypeptide, antibody or composition is in one or more containers such as vials.
- the kit of parts comprises a polypeptide, antibody or a composition according to any aspect or embodiment described herein, for simultaneous, separate or sequential use in therapy.
- the present invention relates to use of a polypeptide, an antibody, a composition or kit-of-parts according to any of the embodiments herein described for use in a diagnostic method.
- the present invention relates to a diagnostic method comprising administering a polypeptide, antibody, a composition or a kit-of-parts according to any embodiments herein described to at least a part of the body of a human or other mammal.
- the present invention relates to use of a polypeptide, an antibody, a composition or kit-of-parts according to any of the embodiments herein described in imaging at least a part of the body of a human or other mammal.
- the present invention relates to a method for imaging of at least a part of the body of a human or other mammal, comprising administering a variant, a composition or a kit-of-parts according to any embodiments herein described.
- the invention provides for a preparation of any polypeptide or antibody according to any aspect or embodiment described above, i.e., preparations comprising multiple copies of the polypeptide or antibody.
- the invention also provides for a composition comprising a polypeptide or antibody according to any aspect or embodiment described above, e.g., a pharmaceutical composition.
- the invention also provides for the use of any such polypeptide or antibody, preparation, or composition as a medicament.
- the invention also provides for combinations of polypeptides or antibodies wherein one polypeptide or antibody comprises at least a first and a second mutation according to the invention, as well as preparations and pharmaceutical compositions of such variant combinations and their use as a medicament.
- the two polypeptides or antibodies bind the same antigen or to different antigens typically expressed on the surface of the same cell, cell membrane, virion and/or other particle.
- a polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- the present invention relates to a polypeptide or antibody, wherein said variant is conjugated to a drug, toxin or radiolabel, such as wherein the variant is conjugated to a toxin via a linker.
- said variant is part of a fusion protein.
- the polypeptide or antibody of the invention is not conjugated at the C-terminus to another molecule, such as a toxin or label.
- the variant is conjugated to another molecule at another site, typically at a site which does not interfere with oligomer formation.
- the antibody variant may, at the other site, be linked to a compound selected from the group consisting of a toxin (including a radioisotope) a prodrug or a drug. Such a compound may make killing of target cells more effective, e.g. in cancer therapy.
- the resulting variant is thus an immunoconjugate.
- the present invention provides an antibody linked or conjugated to one or more therapeutic moieties, such as a cytotoxin, a chemotherapeutic drug, a cytokine, an immunosuppressant, and/or a radioisotope.
- therapeutic moieties such as a cytotoxin, a chemotherapeutic drug, a cytokine, an immunosuppressant, and/or a radioisotope.
- conjugates are referred to herein as “immunoconjugates” or “drug conjugates”.
- Immunoconjugates which include one or more cytotoxins are referred to as "immunotoxins”.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to ⁇ e.g. , kills) cells.
- Suitable therapeutic agents for forming immunoconjugates of the present invention include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, enediyene antitumor antibiotics including neocarzinostatin, calicheamycins, esperamicins, dynemicins, lidamycin, kedarcidin or analogs or derivatives thereof, anthracyclins, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine,
- rachelmycin or analogs or derivatives of CC-1065
- dolastatin pyrrolo[2, l-c][l,4] benzodiazepins (PDBs) or analogues thereof
- antibiotics such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)
- anti-mitotic agents ⁇ e.g.
- tubulin-inhibitors such as monomethyl auristatin E, monomethyl auristatin F, or other analogs or derivatives of dolastatin 10; Histone deacetylase inhibitors such as the hydroxamic acids trichostatin A, vorinostat (SAHA), belinostat, LAQ824, and panobinostat as well as the benzamides, entinostat, CI994, mocetinostat and aliphatic acid compounds such as phenylbutyrate and valproic acid, proteasome inhibitors such as Danoprevir, bortezomib, amatoxins such as a- amantin, diphtheria toxin and related molecules (such as diphtheria A chain and active fragments thereof and hybrid molecules); ricin toxin (such as ricin A or a deglycosylated ricin A chain toxin), cholera toxin, a Shiga-like toxin (SLT-I, SLT
- conjugated molecules include antimicrobial/lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et a/., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994).
- Therapeutic agents that may be administered in combination with an antibody of the present invention as described elsewhere herein, such as, e.g.
- the drug conjugates of the present invention comprise an antibody as disclosed herein conjugated to auristatins or auristatin peptide analogs and derivates (US5635483; US5780588).
- Auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis and nuclear and cellular division (Woyke et a/ (2001) Antimicrob. Agents and Chemother. 45( 12) : 3580-3584) and have anticancer (US5663149) and anti-fungal activity (Pettit et a/., ( 1998) Antimicrob. Agents and Chemother. 42 :2961-2965.
- the auristatin drug moiety may be attached to the antibody via a linker, through the N (amino) terminus or the C (terminus) of the peptidic drug moiety.
- Exemplary auristatin embodiments include the N-terminus-linked monomethyl auristatin drug moieties DE and DF, disclosed in Senter et al., Proceedings of the American Association for Cancer Research. Volume 45, abstract number 623, presented March 28, 2004 and described in US 2005/0238649).
- An exemplary auristatin embodiment is MMAE (monomethyl auristatin E).
- Another exemplary auristatin embodiment is MMAF (monomethyl auristatin F).
- an antibody of the present invention comprises a conjugated nucleic acid or nucleic acid-associated molecule.
- the conjugated nucleic acid is a cytotoxic ribonuclease, an antisense nucleic acid, an inhibitory RNA molecule ⁇ e.g. , a siRNA molecule) or an immunostimulatory nucleic acid ⁇ e.g. , an immunostimulatory CpG motif-containing DNA molecule).
- an antibody of the present invention is conjugated to an aptamer or a ribozyme.
- antibodies comprising one or more radiolabeled amino acids are provided.
- a radiolabeled variant may be used for both diagnostic and therapeutic purposes (conjugation to radiolabeled molecules is another possible feature).
- Non-limiting examples of labels for polypeptides include 3H, 14C, 15N, 35S, 90Y, 99Tc, and 1251, 1311, and 186Re.
- Methods for preparing radiolabeled amino acids and related peptide derivatives are known in the art, (see, for instance Junghans et a/., in Cancer Chemotherapy and Biotherapy 655-686 (2 nd Ed., Chafner and Longo, eds., Lippincott Raven ( 1996)) and U.S. 4,681,581, U.S.
- a radioisotope may be conjugated by the chloramine-T method.
- the polypeptide or antibody of the present invention is conjugated to a radioisotope or to a radioisotope-containing chelate.
- the variant can be conjugated to a chelator linker, e.g. DOTA, DTPA or tiuxetan, which allows for the antibody to be complexed with a radioisotope.
- the variant may also or alternatively comprise or be conjugated to one or more radiolabeled amino acids or other radiolabeled molecule.
- a radiolabeled variant may be used for both diagnostic and therapeutic purposes.
- the variant of the present invention is conjugated to an alpha-emitter.
- Non-limiting examples of radioisotopes include 3 H, 14 C, 15 N, 35 S, 90 Y, "Tc, 125 I, m In, 131 I, 186 Re, 213 Bs, 225 Ac and 227 Th.
- the polypeptide or antibody of the present invention may be conjugated to a cytokine selected from the group consisting of IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, IL-18, IL-23, IL-24, IL-27, IL-28a, IL-28b, IL-29, KGF, IFNa, IFN , IFNy, GM-CSF, CD40L, Flt3 ligand, stem cell factor, ancestim, and TNFa.
- a cytokine selected from the group consisting of IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, IL-18, IL-23, IL-24, IL-27, IL-28a, IL-28b, IL-29, KGF, IFNa, IFN , IFNy, GM-CSF, CD40L, Flt3 ligand
- Polypeptides or antibodies of the present invention may also be chemically modified by covalent conjugation to a polymer to for instance increase their circulating half-life.
- Exemplary polymers, and methods to attach them to peptides are illustrated in for instance US 4,766,106, US 4, 179,337, US 4,495,285 and US 4,609,546.
- Additional polymers include polyoxyethylated polyols and polyethylene glycol (PEG) ⁇ e.g. , a PEG with a molecular weight of between about 1,000 and about 40,000, such as between about 2,000 and about 20,000).
- any method known in the art for conjugating the polypeptide or antibody of the present invention to the conjugated molecule(s), such as those described above, may be employed, including the methods described by Hunter et al. , Nature 144, 945 ( 1962), David et a/. , Biochemistry 13, 1014 ( 1974), Pain et a/. , J . Immunol. Meth. 40, 219 ( 1981) and Nygren, J. Histochem. and Cytochem. 30, 407 ( 1982).
- Such variants may be produced by chemically conjugating the other moiety to the N-terminal side or C-terminal side of the variant or fragment thereof ⁇ e.g.
- an antibody H or L chain see, e.g., Antibody Engineering Handbook, edited by Osamu Kanemitsu, published by Chijin Shokan (1994)).
- conjugated variant derivatives may also be generated by conjugation at internal residues or sugars, where appropriate.
- the agents may be coupled either directly or indirectly to a polypeptide or antibody of the present invention.
- One example of indirect coupling of a second agent is coupling via a spacer or linker moiety to cysteine or lysine residues in the bispecific antibody.
- a polypeptide or antibody is conjugated to a prodrug molecule that can be activated in vivo to a therapeutic drug via a spacer or linker.
- the linker is cleavable under intracellular conditions, such that the cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
- the linker is cleavable by a cleavable agent that is present in the intracellular environment (e. g.
- the spacers or linkers may be cleavable by tumor-cell associated enzymes or other tumor-specific conditions, by which the active drug is formed.
- tumor-cell associated enzymes or other tumor-specific conditions by which the active drug is formed.
- Examples of such prodrug technologies and linkers are described in WO02083180, WO2004043493, WO2007018431, WO2007089149, WO2009017394 and WO201062171 by Syntarga BV, et al. Suitable antibody- prodrug technology and duocarmycin analogs can also be found in U.S. Patent No. 6,989,452 (Medarex), incorporated herein by reference.
- the linker can also or alternatively be, e.g.
- a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including but not limited to, a lysosomal or endosomal protease.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside the target cells (see e. g. Dubowchik and Walker, 1999, Pharm. Therapeutics 83 : 67-123).
- the peptidyl linker cleavable by an intracellular protease is a Val-Cit (valine-citrulline) linker or a Phe- Lys (phenylalanine-lysine) linker (see e.g. US6214345, which describes the synthesis of doxorubicin with the Val-Cit linker and different examples of Phe-Lys linkers).
- Examples of the structures of a Val-Cit and a Phe-Lys linker include but are not limited to MC-vc-PAB described below, MC-vc-GABA, MC-Phe-Lys-PAB or MC-Phe- Lys-GABA, wherein MC is an abbreviation for maleimido caproyl, vc is an abbreviation for Val-Cit, PAB is an abbreviation for p-aminobenzylcarbamate and GABA is an abbreviation for y-aminobutyric acid.
- An advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
- the linker unit is not cleavable and the drug is released by antibody degradation (see US 2005/0238649).
- a linker is not substantially sensitive to the extracellular environment.
- "not substantially sensitive to the extracellular environment" in the context of a linker means that no more than 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers, in a sample of variant antibody drug conjugate compound, are cleaved when the variant antibody drug conjugate compound presents in an extracellular environment ⁇ e.g. plasma).
- Whether a linker is not substantially sensitive to the extracellular environment can be determined for example by incubating the variant antibody drug conjugate compound with plasma for a predetermined time period ⁇ e.g. 2, 4, 8, 16 or 24 hours) and then quantitating the amount of free drug present in the plasma.
- exemplary embodiments comprising MMAE or MMAF and various linker components have the following structures (wherein Ab means antibody and p, representing the drug-loading (or average number of cytostatic or cytotoxic drugs per antibody molecule), is 1 to about 8, e.g. p may be from 4-6, such as from 3-5, or p may be 1, 2, 3, 4, 5, 6, 7 or 8).
- Examples where a cleavable linker is combined with an auristatin include MC- vc-PAB-MMAF (also designated as vcMMAF) and MC-vc-PAB-MMAF (also designated as vcMMAE), wherein MC is an abbreviation for maleimido caproyl, vc is an abbreviation for the Val-Cit (valine-citruline) based linker, and PAB is an abbreviation for p-aminobenzylcarbamate.
- auristatins combined with a non-cleavable linker, such as mcMMAF (mc (MC is the same as mc in this context) is an abbreviation of maleimido caproyl).
- the drug linker moiety is vcMMAE.
- the vcMMAE drug linker moiety and conjugation methods are disclosed in WO2004010957, US7659241, US7829531, US7851437 and US 11/833,028 (Seattle Genetics, Inc.), (which are incorporated herein by reference), and the vcMMAE drug linker moiety is bound to the antibodies at the cysteines using a method similar to those disclosed in therein.
- the drug linker moiety is mcMMAF.
- the mcMMAF drug linker moiety and conjugation methods are disclosed in US7498298, US 11/833,954, and WO2005081711 (Seattle Genetics, Inc.), (which are incorporated herein by reference), and the mcMMAF drug linker moiety is bound to the variants at the cysteines using a method similar to those disclosed in therein .
- the polypeptide or antibody of the present invention is attached to a chelator linker, e.g. tiuxetan, which allows for the bispecific antibody to be conjugated to a radioisotope.
- a chelator linker e.g. tiuxetan
- each arm (or Fab-arm) of the polypeptide or antibody is coupled directly or indirectly to the same one or more therapeutic moieties. In one embodiment, only one arm of the antibody is coupled directly or indirectly to one or more therapeutic moieties.
- each arm of the antibody is coupled directly or indirectly to different therapeutic moieties.
- the variant is a bispecific antibody and is prepared by controlled Fab-arm exchange of two different monospecific antibodies, e.g. a first and second antibody, as described herein
- bispecific antibodies can be obtained by using monospecific antibodies which are conjugated or associated with different therapeutic moieties.
- a polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- the invention relates to a polypeptide, antibody of the invention as described above for use as a medicament, in particular for use as a medicament for the treatment of diseases or disorders.
- diseases and disorders include, without limitation, cancer and bacterial, viral or fungal infections.
- the present invention relates to the polypeptide, antibody, bispecific antibodies, compositions and kit-of-parts described herein, for treatment of a disease, such as cancer.
- the present invention relates to a method for treatment of a human disease, comprising administration of a variant, a composition or a kit-of- parts described herein.
- the present invention relates to a method for treatment of cancer in a human comprising administration of a variant, a composition or a kit-of- parts.
- Treatment refers to the administration of an effective amount of a therapeutically active compound of the present invention with the purpose of easing, ameliorating, arresting or eradicating (curing) symptoms or disease states.
- An "effective amount” or “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.
- a therapeutically effective amount of an antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.
- a polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- Efficient dosages and the dosage regimens for the antibody depend on the disease or condition to be treated and may be determined by the persons skilled in the art.
- An exemplary, non-limiting range for a therapeutically effective amount of an antibody of the present invention is about 0.1 to 100 mg/kg, such as about 0.1 to 50 mg/kg, for example about 0.1 to 20 mg/kg, such as about 0.1 to 10 mg/kg, for instance about 0.5, about such as 0.3, about 1, about 3, about 5, or about 8 mg/kg.
- Polypeptides or antibodies of the present invention may also be administered in combination therapy, i.e., combined with other therapeutic agents relevant for the disease or condition to be treated.
- the antibody- containing medicament is for combination with one or more further therapeutic agents, such as a cytotoxic, chemotherapeutic or anti-angiogenic agents.
- Such combined administration may be simultaneous, separate or sequential.
- the present invention provides a method for treating or preventing disease, such as cancer, which method comprises administration to a subject in need thereof of a therapeutically effective amount of a variant or pharmaceutical composition of the present invention, in combination with radiotherapy and/or surgery.
- polypeptide or antibody refers to a polypeptide or antibody comprising an Fc region having a CH2-CH3 region of an immunoglobulin and an antigen-binding region
- a polypeptide or antibody may also be a multispecific polypeptide or antibody having a first CH2-CH3 region of an immunoglobulin and a first antigen-binding region
- a second polypeptide or antibody having a second Fc region comprising a second CH2- CH3 region of an immunoglobulin and a second antigen-binding region.
- the invention also provides isolated nucleic acids and vectors encoding a variant according to any one of the aspects described above, as well as vectors and expression systems encoding the variants.
- Suitable nucleic acid constructs, vectors and expression systems for antibodies and variants thereof are known in the art, and described in the Examples.
- the nucleotide sequences encoding the heavy and light chain portions may be present on the same or different nucleic acids or vectors.
- the invention also provides a method for producing, in a host cell, a polypeptide or antibody according to any one of the aspects described above, wherein said polypeptide or anibody comprises at least the Fc region of a heavy chain, said method comprising the following steps:
- nucleotide construct encoding said Fc region of said variant, b) expressing said nucleotide construct in a host cell, and
- the antibody is a heavy-chain antibody. In most embodiments, however, the antibody will also contain a light chain and thus said host cell further expresses a light-chain-encoding construct, either on the same or a different vector.
- Host cells suitable for the recombinant expression of antibodies are well- known in the art, and include CHO, HEK-293, Expi293T, PER-C6, NS/0 and Sp2/0 cells.
- said host cell is a cell which is capable of Asn-linked glycosylation of proteins, e.g. a eukaryotic cell, such as a mammalian cell, e.g. a human cell.
- said host cell is a non-human cell which is genetically engineered to produce glycoproteins having human-like or human glycosylation.
- Pichia pastoris Examples of such cells are genetically-modified Pichia pastoris (Hamilton et al., Science 301 (2003) 1244- 1246; Potgieter et al., J . Biotechnology 139 (2009) 318-325) and genetically-modified Lemna minor (Cox et al., Nature Biotechnology 12 (2006) 1591-1597).
- said host cell is a host cell which is not capable of efficiently removing C-terminal lysine K447 residues from antibody heavy chains.
- Table 2 in Liu et al. (2008) J Pharm Sci 97 : 2426 (incorporated herein by reference) lists a number of such antibody production systems, e.g. Sp2/0, NS/0 or transgenic mammary gland (goat), wherein only partial removal of C-terminal lysines is obtained.
- the host cell is a host cell with altered glycosylation machinery. Such cells have been described in the art and can be used as host cells in which to express variants of the invention to thereby produce an antibody with altered glycosylation. See, for example, Shields, R.L.
- Additional methods for generating engineered glycoforms are known in the art, and include but are not limited to those described in Davies et al., 2001, Biotechnol Bioeng 74: 288-294; Shields et al, 2002, J Biol Chem 277 :26733-26740; Shinkawa et al., 2003, J Biol Chem 278 :3466-3473), US6602684, WO00/61739A1; WO01/292246A1; WO02/311140A1; WO 02/30954A1; PotelligentTM technology (Biowa, Inc. Princeton, N.J .); GlycoMAbTM glycosylation engineering technology (GLYCART biotechnology AG, Zurich, Switzerland); US 20030115614; Okazaki et al., 2004, JMB, 336: 1239-49.
- the invention also relates to an antibody obtained or obtainable by the method of the invention described above.
- the invention relates to a host cell capable of producing a polypeptide or antibody of the invention.
- the host cell has been transformed or transfected with a nucleotide construct of the invention.
- GVEVHNAKTKPREEQFNSTFRWSVLTWHQDWL (aa 126- NGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQV 326) YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- GVEVHNAKTKPREEQYNSTFRWSVLTVLHQDWL (aa 177- NGKEYKCKVSNKALPAPIEKTISKTKGQPREPQV 377) YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSR WQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
- GVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWL (aa 127- NGKEYKCKVSNKGLPSS IEKTISKAKGQPREPQV 327) YTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
- GKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGK (aa 133- TFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLP 353) PPSEELALNELVTLTCLARGFSPKDVLVRWLQGS QELPREKYLTWASRQEPSQGTTTFAVTSILRVAA
- GKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGE (aa 120- TFTCTAAHPELKTPLTANITKSGNTFRPEVHLLP 340) PPSEELALNELVTLTCLARGFSPKDVLVRWLQGS QELPREKYLTWASRQEPSQGTTTFAVTSILRVAA EDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKP THVNVSWMAEVDGTCY
- GEAVKTHTNISESHPNATFSAVGEAS ICEDDWNS (aa 230- GERFTCTVTHTDLPSPLKQTISRPKGVALHRPDV 452) YLLPPAREQLNLRESATITCLVTGFSPADVFVQW MQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILT VSEEEWNTGETYTCVAHEALPNRVTERTVDKSTG KPTLYNVSLVMSDTAGTCY
- VPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNA (aa 176- GTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSL 384) NLLASSDPPEAASWLLCEVSGFSPPNILLMWLED QREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAP PSPQPATYTCVVSHEDSRTLLNASRSLEVSYVTD HGPMK
- variable heavy (VH) chain and variable light (VL) chain sequences were prepared by gene synthesis (GeneArt Gene Synthesis; ThermoFisher
- IgGl heavy chain (HC) and light chain (LC) constant regions Desired mutations were introduced either by gene synthesis or site directed mutagenesis.
- Antibodies mentioned in this application have VH and VL sequences derived from previously described CD38 antibody HuMAB 005 (WO2006/099875), DR5 antibodies hDR5-01, hDR5-05 (WO2014/009358), CD52 antibody IgGl- Campath (alemtuzumab, Crowe et al., Clin Exp Immunol. 1992, 87(1) : 105-110), and CD20 antibodies IgG l-7D8 and IgGl-l lB8 (WO2004/035607) .
- the human IgGl antibody bl2 a gpl20-specific antibody was used as a negative control (Barbas et al., J Mol Biol. 1993 Apr 5;230(3) :812-23).
- Antibodies were expressed as IgGl, K. Plasmid DNA mixtures encoding both heavy and light chains of antibodies were transiently transfected in Expi293T cells (Life/Thermo Scientific, USA) using 293fectin (Invitrogen, US) essentially as described by Vink et al. (Vink et al., Methods, 65 (1), 5-10 2014).
- Antibodies were purified by protein A affinity chromatography. Culture supernatants were filtered over a 0.20 ⁇ dead-end filter and loaded on 5 mL MabSelect SuRe columns (GE Healthcare), washed and eluted with 0.02 M sodium citrate-NaOH, pH 3. The eluates were loaded on a HiPrep Desalting column (GE Healthcare) immediately after purification and the antibodies were buffer exchanged into 12.6 mM NaH 2 P0 4 , 140 mM NaCI, pH 7.4 buffer (B.Braun or Thermo Fisher). After buffer exchange, samples were sterile filtered over 0.2 ⁇ dead-end filters.
- Purified proteins were analyzed by a number of bioanalytical assays including capillary electrophoresis on sodium dodecyl sulfate-polyacrylamide gels (CE-SDS) and high- performance size exclusion chromatography (HP-SEC). Concentration was measured by absorbance at 280 nm. Purified antibodies were stored at 2-8°C.
- IgG hexamerization upon target binding on the cell surface has been shown to support efficient binding of the hexameric structure of Clq resulting in avid Clq binding (Diebolder et al., Science 2014).
- IgG hexamerization on the cell surface is mediated through intermolecular non-covalent Fc-Fc interactions, and can be enhanced by point mutations in the CH2 domain, including E345R and E430G (Diebolder et al., 2014 Science; De Jong et al., 2015 PloS Biology).
- Fc-Fc enhancing mutations increase Clq binding avidity on the hexameric antibody structure on the cell surface, while Clq binding affinity is not affected. Therefore, it is unpredictable whether mutations that are described to decrease Clq binding affinity can block CDC by IgGl antibody variants with a mutation for enhanced Fc-Fc interactions.
- IgGl-005-E430G and IgGl-005-E345R WO2013/004842, WO2014/108198
- IgGl-005-E345R/E430G/S440Y WO2014/006217
- 0.1 x 10 6 Daudi cells (ATCC # CCL-213TM) were pre-incubated in polystyrene round-bottom 96-well plates (Greiner bio-one Cat # 650101) with concentration series of purified antibodies in a total volume of 80 ⁇ _ for 15 min on a shaker at RT.
- 20 ⁇ _ normal human serum (NHS; Cat # M0008 Sanquin, Amsterdam, The Netherlands) was added as a source of complement and incubated in a 37°C incubator for 45 min (20% final NHS concentration; 0.001-10.0 ⁇ g/mL final antibody concentrations in 3-fold dilutions).
- the reaction was stopped by putting the plates on ice before pelleting the cells by centrifugation and replacing the supernatant replaced by 20 ⁇ _ of 2 ⁇ g/mL propidium iodide solution (PI; Sigma Aldrich, Zwijnaarde, The Netherlands).
- the number of Pi-positive cells was determined by FACS analysis on an Intellicyt iQueTM screener (Westburg). The data were analyzed using best-fit values of a non-linear dose-response fit using log- transformed concentrations in GraphPad PRISM 5. The percentage lysis was calculated as (number of Pi-positive cells / total number of cells) x 100%.
- Cells were washed with 150 ⁇ _ FACS buffer and incubated for 30 minutes at 4°C with 50 ⁇ _ FITC-labeled rabbit anti-HuClq antibody (DAKO, Cat # F0254; 20 ⁇ g/mL final concentration) . Cells were washed twice with FACS buffer and resuspended in 30 ⁇ _ FACS buffer to determine mean fluorescence intensities on an Intellicyt iQueTM screener.
- Example 4 The effect of K322X mutations on the in vitro CDC efficacy of IgGl-005 variants with enhanced Fc-Fc interactions
- Antibodies were collected by taking the supernatants of transient transfections as described in Example 1. Antibody concentration series (0.001-30.0 ⁇ g/mL final concentrations in 3-fold dilutions) were tested in an in vitro CDC assay on Daudi cells with 20% NHS, essentially as described in Example 2.
- CE-SDS was performed under reducing and non-reducing conditions. Purity and fragmentation of the samples were analyzed using CE-SDS (Caliper Labchip GXII, PerkinElmer) on the Labchip GXII (High Sensitivity protocol) with few modifications. Both nonreduced and reduced samples (addition of DTT) were prepared using the HT Protein Express Reagent Kit (CLS960008) and denatured by incubation at 70°C for 10 min . Samples were ru n with the HT antibody analysis 200 high sensitivity settings. Data were a nalyzed for molecular weight and purity (fraction of total) with Labchip GXII software.
- Figure 4A shows that IgG l-005- K322E/E430G displayed behavior comparable to the wild type IgGl assay control with disulfide-bridged heavy a nd light chains.
- a single molecular species with apparent MW of approximately 150 kDa was visible under non-reducing conditions, while under reducing conditions a heavy chain with apparent MW of 50 kDa and light chain of 26 kDa were visible.
- Antibody variants IgG l-005-K322D/E430G and IgG l- 005-K322N/E430G contained higher-molecular weight aggregates under non- reducing conditions that appeared to be resolved after reduction .
- HP-SEC fractionation was performed using a Waters Alliance 2975 separation unit (Waters, Etten-Leur, The Netherlands) connected to a TSK HP-SEC column (G3000SW X i; Toso Biosciences, via Omnilabo, Breda, The Netherlands) and a Waters 2487 dual ⁇ absorbance detector (Waters). 50 ⁇ _ sa mples containing 1.25 ⁇ g/mL protein were separated at 1 mL/min in 0.1 M Na 2 S0 4 /0.1 M sodium phosphate buffered at pH 6.8. Results were processed using Empower software version 3 and expressed per peak as percentage of total peak area .
- Figure 4B shows that while antibody IgGl-005-K322E/E430G eluted overwhelmingly at the elution time expected for a monomeric species (98% monomeric), variants IgG l-005- K322D/E430G (70% aggregated) and IgG l-005-K322N/E430G (43% agg regated) showed considerable amounts of higher molecular weight species.
- HP-SEC analysis therefore suggested that the double mutant K322E/E430G was more homogeneous in solution than double mutants K322D/E430G and K322N/E430G.
- Example 6 The effect of P329X mutations on the in vitro CDC efficacy of IgGl-005 variants with enhanced Fc-Fc interactions
- Example 7 Biophysical characterization of IgGl-005-E430G variants containing mutations at position P329.
- CE-SDS was performed under reducing and non-reducing conditions as described in Example 5. All tested IgGl-005-E430G antibody variants containing an additional mutation of amino acid P329 displayed behavior similar to the wild type IgGl assay control antibody, with disulfide-bridged heavy and light chains: a single molecular species with apparent MW of approximately 150 kDa was visible under non-reducing conditions, while under reducing conditions a heavy chain with apparent MW of 50 kDa and light chain of 26 kDa were visible (summarized in Table 1) . These data suggest that under denaturing conditions, a monomeric molecule is formed displaying behavior typical of wild type IgGl antibodies.
- HP-SEC fractionation was performed as described in Example 5.
- the tested IgGl-005-E430G antibody variants that were additionally mutated at amino acid P329 contained variable amounts of higher molecular weight species (Table 1 ). Va riants IgG l-005-P329R/E430G, IgGl-005-P329D/E430G, and IgGl-005- P329T/E430G were essentially homogeneous in solution .
- Example 8 Analysis of the thermal stability of IgGl-005-E430G variants containing mutations at position P329
- DSF was performed in an iQ5 96-well RT-PCR machine ( Bio-Rad) capable of detecting changes in fluorescence intensity caused by binding of the extrinsic dye Sypro-Orange (ThermoFisher -Scientific, S6651) to hydrophobic regions exposed by denatured IgG.
- Sypro-Orange ThermoFisher -Scientific, S6651
- a thermal melt curve can be derived from measuring the increasing fluorescence during controlled, stepwise thermal denaturation of the analyzed IgG. Therefore, samples of 5 ⁇ _ of 0.6 mg/mL IgG protein, mixed with 20 ⁇ _ of 75 mM Sypro-Orange in either PBS pH 7.4 (B. Braun, Netherlands) or 30 mM NaAc pH 4, were prepared in duplicate. Fluorescence was recorded at temperatures ranging from 25°C to 95°C, in stepwise increments of 0.5°C per increment and 15 second duration plus the time necessary to record the fluorescence of all
- Table 2 DSF analysis of IgGl-005-P329X/E430G antibody variants.
- P329D/E430G 57.0 41.0 1 IgGl-005 antibody variants were ranked according to decreasing Tm
- Example 9 effect of mutations at position P329 on FcvRIIIa activation by IgGl-005 variants with enhanced Fc-Fc interactions
- the kit contains Jurkat human T cells that are engineered to stably express high affinity
- FcyRIIIa V158
- NFAT nuclear factor of activated T cells
- Luminescence signals were normalized by subtracting with background luminescence signal determined from medium-only samples (no Daudi cells, no antibody, no effector cells).
- Example 10 Analysis of the effect of mutations at positions K322 and P329 on the ADCC efficacy of lgG1 -005 variants with enhanced Fc-Fc interactions CDC-inhibiting mutants of IgGl-005-E430G (described in Example 4 and Example 6) showing favorable biophysical characteristics (described in Example 5, Example 7 and Example 8) were tested for their ADCC efficacy.
- IgGl-005-E430G variants containing the K322E, P329A, P329D, P329K or P329R mutation were applied in an in vitro ADCC assay on Daudi cells with freshly isolated peripheral blood mononuclear cells (PBMC) from three different healthy donors as effector cells.
- PBMC peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- Daudi cells were harvested (5xl0 6 cells/mL), washed (twice in PBS, 1200 rpm, 5 min) and collected in 1 mL RPMI-1640 medium supplemented with 10% DBSI and Pen/Strep, to which 100 ⁇ 51 Cr (Chromium-51; PerkinElmer, Cat # NEZ030002MC) was added. The mixture was incubated in a shaking water bath for 1 hour at 37°C.
- the cells were resuspended in RPMI-1640 medium supplemented with 10% DBSI and and Pen/Strep, counted by trypan blue exclusion and diluted to a concentration of lxlO 5 cells/mL.
- Example 11 The P329D mutation is generally applicable to inhibit complement activation and CDC by IgGl antibodies with mutations for enhanced Fc-Fc interactions
- Example 3 and Example 6 describe that introduction of the P329D mutation in an anti-CD38 mAb IgGl-005 variant containing the E430G mutation for enhanced Fc-Fc interactions, resulted in complete inhibition of CDC activity on Daudi cells.
- introduction of the P329D mutation had the same effect on IgGl-005 variants containing other Fc-Fc-enhancing mutations. Therefore, the P329D mutation was introduced in IgGl-005 variants with the E345R, E345K or E345R/E430G/S440Y (RGY) mutation(s) and tested on Daudi cells for Clq binding and in an in vitro CDC assay.
- Example 12 Biophysical characterization of hexameric IgGl-005- E345R/E430G/S440Y variants containing the K322E or P329D mutation
- K322E and P329D were introduced in IgGl-005-RGY generating IgGl- 005-K322E/E345R/E430G/S440Y (IgGl-005-ERGY) and IgGl-005-
- CE-SDS was performed under reducing and non-reducing conditions.
- IgGl-005-RGY Diebolder et al., Science 2014
- both IgGl-005-ERGY and IgGl-005-DRGY displayed a single molecular species with apparent MW of approximately 150 kDa under non-reducing conditions, while under reducing conditions, a heavy chain with apparent MW of 50 kDa and light chain of 26 kDa were visible (Figure 9B).
- IgGl-005-ERGY and IgGl- 005-DRGY behaved similar to the WT monomeric IgGl assay control antibody, and indicate that hexamerization is disturbed under denaturing CE-SDS conditions, consistent with non-covalent Fc-Fc interactions.
- the biophysical analyses described in this example indicate that introduction of the Clq binding inhibiting mutation P329D or K322E did not block hexamerization of IgGl-005-RGY in solution (HP-SEC, native MS), but completely abolished Clq binding (native MS) .
- the oligomers that were formed by antibody variants IgGl-005-ERGY and IgGl-005-DRGY in solution were formed by non-covalent interactions (CE-SDS) in agreement with the Fc-Fc interactions described for IgGl-005-RGY (Diebolder et al., Science 2014).
- Example 13 Analysis of the efficacy to induce killing by agonistic DR5 antibodies with enhanced Fc-Fc interactions in the presence of the P329D mutation
- Agonistic death receptor 5 (DR5) antibodies can induce killing of DR5-positive tumor cells by activation of the extrinsic apoptosis pathway through DR5 hyperclustering, resulting in recruitment of the adaptor protein Fas-associated protein with death domain (FADD) to the intracellular DR5 death domain, which in turn leads to binding and activation caspase-8 and formation of the DISC (death-inducing signaling complex) that initiates apoptosis.
- FADD Fas-associated protein with death domain
- BxPC-3 A viability assay on BxPC-3 cells was performed in presence or absence of the DCAWHLGELVWCT peptide.
- Adherent BxPC- 3 Adherent BxPC- 3 (ATCC, CRL- 1687) cells were harvested by trypsinization and passed through a cell strainer. Cells were pelleted by centrifugation for 5 minutes at 1,200 rpm and resuspended in culture medium at a concentration of 0.5xl0 5 cells/mL [RPMI 1640 with 25mM Hepes and L-Glutamine (Lonza Cat nr BE12-115F) + 10% DBSI (Life Technologies Cat nr 10371-029) + Pen/Strep (Lonza Cat nr DE17-603E)].
- a sample was incubated with 5 ⁇ staurosporine (Sigma Aldrich, Cat nr S6942). The percentage viable cells was determined in a CellTiter-Glo luminescent cell viability assay (Promega, Cat nr G7571) that quantifies the ATP present, which is an indicator of metabolically active cells. From the kit, 20 ⁇ luciferin solution reagent was added per well and mixed by shaking the plate for 2 minutes at 500 rpm. Next, plates were incubated for 1.5 hours at 37°C.
- % viable cells [(luminescence antibody sample - luminescence staurosporine sample)/(luminescence no antibody sample luminescence staurosporine sample)]*100.
- a viability assay on BxPC-3 cells was performed, essentially as described above. Briefly, BxPC-3 cells that were allowed to adhere overnight (5,000 cells per well) were incubated for 3 days at 37°C with 5 or 10 g/mL final antibody concentration in a total volume of 150 ⁇ _. The percentage viable cells were determined in a CellTiter-Glo luminescent cell viability assay.
- Example 14 Glycosylation profiling of IgGl-005 variants with enhanced Fc-Fc interactions containing the K322E, P329D or P329R mutation
- N-linked glycans of purified antibodies IgGl-005-K322E/E430G, IgGl-005- P329D/E430G and IgGl-005-P329R/E430G were analyzed by Mass Spectrometry.
- IgG samples were incubated with DTT for 1 h at 37°C.
- samples were desalted on an Ultimate 3000 UPLC system (Dionex) by using a 10 min block gradient on a Proswift RP-4H 1 x 250 mm column (Thermo Scientific) at 60°C with MilliQ water (Eluent A) and LC-MS grade acetonitrile (eluent B), both with 0.05% formic acid (Fluka).
- the UPLC system was coupled to a Q-Exactive Plus Orbitrap MS system (Thermo Scientific) equipped with an electrospray ionization HESI source.
- Antibody variants IgGl-005-K322E/E430G, IgGl-005-P329D/E430G and IgGl-005-P329R/E430G all displayed glycosylation profiles similar to those commonly observed for IgGl antibodies expressed in EXPI293 cells, with low levels of mannose-5 or charged species, a high level of fucosylation, and between 10% and 30% of galactosylated species (Table 3). These data suggest that mutations K322E, P329D and P329R did not materially impact the glycosylation profile of IgGl-005- E430G. Table 3: N-linked glycan distribution of lgG1 -005-E430G variants
- Example 15 Pharmacokinetic (PK) analysis of IgG-005 variants with enhanced Fc-Fc interactions containing the K322E, P329D or P329R mutation
- the effect of the K322E, P329D and P329R mutation on the clearance rate of IgGl- 005-E430G was studied in a PK experiment in SCID mice.
- the clearance rate of IgGl-005-K322E/E430G, IgGl-005-P329D/E430G and IgGl-005-P329R/E430G was compared to that of IgGl-005-E430G without CDC-inhibiting mutation and WT IgGl- 005 without the E430G mutation for enhanced Fc-Fc interactions.
- mice in this study were housed in the Central Laboratory Animal Facility (Utrecht, The Netherlands) and handled in accordance with good animal practice as defined by FELASA, in an AAALAC and ISO 9001 :2000 accredited animal facility (GDL). All experiments were performed in compliance with the Dutch animal protection law (WoD) translated from the directives (2010/63/EU) and approved by the Utrecht University animal ethics committee.
- MoD Dutch animal protection law
- mice 11-12 weeks old female SCID (C.B- 17/IcrHan@Hsd-Prkdc ⁇ scid, Envigo) mice (3 mice per group) were injected intravenously with 500 pg antibody (25 mg/kg) in a 210 ⁇ L ⁇ (for IgGl-005- K322E/E430G) or 200 ⁇ (for the other batches) injection volume. 50-100 pL blood samples were collected from the saphenous vein at 10 minutes, 4 hours, 1 day, 2 days, 7 days, 14 days and 21 days after antibody administration. Blood was collected into heparin-containing vials and centrifuged for 10 minutes at 14,000 g .
- Plates were blocked by incubating on a plate shaker for lh at RT with PBS supplemented with 0.2% BSA. After washing, 100 ⁇ _ of the diluted plasma samples were added and incubated on a plate shaker for lh at RT. Plates were washed three times with 300 ⁇ _ PBST and subsequently incubated on a plate shaker for lh at RT with 100 ⁇ _ peroxidase-labeled goat anti-human IgG immunoglobulin (#109-035-098, Jackson, West Grace, PA; 1 : 10.000 in PBST supplemented with 0.2% BSA).
- Examplel6 The effect of P329X mutations on the in vitro CDC efficacy of IgGl-005 variants with enhanced Fc-Fc interactions
- Example 17 The effect of P329R and P329D mutations on the in vitro CDC efficacy of Campath IgG isotype variants with enhanced Fc-Fc interactions
- Example 2 The area under the dose-response curves of three experimental replicates was calculated using a log transformed concentration axis with GraphPad
- IgGl-bl2 (0%) and IgGl-Campath (100%).
- Example18 The effect of mutation K322E on the in vitro CDC efficacy of Campath IgG isotype variants with enhanced Fc-Fc interactions
- the effect of mutation K322E on in vitro CDC efficacy was tested using different IgG isotype variants of the antibody IgGl-Campath-E430G, which has enhanced CDC compared to IgGl-Campath ( Figure 14).
- Different concentrations of purified antibodies range 0.001-30.0 ⁇ g/mL final concentrations were tested in an in vitro CDC assay on Wien 133 cells with 20% NHS essentially as described in Example 2.
- the area under the dose-response curves of three experimental replicates was calculated using a log transformed concentration axis with GraphPad Prism 7.02 and normalized relative to cell lysis measured for isotype control antibody IgGl-b l2 (0%) and IgGl-Campath (100%).
- Example19 The effect of mutations P329R and K322E on the in vitro CDC efficacy of Campath variants with different mutations inducing enhanced Fc-Fc interactions
- Example20 The effect of mutations P329R, P329D and K322E on the in vitro CDC efficacy of anti-CD20 antibodies with enhanced Fc-Fc interactions
- IgGl-l lB8 did not show detectable CDC
- introduction of the mutation E430G that induces enhanced Fc-Fc interactions promoted efficient cell lysis (IgGl-l lB8- E430G, Figure 16).
- Both mutations P329R and K322E limited the CDC activity of IgGl- l lB8-E430G to the background lysis levels observed for non-binding isotype control antibody IgGl bl2.
- IgGl-7D8 was capable of inducing CDC of Wien 133 cells, but the CDC efficacy was stimulated by introduction of Fc-Fc interaction enhancing mutation E430G.
- Introduction of mutation P329R or P329D suppressed CDC activity to levels below that of the wild type parental antibody IgGl-7D8.
- Fc-region independent accessory CDC mediated through B-cell receptor association may contribute to the residual CDC detected for IgGl-7D8-P329R-E430G and IgGl- 7D8-P329D-E430G, which is typical for type I antibodies against CD20.
- Example 21 The effect of K322E or P329X mutations on the in vitro FcvR binding of anti-CD38 antibodies with enhanced Fc-Fc interactions
- Binding of IgGl-005 antibody variants to a monomeric extracellular domain (ECD) of FcyRI and dimeric variants of ECD's of FcyRIIA allotype 131H, FcyRIIA allotype 131R, FcyRIIB, FcyRIIIA allotype 158F, and FcyRIIIA allotype 158V was tested in ELISA assays using purified antibodies.
- 96-well Microlon ELISA plates (Greiner, Germany) were coated overnight at 4°C with His-tagged FcyRI ECD ( 1 ⁇ g/ml) in PBS, washed and blocked with 200 ⁇ / ⁇ PBS/0.2% BSA for 1 h at room temperature (RT).
- 96-well Microlon ELISA plates (Greiner, Germany) were coated overnight at 4°C with goat F(ab')2-anti-human-IgG- F(ab') 2 (Jackson Laboratory, 109-006-097, 1 ⁇ g/ml) in PBS, washed and blocked with 200 ⁇ / ⁇ PBS/0.2% BSA for 1 h at room temperature (RT).
- plates were sequentially incubated with 100 ⁇ of a dilution series of IgGl-005 antibody variants (0.0013-20 ⁇ g/mL in five-fold steps) in PBST/0.2% BSA for 1 h at RT, 100 ⁇ / ⁇ of dimeric, His-tagged, C-terminally biotinylated FcyR ECD variants ( 1 ⁇ g/mL) in PBST/0.2% BSA for 1 h at RT, and with 100 ML/well Streptavidin-polyHRP (CLB, M2032, 1 : 10.000) in PBST/0.2% BSA as detecting antibody for 30 min at RT.
- substitutions P329D, P329K and P329R reduced also FcyRI essentially to background levels, comparable to L234A/L235A/P329G/E430G (AAGG) and L234F/L235E/P329D/E430G (PEDG) .
- variant K322E could potently suppress CDC (Examples 3, 4), but retained binding to all tested FcyR variants.
- Substitutions P329D, P329K and P329R potently inhibited CDC (Examples 3, 6, 11), but in addition also blocked the binding of Fc-Fc enhanced antibodies to all tested FcyR ( Figure 17) .
- Fc-Fc enhanced antibodies containing mutations P329A or P329G retained considerable binding to FcyRI.
- Example 22 The effect of mutation P329R on the in vitro CDC efficacy of anti- CD20+anti-CD52 antibody mixtures with enhanced Fc-Fc interactions
- IgGl-l lB8-E430G-S440K to partially active antibody IgGl-Campath-E430G- K439E restored CDC activity to a level similar to that of IgGl-Campath- E430G+IgGl-l lB8-E430G, while adding IgGl-l lB8-P329R-E430G-S440K to IgGl- Campath- E430G-K439E resulted in a partial recovery of CDC activity when compared to IgGl-Campath-E430G-K439E.
- IgGl-l lB8-E430G-S440K to IgGl-Campath-P329R-E430G-K439E, both of which failed to show detectable CDC activity, recovered approximately 56% cell lysis at saturating target binding.
- adding IgGl- l lB8-P329R-E430G-S440K to IgGl-Campath-P329R-E430G- K439E did not yield CDC activity above background level.
- Example 23 The effect of mutation K322E on the in vitro CDC efficacy of anti-CD20+anti-CD52 antibody mixtures with enhanced Fc-Fc interactions
- the area under the dose-response curves of three experimental replicates was calculated using a log transformed concentration axis with GraphPad Prism 7.02 and normalized relative to cell lysis measured for isotype control antibody IgGl-bl2 (0%) and for the mixture of IgGl-Campath-E430G + IgGl-l lB8-E430G ( 100%).
- Introduction of mutation K439E decreased the CDC efficacy of IgGl-Campath-E430G, while introducing additional mutation K322E to create IgGl- Campath-K322E-E430G-K439E reduced CDC activity to the background level observed for non-binding control IgGl-bl2 ( Figure 19).
- Both single mutation S440K and the double mutation S440K-K322E limited the CDC efficacy of IgGl-l lB8-E430G to background level.
- IgGl-l lB8-E430G-S440K to partially active antibody IgGl-Campath-E430G- K439E restored CDC activity to a level similar to the maximal level observed for IgGl-Campath-E430G+IgGl-l lB8-E430G, while also the combination of IgGl-l lB8- K322E-E430G-S440K with IgGl-Campath-E430G-K439E recovered approximately maximal CDC activity.
- adding IgG l-l lB8- K322E-E430G-S440K to IgGl-Campath-K322E-E430G-K439E yielded a maximal cell lyis of approximately 31%.
- Example 24 Selective killing of different cell lines by anti-CD20+anti-CD52 antibody mixtures with enhanced Fc-Fc interactions
- Example 23 demonstrated that specific combinations of Fc-Fc enhanced CD20- and CD52-directed antibodies could selectively lyse Wien 133 target cells at appreciable levels only if both components were simultaneously present, provided each of the antibodies contained either a K439E or an S440K mutation blocking self- oligomerization via Fc-Fc interactions.
- the selective activity of the mixture compared to its individual components was improved, if direct Clq binding of the anti-CD52 antibody was suppressed by introducing a further K322E mutation (Example 23) or P329R mutation (Example 22).
- Cell lysis was averaged over of three experimental replicates and normalized per cell line relative to the cell lysis measured for isotype control antibody IgGl-bl2 (0%) and for IgGl- Campath-E430G (100%, for REH, U266B1, and Wien 133 cells) or IgGl-l lB8-E430G (100%, for Daudi, Raji, Ramos, and U-698-M cells), depending on which antibody induced the highest lysis.
- the CD52 and CD20 expression at the cell surface of the seven cell lines was detemined by indirect immunofluorescence using QIFIKIT (Biocytex, Cat nr CPOIO).
- the antibody binding capacity (ABC) an estimate for the number of antigen molecules expressed on the plasma membrane, was calculated using the Geometric mean fluorescence intensity of the human antibody-stained cells, based on the equation of the calibration curve (interpolation of unknowns from the standard curve, using GraphPad Software), followed by subtraction of the background determined for wells incubated without primary antibody.
- the number of molecules expressed as ABC was averaged over two independent experiments and is summarized in table 4, ordered by CD52 expression.
- the lysis induced by IgGl-Campath-E430G or IgGl-l lB8-E430G varied with the target expression ( Figure 20) : whereas low CD20 expressing U-266B1 and REH cells were resilient to lysis by anti-CD20 Ab IgGl-l lB8-E430G, they were sensitive to anti-CD52 Ab IgG l-Campath-E430G. In contrast, the low CD52 expressing Daudi cells were resilient to IgGl-Campath-E430G, but sensitive to IgGl-l lB8-E430G.
- IgGl-Campath-E430G or IgGl- l lB8 variants were introduced into IgGl-Campath-E430G or IgGl- l lB8 variants to suppress single agent activity.
- IgGl-Campath-E430G-K439E showed reduced single agent activity on the relatively low CD52 expressing cell lines U-698-M and Raji compared to IgGl- Campath-E430G, but displayed maximal lysis levels similar to IgGl-Campath-E430G for the high CD52 expressing cell lines U-266B1, Wien 133, Ramos, and REH.
- IgGl- Campath-K322E-E430G-K439E Campath-EGE
- single agent activity was eliminated for all seven cell line tested.
- the activity of IgGl- llB8-E430G could already be blocked using only an S440K mutation for all cell lines sensitive to IgGl-l lB8-E430G mediated lysis;
- IgGl-l lB8-EGK, containing K322E, E430G and S440K mutations also displayed single agent activity comparable to background defined by non-binding IgGl-bl2.
- IgGl-Campath-E430G-K439E was mixed with IgGl-l lB8-E430G-S440K, all seven cell lines were lysed, illustrating absence of selectivity.
- a mixture of IgGl-Campath-K322E-E430G-K439E (Campath EGE) and IgGl-l lB8- E430G-S440K showed selective lysis of only those cell lines that displayed surface expression of both CD20 and CD52 at levels above 20,000 copies per cell, i.e. Wien 133, Ramos, U-698-M, and Raji.
- IgGl-Campath-EGE activity could not be restored using an IgGl-b l2-E430G-S440K control antibody that is not recruited to the cell surface.
- U-266B1, REH, and Daudi were not lysed due to the low expression of either CD20 or CD52. This suggests that the recruitment of Clq by IgGl-Campath-EGE is dependent on its hetero-oligomerization with IgGl-l lB8- E430G-S440K.
- CD20 antibody IgGl-l lB8-K322E-E430G-S440K IgGl- 11B8-EGK
- Table 4 summarizes the cell surface expression of CD52 and CD20 of different cell lines expressed as the number of specific antibody binding units per cell, determined using QIFIKIT. Molecules/cell U-266B1 Wien 133 Ramos REH U-698-M Raji Daudi
- Example 25 The effect of K322E or P329R mutations on the activation of OX40 on Jurkat cells by anti-OX40 antibodies with enhanced Fc-Fc interactions
- OX40/CD134 receptors by OX40 ligand can induce the proliferation of T-cells expressing the OX40 receptor (Gramaglia, I., Weinberg, A. D., Lemon, M ., and Croft, M . ( 1998) Ox-40 ligand : a potent costimulatory molecule for sustaining primary CD4 T cell responses. J. Immunol. 161, 6510-6517) .
- the effect of mutations K322E or P329R on OX40/CD 134 signaling was tested using different variants of the anti-OX40 antibody IgG l-SF2 (U . S.
- Patent 2014/0377284 using the OX40 Bioassay Kit (Promega, #CS197704) essentially according to the instructions supplied by the manufacturer.
- Thaw-and-Use GloResponse NFKB-IUC2/OX40 Jurkat cells (Promega, #CS197704), which stably express human OX40 a nd a luciferase reporter gene downstream of an NFAT response element, express luciferase upon OX40 activation .
- 25 ⁇ _ freshly thawed cells were incubated overnight in 96-well white F-bottom Optiplates (Perkin Elmer, # 6005299) in 25 ⁇ _ RPMI 1640 medium (Promega, #G708A) in the presence of 8% serum from different sources detailed below.
- the following day 2.5 ⁇ g/mL (end concentration) antibodies or 1.5 ⁇ g/mL (end concentration) of purified, recombinant OX40 ligand (Biolegend, #555704) were added to the cells in medium to an end volu me of 80 ⁇ _. Cells were incubated for a further 5 hours prior to addition of the Bio-Glo Reagent (Promega, #CS197704).
- Serum sources were Fetal Bovine Serum (FBS, Promega Ref. J 121A), FBS heat-inactivated for 30 min at 56°C, human Clq-depleted serum (Quidel, #A509), human C lq-depleted serum supplemented with human recombinant Clq ( 1.0 ⁇ g/mL end concentration ; Quidel, #A400), or normal human serum (NHS, Sanquin, Ref. M0008AC).
- FBS Fetal Bovine Serum
- FBS Fetal Bovine Serum
- FBS Fetal Bovine Serum
- human Clq-depleted serum Quidel, #A509
- human C lq-depleted serum supplemented with human recombinant Clq 1.0 ⁇ g/mL end concentration ; Quidel, #A400
- normal human serum NHS, Sanquin, Ref. M0008AC
- Recombinant OX40 ligand which was used as a positive control in the OX40 response assay, induced clear response signals relative to the non-binding negative control antibody IgG l-b l2 ( Figure 21).
- OX40 responses induced by test compounds were normalized relative to incubations without antibody (0%) and incubations with OX40 ligand ( 100%).
- Wild type anti-OX40 antibody IgG l-SF2 induced OX40 response levels essentially similar to the negative control antibody IgGl-bl2, regardless the source of serum.
- IgG l-SF2 variants that contained only the E345R mutation, which induces Fc-Fc interactions between antibodies after cell surface binding, induced varying OX40 responses, which exceeded the level of OX40 ligand (> 100%) when Clq was inactivated or depleted ( Figure 21B/D) .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Transplantation (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020197015386A KR20190070977A (ko) | 2016-11-01 | 2017-11-01 | 폴리펩티드 변이체 및 그의 용도 |
| SG11201903693QA SG11201903693QA (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
| CA3041988A CA3041988A1 (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
| CN201780081545.1A CN110461868A (zh) | 2016-11-01 | 2017-11-01 | 多肽变体及其用途 |
| BR112019008702-8A BR112019008702A2 (pt) | 2016-11-01 | 2017-11-01 | polipeptídeo, método de diminuição de uma função fc efetora de um polipeptídeo, composição, método de tratamento, kit de partes, e, uso de um polipeptídeo ou composição. |
| JP2019523105A JP7277363B2 (ja) | 2016-11-01 | 2017-11-01 | ポリペプチド変異体およびその使用 |
| US16/345,044 US20190276549A1 (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
| EP17803807.1A EP3535291A1 (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
| US17/745,667 US20230107363A1 (en) | 2016-11-01 | 2022-05-16 | Polypeptide variants and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DKPA201600674 | 2016-11-01 | ||
| DKPA201600674 | 2016-11-01 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/345,044 A-371-Of-International US20190276549A1 (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
| US17/745,667 Continuation US20230107363A1 (en) | 2016-11-01 | 2022-05-16 | Polypeptide variants and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018083126A1 true WO2018083126A1 (en) | 2018-05-11 |
Family
ID=60450591
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/077971 Ceased WO2018083126A1 (en) | 2016-11-01 | 2017-11-01 | Polypeptide variants and uses thereof |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20190276549A1 (https=) |
| EP (1) | EP3535291A1 (https=) |
| JP (3) | JP7277363B2 (https=) |
| KR (1) | KR20190070977A (https=) |
| CN (1) | CN110461868A (https=) |
| BR (1) | BR112019008702A2 (https=) |
| CA (1) | CA3041988A1 (https=) |
| MA (1) | MA46700A (https=) |
| SG (1) | SG11201903693QA (https=) |
| WO (1) | WO2018083126A1 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020223550A1 (en) * | 2019-04-30 | 2020-11-05 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| WO2021019094A1 (en) | 2019-07-31 | 2021-02-04 | Scancell Limited | Modified fc-regions to enhance functional affinity of antibodies and antigen binding fragments thereof |
| EP3576793A4 (en) * | 2017-02-06 | 2021-03-31 | Dana Farber Cancer Institute, Inc. | COMPOSITIONS AND PROCEDURES FOR ENHANCING ANTIBODY-MEDIATED RECEPTOR SIGNALING |
| CN113710324A (zh) * | 2019-01-23 | 2021-11-26 | 千禧制药公司 | 抗cd38抗体 |
| WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
| US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US11667723B2 (en) | 2020-08-17 | 2023-06-06 | Utc Therapeutics (Shanghai) Co., Ltd. | Lymphocytes-antigen presenting cells co-stimulators and uses thereof |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| WO2024235862A1 (en) | 2023-05-12 | 2024-11-21 | Genmab A/S | Antibodies capable of binding to ox40, variants thereof and uses thereof |
| US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| WO2025114541A1 (en) | 2023-11-30 | 2025-06-05 | Genmab A/S | Antibodies capable of binding to ox40 in combination therapy |
| EP4644413A1 (en) | 2024-05-03 | 2025-11-05 | Genmab B.V. | Binding agents having altered fc-mediated effector functions |
| WO2025228542A1 (en) | 2024-05-03 | 2025-11-06 | Genmab B.V. | Method for co-expression of a plurality of antibodies |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA117901C2 (uk) | 2011-07-06 | 2018-10-25 | Ґенмаб Б.В. | Спосіб посилення ефекторної функції вихідного поліпептиду, його варіанти та їх застосування |
| JP6454547B2 (ja) * | 2011-07-06 | 2019-01-16 | ゲンマブ エー/エス | 抗体重鎖のc末端の修飾による補体依存性細胞傷害の調節 |
| CN109476737A (zh) | 2015-12-01 | 2019-03-15 | 根马布有限公司 | 抗dr5抗体及其使用方法 |
| EP3580233A1 (en) | 2017-02-10 | 2019-12-18 | Genmab B.V. | Polypeptide variants and uses thereof |
| JP7330942B2 (ja) | 2017-03-31 | 2023-08-22 | ジェンマブ ホールディング ビー.ブイ. | 二重特異性抗cd37抗体、モノクローナル抗cd37抗体、およびそれらの使用方法 |
| WO2021262813A1 (en) * | 2020-06-23 | 2021-12-30 | Actinium Pharmaceuticals, Inc. | Dr5 radioimmunotherapy in the treatment of solid cancers |
| CN112851794B (zh) * | 2021-02-04 | 2023-05-23 | 苏州铂维生物科技有限公司 | 一种基于cd271的抗原表位及其应用 |
| WO2023277144A1 (ja) * | 2021-06-30 | 2023-01-05 | 日本メジフィジックス株式会社 | Heg1タンパク質に結合するヒト化抗体および当該抗体と放射性核種との複合体 |
Citations (71)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| WO2002020039A2 (de) | 2000-09-04 | 2002-03-14 | Horst Lindhofer | Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites |
| WO2002031140A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions |
| WO2002030954A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Method of purifying antibody |
| WO2002083180A1 (en) | 2001-03-23 | 2002-10-24 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004035607A2 (en) | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| WO2004043493A1 (en) | 2002-11-14 | 2004-05-27 | Syntarga B.V. | Prodrugs built as multiple self-elimination-release spacers |
| WO2005081711A2 (en) | 2003-11-06 | 2005-09-09 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| WO2006099875A1 (en) | 2005-03-23 | 2006-09-28 | Genmab A/S | Antibodies against cd38 for treatment of multiple myeloma |
| WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US7262028B2 (en) | 2002-07-18 | 2007-08-28 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2008003116A2 (en) | 2006-07-05 | 2008-01-10 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Method for engineering immunoglobulins |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2009017394A1 (en) | 2007-08-01 | 2009-02-05 | Syntarga B.V. | Substituted cc-1065 analogs and their conjugates |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2010062171A2 (en) | 2008-11-03 | 2010-06-03 | Syntarga B.V. | Novel cc-1065 analogs and their conjugates |
| US20100155133A1 (en) | 2005-01-13 | 2010-06-24 | The Wiremold Company | Downward facing receptacle assembly for cable raceway |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US20100226923A1 (en) | 2007-10-15 | 2010-09-09 | Sanofi-Aventis | Antibodies that bind il-4 and/or il-13 and their uses |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010151792A1 (en) | 2009-06-26 | 2010-12-29 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| US7951918B2 (en) | 2006-03-17 | 2011-05-31 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| WO2011069104A2 (en) | 2009-12-04 | 2011-06-09 | Genentech, Inc. | Multispecific antibodies, antibody analogs, compositions, and methods |
| WO2011117329A1 (en) | 2010-03-26 | 2011-09-29 | F. Hoffmann-La Roche Ag | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| CN102250246A (zh) | 2011-06-10 | 2011-11-23 | 常州亚当生物技术有限公司 | 抗VEGF/PDGFRβ双特异性抗体及其应用 |
| WO2011157741A2 (en) | 2010-06-15 | 2011-12-22 | Genmab A/S | Human antibody drug conjugates against tissue factor |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| WO2012025530A1 (en) | 2010-08-24 | 2012-03-01 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a disulfide stabilized - fv fragment |
| WO2012025525A1 (en) | 2010-08-24 | 2012-03-01 | Roche Glycart Ag | Activatable bispecific antibodies |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2013004842A2 (en) | 2011-07-06 | 2013-01-10 | Genmab A/S | Antibody variants and uses thereof |
| WO2013157953A1 (en) | 2012-04-20 | 2013-10-24 | Merus B.V. | Methods and means for the production of ig-like molecules |
| WO2014006217A1 (en) | 2012-07-06 | 2014-01-09 | Genmab B.V. | Dimeric protein with triple mutations |
| WO2014009358A1 (en) | 2012-07-09 | 2014-01-16 | International - Drug - Development - Biotech | Anti-dr5 family antibodies, bispecific or multivalent anti-dr5 family antibodies and methods of use thereof |
| WO2014031646A2 (en) | 2012-08-20 | 2014-02-27 | Gliknik Inc. | Molecules with antigen binding and polyvalent fc gamma receptor binding activity |
| WO2014108198A1 (en) | 2013-01-10 | 2014-07-17 | Genmab B.V. | Human igg1 fc region variants and uses thereof |
| US20140348839A1 (en) | 2011-12-20 | 2014-11-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
| US20140377284A1 (en) | 2013-03-18 | 2014-12-25 | Janssen Pharmaceuticals, Inc. | Humanized anti-cd134 (ox40) antibodies and uses thereof |
| WO2015158867A1 (en) | 2014-04-16 | 2015-10-22 | Ucb Biopharma Sprl | Multimeric fc proteins |
| WO2016130516A1 (en) * | 2015-02-09 | 2016-08-18 | Research Development Foundation | Engineered immunoglobulin fc polypeptides displaying improved complement activation |
| WO2016164480A1 (en) * | 2015-04-07 | 2016-10-13 | Genentech, Inc. | Antigen binding complex having agonistic activity and methods of use |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6737056B1 (en) * | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| TWI687439B (zh) * | 2011-06-30 | 2020-03-11 | 中外製藥股份有限公司 | 異源二聚化多胜肽 |
| HK1209034A1 (en) * | 2012-06-21 | 2016-03-24 | Indiana University Research And Technology Corporation | Incretin receptor ligand polypeptide fc-region fusion polypeptides and conjugates with altered fc-effector function |
| CN105246914B (zh) * | 2013-04-02 | 2021-08-27 | 中外制药株式会社 | Fc区变体 |
| AU2017300794A1 (en) * | 2016-07-22 | 2019-01-24 | Gliknik Inc. | Fusion proteins of human protein fragments to create orderly multimerized immunoglobulin fc compositions with enhanced fc receptor binding |
-
2017
- 2017-11-01 US US16/345,044 patent/US20190276549A1/en not_active Abandoned
- 2017-11-01 JP JP2019523105A patent/JP7277363B2/ja active Active
- 2017-11-01 CA CA3041988A patent/CA3041988A1/en active Pending
- 2017-11-01 SG SG11201903693QA patent/SG11201903693QA/en unknown
- 2017-11-01 KR KR1020197015386A patent/KR20190070977A/ko active Pending
- 2017-11-01 EP EP17803807.1A patent/EP3535291A1/en active Pending
- 2017-11-01 CN CN201780081545.1A patent/CN110461868A/zh active Pending
- 2017-11-01 MA MA046700A patent/MA46700A/fr unknown
- 2017-11-01 WO PCT/EP2017/077971 patent/WO2018083126A1/en not_active Ceased
- 2017-11-01 BR BR112019008702-8A patent/BR112019008702A2/pt active Search and Examination
-
2022
- 2022-05-16 US US17/745,667 patent/US20230107363A1/en active Pending
-
2023
- 2023-05-08 JP JP2023076427A patent/JP7695293B2/ja active Active
-
2025
- 2025-06-06 JP JP2025094622A patent/JP2025124873A/ja active Pending
Patent Citations (80)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4495285B1 (https=) | 1981-10-30 | 1986-09-23 | Nippon Chemiphar Co | |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| USRE35500E (en) | 1989-08-09 | 1997-05-06 | Aberlyn Capital Management Limited Partnership | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| WO2002020039A2 (de) | 2000-09-04 | 2002-03-14 | Horst Lindhofer | Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites |
| WO2002031140A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| WO2002030954A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Method of purifying antibody |
| WO2002083180A1 (en) | 2001-03-23 | 2002-10-24 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US7262028B2 (en) | 2002-07-18 | 2007-08-28 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7829531B2 (en) | 2002-07-31 | 2010-11-09 | Seattle Genetics Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7851437B2 (en) | 2002-07-31 | 2010-12-14 | Seattle Genetics Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7659241B2 (en) | 2002-07-31 | 2010-02-09 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004035607A2 (en) | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| WO2004043493A1 (en) | 2002-11-14 | 2004-05-27 | Syntarga B.V. | Prodrugs built as multiple self-elimination-release spacers |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005081711A2 (en) | 2003-11-06 | 2005-09-09 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20100155133A1 (en) | 2005-01-13 | 2010-06-24 | The Wiremold Company | Downward facing receptacle assembly for cable raceway |
| WO2006099875A1 (en) | 2005-03-23 | 2006-09-28 | Genmab A/S | Antibodies against cd38 for treatment of multiple myeloma |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US7951918B2 (en) | 2006-03-17 | 2011-05-31 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2008003116A2 (en) | 2006-07-05 | 2008-01-10 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Method for engineering immunoglobulins |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2009017394A1 (en) | 2007-08-01 | 2009-02-05 | Syntarga B.V. | Substituted cc-1065 analogs and their conjugates |
| US20100226923A1 (en) | 2007-10-15 | 2010-09-09 | Sanofi-Aventis | Antibodies that bind il-4 and/or il-13 and their uses |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010062171A2 (en) | 2008-11-03 | 2010-06-03 | Syntarga B.V. | Novel cc-1065 analogs and their conjugates |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010151792A1 (en) | 2009-06-26 | 2010-12-29 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| WO2011069104A2 (en) | 2009-12-04 | 2011-06-09 | Genentech, Inc. | Multispecific antibodies, antibody analogs, compositions, and methods |
| WO2011117329A1 (en) | 2010-03-26 | 2011-09-29 | F. Hoffmann-La Roche Ag | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| WO2011157741A2 (en) | 2010-06-15 | 2011-12-22 | Genmab A/S | Human antibody drug conjugates against tissue factor |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| WO2012025530A1 (en) | 2010-08-24 | 2012-03-01 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a disulfide stabilized - fv fragment |
| WO2012025525A1 (en) | 2010-08-24 | 2012-03-01 | Roche Glycart Ag | Activatable bispecific antibodies |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| CN102250246A (zh) | 2011-06-10 | 2011-11-23 | 常州亚当生物技术有限公司 | 抗VEGF/PDGFRβ双特异性抗体及其应用 |
| WO2013004842A2 (en) | 2011-07-06 | 2013-01-10 | Genmab A/S | Antibody variants and uses thereof |
| US20140348839A1 (en) | 2011-12-20 | 2014-11-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
| WO2013157953A1 (en) | 2012-04-20 | 2013-10-24 | Merus B.V. | Methods and means for the production of ig-like molecules |
| WO2014006217A1 (en) | 2012-07-06 | 2014-01-09 | Genmab B.V. | Dimeric protein with triple mutations |
| WO2014009358A1 (en) | 2012-07-09 | 2014-01-16 | International - Drug - Development - Biotech | Anti-dr5 family antibodies, bispecific or multivalent anti-dr5 family antibodies and methods of use thereof |
| WO2014031646A2 (en) | 2012-08-20 | 2014-02-27 | Gliknik Inc. | Molecules with antigen binding and polyvalent fc gamma receptor binding activity |
| WO2014108198A1 (en) | 2013-01-10 | 2014-07-17 | Genmab B.V. | Human igg1 fc region variants and uses thereof |
| US20140377284A1 (en) | 2013-03-18 | 2014-12-25 | Janssen Pharmaceuticals, Inc. | Humanized anti-cd134 (ox40) antibodies and uses thereof |
| WO2015158867A1 (en) | 2014-04-16 | 2015-10-22 | Ucb Biopharma Sprl | Multimeric fc proteins |
| WO2016130516A1 (en) * | 2015-02-09 | 2016-08-18 | Research Development Foundation | Engineered immunoglobulin fc polypeptides displaying improved complement activation |
| WO2016164480A1 (en) * | 2015-04-07 | 2016-10-13 | Genentech, Inc. | Antigen binding complex having agonistic activity and methods of use |
Non-Patent Citations (53)
| Title |
|---|
| "Antibody Engineering Handbook", 1994, CHIJIN SHOKAN |
| "Fundamental Immunology. 2nd ed.", 1989, RAVEN PRESS |
| BARBAS ET AL., J MOL BIOL., vol. 230, no. 3, 5 April 1993 (1993-04-05), pages 812 - 823 |
| BEURSKENS ET AL., METHOD CELLULAR DEPOSITION OF C3B AND C4B, vol. 188, no. 7, 1 April 2012 (2012-04-01), pages 3532 - 3541 |
| C. A. DIEBOLDER ET AL: "Complement Is Activated by IgG Hexamers Assembled at the Cell Surface", SCIENCE, vol. 343, no. 6176, 14 March 2014 (2014-03-14), pages 1260 - 1263, XP055268754, ISSN: 0036-8075, DOI: 10.1126/science.1248943 * |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| COX ET AL., NATURE BIOTECHNOLOGY, vol. 12, 2006, pages 1591 - 1597 |
| CROWE ET AL., CLIN EXP IMMUNOL., vol. 87, no. 1, 1992, pages 105 - 110 |
| DATABASE UniProt [O] Database accession no. P01854 |
| DATABASE UniProt [O] Database accession no. P01857 |
| DATABASE UniProt [O] Database accession no. P01859 |
| DATABASE UniProt [O] Database accession no. P01860 |
| DATABASE UniProt [O] Database accession no. P01861 |
| DATABASE UniProt [O] Database accession no. P01871 |
| DATABASE UniProt [O] Database accession no. P01876 |
| DATABASE UniProt [O] Database accession no. P01877 |
| DATABASE UniProt [O] Database accession no. P01880 |
| DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014 |
| DAVIES ET AL., BIOTECHNOL BIOENG, vol. 74, 2001, pages 288 - 294 |
| DE JONG ET AL., PLOS BIOLOGY, 2015 |
| DELANO ET AL., SCIENCE, vol. 287, no. 5456, 18 February 2000 (2000-02-18), pages 1279 - 1283 |
| DIEBOLDER ET AL., SCIENCE, vol. 343, no. 6176, 14 March 2014 (2014-03-14), pages 1260 - 1263 |
| DIEBOLDER ET AL., SCIENCE, vol. 343, no. 6176, March 2014 (2014-03-01), pages 1260 - 1263 |
| DIMASI, N. ET AL., J MOL BIOL, vol. 393, no. 3, 2009, pages 672 - 692 |
| DUBOWCHIK; WALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123 |
| EDELMAN ET AL., PROC NATL ACAD SCI USA., vol. 63, no. 1, May 1969 (1969-05-01), pages 78 - 85 |
| GOLDENBERG, CALIF. A CANCER JOURNAL FOR CLINICIANS, vol. 44, 1994, pages 43 |
| GRAMAGLIA, I.; WEINBERG, A. D.; LEMON, M.; CROFT, M.: "Ox-40 ligand: a potent costimulatory molecule for sustaining primary CD4 T cell responses", J. IMMUNOL., vol. 161, 1998, pages 6510 - 6517, XP002109418 |
| HAMERS-CASTERMAN, NATURE, vol. 363, 1993, pages 446 |
| HAMILTON ET AL., SCIENCE, vol. 301, 2003, pages 1244 - 1246 |
| HUNTER ET AL., NATURE, vol. 144, 1962, pages 945 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184 |
| JUNGHANS ET AL.: "Cancer Chemotherapy and Biotherapy", 1996, LIPPINCOTT RAVEN, pages: 655 - 686 |
| KABAT ET AL.: "Sequences of proteins of immunological interest", 1991, NIH PUBLICATION |
| LINDHOFER ET AL.: "Pharma/Fresenius Biotech", J IMMUNOL, vol. 155, 1995, pages 219 |
| LIU ET AL., J PHARM SCI, vol. 97, 2008, pages 2426 |
| NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407 |
| OKAZAKI ET AL., JMB, vol. 336, 2004, pages 1239 - 1249 |
| PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219 |
| PASTAN ET AL., CELL, vol. 47, 1986, pages 641 |
| PETTIT ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 42, 1998, pages 2961 - 2965 |
| POTGIETER ET AL., J. BIOTECHNOLOGY, vol. 139, 2009, pages 318 - 325 |
| ROB N. DE JONG ET AL: "A Novel Platform for the Potentiation of Therapeutic Antibodies Based on Antigen-Dependent Formation of IgG Hexamers at the Cell Surface", PLOS BIOLOGY, vol. 14, no. 1, 6 January 2016 (2016-01-06), United States, pages e1002344, XP055268752, ISSN: 1544-9173, DOI: 10.1371/journal.pbio.1002344 * |
| SENTER ET AL., PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 45, 28 March 2004 (2004-03-28) |
| SHEN, J. ET AL., J IMMUNOL METHODS, vol. 318, no. 1-2, 2007, pages 65 - 74 |
| SHIELDS ET AL., J BIOL CHEM, vol. 277, 2002, pages 26733 - 26740 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SHINKAWA ET AL., J BIOL CHEM, vol. 278, 2003, pages 3466 - 3473 |
| UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180 |
| VAN BIJ ET AL., JOURNAL OF HEPATOLOGY, vol. 53, no. 4, October 2010 (2010-10-01), pages 677 - 685 |
| VINK ET AL., METHODS, vol. 65, no. 1, 2014, pages 5 - 10 |
| WANG ET AL., MOL. CELL, 2016 |
| WOYKE ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 45, no. 12, 2001, pages 3580 - 3584 |
Cited By (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220213206A1 (en) * | 2017-02-06 | 2022-07-07 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for augmenting antibody mediated receptor signaling |
| AU2018215673B2 (en) * | 2017-02-06 | 2025-01-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for augmenting antibody mediated receptor signaling |
| EP3576793A4 (en) * | 2017-02-06 | 2021-03-31 | Dana Farber Cancer Institute, Inc. | COMPOSITIONS AND PROCEDURES FOR ENHANCING ANTIBODY-MEDIATED RECEPTOR SIGNALING |
| CN113710324A (zh) * | 2019-01-23 | 2021-11-26 | 千禧制药公司 | 抗cd38抗体 |
| JP2022518282A (ja) * | 2019-01-23 | 2022-03-14 | ミレニアム ファーマシューティカルズ, インコーポレイテッド | 抗cd38結合ドメイン |
| US12312411B2 (en) | 2019-01-23 | 2025-05-27 | Takeda Pharmaceutical Company Limited | Anti-CD38 binding domains |
| CN113710324B (zh) * | 2019-01-23 | 2025-02-14 | 千禧制药公司 | 抗cd38抗体 |
| GB2600834A (en) * | 2019-04-30 | 2022-05-11 | Myeloid Therapeutics Inc | Engineered chimeric fusion protein compositions and methods of use thereof |
| GB2600834B (en) * | 2019-04-30 | 2024-07-17 | Myeloid Therapeutics Inc | Engineered chimeric fusion protein compositions and methods of use thereof |
| WO2020223550A1 (en) * | 2019-04-30 | 2020-11-05 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12595313B2 (en) | 2019-07-31 | 2026-04-07 | Scancell Limited | Modified Fc-regions to enhance functional affinity of antibodies and antigen binding fragments thereof |
| WO2021019094A1 (en) | 2019-07-31 | 2021-02-04 | Scancell Limited | Modified fc-regions to enhance functional affinity of antibodies and antigen binding fragments thereof |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| US11667723B2 (en) | 2020-08-17 | 2023-06-06 | Utc Therapeutics (Shanghai) Co., Ltd. | Lymphocytes-antigen presenting cells co-stimulators and uses thereof |
| US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
| WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| US12410258B2 (en) | 2023-05-12 | 2025-09-09 | Ganmab A/S | Antibodies capable of binding to OX40, variants thereof and uses thereof |
| WO2024235862A1 (en) | 2023-05-12 | 2024-11-21 | Genmab A/S | Antibodies capable of binding to ox40, variants thereof and uses thereof |
| WO2025114541A1 (en) | 2023-11-30 | 2025-06-05 | Genmab A/S | Antibodies capable of binding to ox40 in combination therapy |
| EP4644413A1 (en) | 2024-05-03 | 2025-11-05 | Genmab B.V. | Binding agents having altered fc-mediated effector functions |
| WO2025228844A1 (en) | 2024-05-03 | 2025-11-06 | Genmab B.V. | Binding agents having altered fc-mediated effector functions |
| WO2025228542A1 (en) | 2024-05-03 | 2025-11-06 | Genmab B.V. | Method for co-expression of a plurality of antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7695293B2 (ja) | 2025-06-18 |
| US20190276549A1 (en) | 2019-09-12 |
| US20230107363A1 (en) | 2023-04-06 |
| EP3535291A1 (en) | 2019-09-11 |
| CA3041988A1 (en) | 2018-05-11 |
| JP7277363B2 (ja) | 2023-05-18 |
| KR20190070977A (ko) | 2019-06-21 |
| JP2020502046A (ja) | 2020-01-23 |
| SG11201903693QA (en) | 2019-05-30 |
| JP2023100838A (ja) | 2023-07-19 |
| MA46700A (fr) | 2021-05-19 |
| JP2025124873A (ja) | 2025-08-26 |
| BR112019008702A2 (pt) | 2019-07-16 |
| CN110461868A (zh) | 2019-11-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230107363A1 (en) | Polypeptide variants and uses thereof | |
| US20250326854A1 (en) | Polypeptide variants and uses thereof | |
| JP2022115955A (ja) | 三重変異を有する二量体タンパク質 | |
| US12338289B2 (en) | Antibody variant combinations and uses thereof | |
| US20210107988A1 (en) | Polypeptide variants and uses thereof | |
| JP2019163262A (ja) | 三重変異を有する二量体タンパク質 | |
| JP2023500701A (ja) | 抗体変種の組み合わせおよびその使用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17803807 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3041988 Country of ref document: CA Ref document number: 2019523105 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019008702 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20197015386 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017803807 Country of ref document: EP Effective date: 20190603 |
|
| ENP | Entry into the national phase |
Ref document number: 112019008702 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190429 |