WO2017205852A2 - Protein interfaces - Google Patents

Protein interfaces Download PDF

Info

Publication number
WO2017205852A2
WO2017205852A2 PCT/US2017/034870 US2017034870W WO2017205852A2 WO 2017205852 A2 WO2017205852 A2 WO 2017205852A2 US 2017034870 W US2017034870 W US 2017034870W WO 2017205852 A2 WO2017205852 A2 WO 2017205852A2
Authority
WO
WIPO (PCT)
Prior art keywords
cell
rad51
polypeptide
compound
amino acids
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/034870
Other languages
English (en)
French (fr)
Other versions
WO2017205852A3 (en
Inventor
Charly CHAHWAN
Maria SOLOVEYCHIK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Synthex Inc
Original Assignee
Synthex Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Synthex Inc filed Critical Synthex Inc
Priority to BR112018074472-7A priority Critical patent/BR112018074472A2/pt
Priority to JP2019514203A priority patent/JP7080878B2/ja
Priority to CN201780046940.6A priority patent/CN109562138B/zh
Priority to EP17803737.0A priority patent/EP3463414B1/en
Priority to CN202310203866.1A priority patent/CN116217657A/zh
Priority to AU2017271678A priority patent/AU2017271678B2/en
Priority to CA3025423A priority patent/CA3025423A1/en
Priority to EP23188944.5A priority patent/EP4269427A3/en
Priority to MX2018014366A priority patent/MX2018014366A/es
Priority to US15/683,586 priority patent/US10188691B2/en
Publication of WO2017205852A2 publication Critical patent/WO2017205852A2/en
Publication of WO2017205852A3 publication Critical patent/WO2017205852A3/en
Anticipated expiration legal-status Critical
Priority to US16/215,432 priority patent/US20190216879A1/en
Priority to US17/171,841 priority patent/US12214008B2/en
Priority to AU2021205010A priority patent/AU2021205010B2/en
Priority to JP2022084997A priority patent/JP7479421B2/ja
Priority to AU2022259709A priority patent/AU2022259709A1/en
Priority to JP2024070016A priority patent/JP2024099695A/ja
Priority to AU2024204362A priority patent/AU2024204362A1/en
Priority to US18/975,990 priority patent/US20250177474A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/02Peptides of undefined number of amino acids; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1019Tetrapeptides with the first amino acid being basic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1055Protein x Protein interaction, e.g. two hybrid selection
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/80Vectors or expression systems specially adapted for eukaryotic hosts for fungi
    • C12N15/81Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/502Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
    • G01N33/5023Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects on expression patterns
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12RINDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
    • C12R2001/00Microorganisms ; Processes using microorganisms
    • C12R2001/645Fungi ; Processes using fungi
    • C12R2001/85Saccharomyces
    • C12R2001/865Saccharomyces cerevisiae
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Cancer an uncontrolled proliferation of cells, is a multifactorial disease characterized by tumor formation, growth, and in some instances, metastasis.
  • Current cancer therapies include chemotherapy and targeted therapies, which attempt to destroy cancer cells via apoptosis, necrosis, or proliferative inhibition.
  • Deoxyribonucleic acid (DNA) repair pathways are frequently overexpressed in cancer cells, and can be essential to the proliferation of
  • the present disclosure is directed to methods, compositions, and techniques for the identification and production of protein-protein interaction inhibitors as well as methods, compositions, and techniques for using protein-protein interaction inhibitors.
  • the invention relates to a non-naturally occurring compound which interacts with RAD51 API 's binding site on human RAD51.
  • the compound interacts with at least one of residues 202, 205, and 206 of human RAD51.
  • the compound further interacts with residue 187 of human RAD51.
  • the compound has a binding constant to RAD51 with a Kd value of 10 "4 M or less.
  • the compound comprises a polypeptide.
  • the polypeptide comprises non-naturally occurring amino acids.
  • the polypeptide comprises both (L)- and (D)-amino acids.
  • the polypeptide comprises at least one (D)-amino acid.
  • the compound comprises an amino acid sequence according to formula I, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids.
  • the compound compress an amino acid sequence according to any one of formulas II-IV, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids.
  • the compound comprises an amino acid sequence according to SEQ ID NO.: 1, SEQ ID NO.: 5, SEQ ID NO.: 10, SEQ ID NO. : 66, or SEQ ID NO. :67, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids.
  • the compound is compound 1, compound 5, compound 10, compound 13, or compound 14.
  • the polypeptide is not an antibody.
  • the polypeptide consists of fewer than 30 amino acid residues.
  • the polypeptide consists of 60 or fewer amino acid residues.
  • the polypeptide consists of fewer than 30 amino acid residues.
  • the polypeptide consists of fewer than 20, fewer than 15, or fewer than 10 amino acid residues.
  • the polypeptide further comprises a cell-penetrating peptide sequence.
  • the compound displays at least one of the following characteristics upon binding to RAD51 in a cell: (a) inhibition of assembly of RAD51 monomers on DNA; (b) inhibition of cellular homologous recombination; (c) lack of inhibition of RAD51 ATPase activity; or (d) lowering of RAD51 affinity for Ca2+.
  • the invention relates to a method of inducing cell death, wherein the method comprises contacting the cell with a polypeptide that binds to a eukaryotic recombinase in a cell, wherein the binding of the polypeptide to the eukaryotic recombinase in inhibits binding of the eukaryotic recombinase to a protein in the cell, wherein the cell exhibits an increase in intracellular free calcium concentration upon binding of the polypeptide to the eukaryotic recombinase.
  • the polypeptide comprises an amino acid sequence according to formula I or an invert thereof.
  • the eukaryotic recombinase is RAD51.
  • the protein is BRCA2. In another embodiment, the protein is RAD51AP1. In another embodiment the cell death is apoptotic cell death. In another embodiment, the binding of the polypeptide to a eukaryotic recombinase in the cell sensitizes the cell to a chemotherapeutic. In another embodiment, the method further comprises administering a chemotherapeutic agent. In another embodiment, the chemotherapeutic agent is PD-L1, an anti-PDl agent, or a PARP inhibitor. In another embodiment, the eukaryotic cell is a cancer cell. In another embodiment, the cell is a human cell.
  • the polypeptide induces death of the cell at a rate at least 10-fold greater than in the absence of the polypeptide. In another embodiment, the polypeptide induces death of a cancer cell at a rate greater than that of a non-cancerous cell. In another embodiment, the polypeptide induces death of a cancer cell at a rate at least 10-fold greater than a non-cancerous cell. In another embodiment, the polypeptide induces death of a cancer cell dependent on elevated RAD51 activity at a rate greater than that of a non-cancerous cell.
  • the invention relates to a method of treating a condition associated with aberrant RAD51 activity, comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide which interacts with RAD51 API 's binding site on human RAD51.
  • the compound interacts with at least one of residues 202, 205, and 206 of human RAD51.
  • the compound further interacts with residue 187 of human RAD51.
  • the compound has a binding constant to RAD51 with a Kd value of 10 "4 M or less.
  • the compound comprises a polypeptide.
  • the polypeptide comprises non-naturally occurring amino acids.
  • the polypeptide comprises both (L)- and (D)-amino acids. In another embodiment, the polypeptide comprises at least one (D)-amino acid. In another embodiment the compound comprises an amino acid sequence according to formula I, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids. In another embodiment, the compound comprises an amino acid sequence according to any one of formulas II-IV, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids. In another embodiment, the compound comprises an amino acid sequence according to SEQ ID NO.: 1, SEQ ID NO. : 5, SEQ ID NO.: 10, SEQ ID NO.
  • the polypeptide is not an antibody.
  • the polypeptide consists of fewer than 30 amino acid residues.
  • the peptide consists of 60 or fewer amino acid residues.
  • the polypeptide consists of fewer than 20, fewer than 15, or fewer than 10 amino acid residues.
  • the polypeptide further comprises a cell-penetrating peptide sequence.
  • the compound displays at least one of the following characteristics upon binding to RAD51 in a cell: (a) inhibition of assembly of RAD51 monomers on DNA; (b) inhibition of cellular homologous recombination; (c) lack of inhibition of RAD51 ATPase activity; or (d) lowering of RAD51 affinity for Ca2+.
  • the condition is Bloom's syndrome. In another embodiment, the condition is Bloom's syndrome, Fanconi Anemia, Werner's Syndrome, or Nijmegen Breakage Syndrome.
  • the invention relates to a method of reducing drug resistance in a cell, comprising contacting the cell with a polypeptide that binds RADAPl 's binding site on human RAD51.
  • the compound interacts with at least one of residues 202, 205, and 206 of human RAD51.
  • the compound further interacts with residue 187 of human RAD51.
  • the compound has a binding constant to RAD51 with a Kd value of 10 "4 M or less.
  • the compound comprises a polypeptide.
  • the polypeptide comprises non-naturally occurring amino acids.
  • the polypeptide comprises both (L)- and (D)-amino acids.
  • the polypeptide comprises at least one (D)-amino acid.
  • the compound comprises an amino acid sequence according to formula I, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids.
  • the compound comprises an amino acid sequence according to any one of formulas II-IV, or an invert thereof, wherein any one or more of the amino acids are optionally non-natural amino acids or (D)-amino acids.
  • the compound comprises an amino acid sequence according to SEQ ID NO.: 1, SEQ ID NO. : 5, SEQ ID NO.: 10, SEQ ID NO.
  • the polypeptide is not an antibody.
  • the polypeptide consists of fewer than 30 amino acid residues.
  • the polypeptide consists of 60 or fewer amino acid residues.
  • the polypeptide consists of fewer than 20, fewer than 15, or fewer than 10 amino acid residues.
  • the polypeptide further comprises a cell-penetrating peptide sequence.
  • the compound displays at least one of the following characteristics upon binding to RAD51 in a cell: (a) inhibition of assembly of RAD51 monomers on DNA; (b) inhibition of cellular homologous recombination; (c) lack of inhibition of RAD51 ATPase activity; or (d) lowering of RAD51 affinity for Ca2+.
  • the drug is PD-L1, an anti-PDl agent, or a PARP inhibitor.
  • the drug is melphalan, doxorubicin, adrianmycin, etoposide, camptothecins, mitomycin C, cisplatin, temozolomide, oxaliplatin, carboplatin, or gemcitabine.
  • the invention relates to a method for detecting an interaction between a first test protein and a second test protein in a host cell, comprising: a) expressing in the host cell a first fusion protein comprising the first test protein and a DNA-binding moiety; b) expressing in the host cell a second fusion protein comprising the second test protein and a gene activating moiety; and c) expressing in the host cell a death agent, wherein the cytotoxic reporter is activated by a promoter DNA sequence specific for the DNA binding moiety, wherein interaction between the first protein and the second protein causes the gene activating moiety to activate expression of the cytotoxic reporter.
  • the host cell comprises more than one cytotoxic reporter activated by the promoter DNA sequence specific for the DNA- binding moiety.
  • the host cell comprises: a) genomic DNA encoding the first fusion protein and genomic DNA encoding the second fusion protein; and b) plasmid DNA encoding the cytotoxic reporter.
  • the DNA binding moiety is derived from LexA, cl, Glucocorticoid receptor, TetR, or Ume6.
  • the gene activating moiety is derived from GAL4, B42, VP 16 or Dofl .
  • the cytotoxic reporter is a ribosomally-encoded xenobiotic agent, a ribosomally-encoded poison, a ribosomally-encoded endogenous or exogenous gene that results in severe growth defects upon mild overexpression, a ribosomally-encoded recombinase that excises an essential gene for viability, a limiting factor involved in the synthesis of a toxic secondary metabolite, or any combination thereof.
  • the cytotoxic reporter is Cholera toxin, SpvB toxin, CARDS toxin, SpyA Toxin, HopUl, Chelt toxin, Certhrax toxin, EFV toxin, ExoT, CdtB, Diphtheria toxin, ExoU/VipB, HopPtoE, HopPtoF, HopPtoG, VopF, YopJ, AvrPtoB, SdbA, SidG, VpdA, Lpg0969, Lpgl978, YopE, SptP, SopE2, SopB/SigD, Sip A, YpkA, YopM,
  • the host cell is fungal or bacterial.
  • the method further comprises expressing a test gene in the host cell comprising a DNA sequence that encodes a randomized polypeptide library.
  • the randomized polypeptide library comprises polypeptides 60 or fewer amino acids in length.
  • the randomized polypeptide library comprises polypeptides 30 or fewer amino acids in length.
  • the randomized polypeptide library comprises polypeptides 20 or fewer amino acids in length.
  • the test gene comprises a 3 'UTR of a short protein.
  • the 3'UTR is the 3'UTR of sORFl .
  • the DNA sequence that encodes a randomized polypeptide library encodes a common N-terminal sequence of Methionine- Valine- Asparagine.
  • the DNA sequence that encodes a randomized polypeptide library encodes a common N-terminal stabilization sequence.
  • polypeptides encoded by the randomized peptide library are processed into cyclic peptides in the host cell.
  • polypeptides encoded by the randomized peptide library are processed into cyclic peptides in the host cell by POPB from G. marginata or A. bisporigera.
  • the invention relates to a plasmid vector comprising the nucleotide sequence of SEQ ID NO. : 63.
  • the plasmid vector has a DNA sequence encoding a first polypeptide inserted in frame with TetR-DBD, and a DNA sequence encoding a second polypeptide inserted in frame with Dofl-AD.
  • the invention relates to a host cell, comprising the nucleotide sequence of SEQ ID NO. : 63, or a host cell comprising the nucleotide sequence of SEQ ID NO.: 63 wherein a DNA sequence encoding a first polypeptide is inserted in frame with TetR-DBD, and wherein a DNA sequence encoding a second polypeptide is inserted in frame with Dofl-AD.
  • the invention relates to a library of plasmid vectors, each plasmid vector comprising: a) a DNA sequence encoding a different peptide sequence operably linked to a first switchable promoter; and b) a DNA sequence encoding a cytotoxic reporter under control of a second switchable promoter.
  • the different peptide sequences encodes a common N-terminal stabilization sequence.
  • the DNA sequence encoding a different peptide sequence further encodes a 3'UTR.
  • the different peptide sequence is 60 or fewer amino acids in length.
  • the different peptide sequence is 30 or fewer amino acids in length.
  • the different peptide sequence is 20 or fewer amino acids in length.
  • the N- terminal stabilization sequence is M-V-A.
  • the 3'UTR is derived from sORFl .
  • the different peptide sequences are random.
  • the different peptide sequences are pre-enriched for binding to a target.
  • the invention relates to a library of host cells, each comprising 0 or 1 copy of the plasmid vectors of the plasmid vector library described above.
  • the invention relates to a host cell, expressing: a) a first fusion protein comprising a DNA-binding moiety; b) a second fusion protein comprising a gene activating moiety; c) a cytotoxic reporter, wherein the expression of the cytotoxic reporter is under control of a DNA-binding sequence specific for the DNA-binding moiety; and d) an mRNA comprising a nucleotide sequence encoding a polypeptide of 60 or fewer amino acids, wherein the mRNA comprises a 3'UTR 3' to the polypeptide, and wherein the polypeptide encodes an N-terminal sequence for peptide stabilization.
  • the host cell is fungal or bacterial. In another embodiment, the host cell is a haploid yeast cell. In another embodiment, the host cell is a diploid yeast cell. In another embodiment, the diploid yeast cell is produced by mating a first host cell comprising DNA sequences encoding the first chimeric gene and the second chimeric gene, to a second host cell comprising DNA sequences encoding the cytotoxic reporter and the mRNA comprising a nucleotide sequence encoding a polypeptide. In another embodiment, the host cell is mammalian. [0014] Additional aspects and advantages of the present disclosure will become readily apparent to those skilled in this art from the following detailed description, wherein only illustrative embodiments of the present disclosure are shown and described. As will be realized, the present disclosure is capable of other and different embodiments, and its several details are capable of modifications in various obvious respects, all without departing from the disclosure.
  • FIGURE 1 depicts the effect of Compounds 1, 3, and 5 on SSP-25 cells.
  • FIGURE 2 depicts the effect of Compounds 1 and 5 on SSP-25 and HeLa cells.
  • FIGURE 3 depicts the effect of Compound 1 on SSP-25 and HeLa cells.
  • FIGURE 4 depicts the effect of Compound 1 on SSP-25 cells.
  • FIGURE 5 depicts the effect of Compounds 1 and 2 on SSP-25 cells.
  • FIGURE 6 depicts the effect of etoposide and Compound 1 on GM08505 cells.
  • FIGURE 7 is an illustrative example of a protein-protein integration plasmid.
  • FIGURE 8 is a sequence for the protein-protein integration plasmid (SEQ ID NOS.: 60 AND 61)
  • FIGURE 9 is an illustrative example of a selection and library plasmid.
  • FIGURE 10 is a sequence for the selection and library plasmid (SEQ ID NO.: 62)
  • FIGURE 11 is an illustrative example of a confirmation plasmid.
  • FIGURE 12 is an illustrative example of a platform of the present disclosure to identify a compound that disrupts a protein-protein interaction.
  • FIGURE 13 shows cell killing of SSP-25 cells using Compound 5 using the
  • FIGURE 14 compares cell killing of PC3 cells using Compounds 5 and 6 using the xCELLigence assay.
  • FIGURE 15 shows cell killing of A549 cells by Compound 10 using an xCELLigence assay.
  • the vertical line indicates the time of compound administration, and the cell index (Y- axis) represents cell viability
  • FIGURE 16 shows an example of a curve fit to calculate the IC50 for compound 10 based on the data show in in FIGURE 15.
  • FIGURE 17 shows the full chemical structure of exemplary compounds according to the invention, alongside measurements of their cell-death IC50 on SSP-25 cells.
  • FIGURE 18 shows exemplary compounds according to the invention showing the relative insensitivity of cell-death IC50s to which cell-penetrating peptides are utilized.
  • FIGURE 19 shows the effect of Compound 10 administered intratumorally and intraperitoneally in an in vivo athymic mouse A549 xenograft model.
  • FIGURE 20 shows IC50s of compound 10 in vitro against immortalized cell lines originating from diverse tumor types.
  • FIGURE 21 shows exemplary markush structures encompassing RAD51 -interacting compounds as described herein.
  • FIGURE 22 shows a binding model of an exemplary RAD51 peptide according to the invention bound to RAD51 (as represented by pdb structure 1N0W). Critical residues identified for peptide binding are highlighted. The left panel shows a BRCA2 peptide bound on RAD51 (with the Compound interacting with the highlighted residues around the BRCA2 peptide), the right panel excludes this sequence of BRCA2 and highlights just the Compound interacting residues on RAD51.
  • FIGURE 23 shows a sequence alignment of RAD51 derived from various different species, grouped according to whether RAD51 -interacting peptides according to the invention do or do not bind to SEQ ID NO. : 5 as assessed by a Y2H assay using a RAD51/SEQ ID NO.: 5 pair. Highlighted are variant residues that appear to account for the difference in binding.
  • FIGURE 24 shows an xCELLigence cell death assay on SSP-25 cells, wherein compound 10 is added alone or combined with the calcium chelator BAPTA-AM, demonstrating that addition of BAPTA-AM rescues cell death due to compound 10.
  • FIGURE 25 shows an xCELLigence cell death assay on SSP-25 cells, wherein compound 10 is added alone or combined with the calcium chelator ruthenium red,
  • FIGURE 26 shows an xCELLigence cell death assay on SSP-25 cells, wherein compound 10 or olaparib are added alone or in combination, demonstrating that the combination of compound 10 and olaparib enhances cell death relative to compound 10 or olaparib alone.
  • the present disclosure provides methods for the treatment of cancer using compounds that can bind to proteins involved in the homologous recombination DNA repair pathway.
  • the present compounds can decrease the rate of cellular proliferation in cancer cells, and avoid affecting those cells that do not overexpress proteins specific to the DNA repair pathway.
  • the present compounds can further sensitize cells to chemotherapy, and sensitize those cells that have developed resistance to therapeutics.
  • the compounds disclosed herein can display specificity toward cancer cells harboring specific transcriptional signatures.
  • Cancer is a collection of related diseases characterized by uncontrolled proliferation of cells with the potential to metastasize throughout the body. Cancer can be classified into five broad categories including, for example, carcinomas, sarcomas, lymphomas, leukemias, and adenomas.
  • Carcinomas can arise from cells that cover internal and external parts of the body such as the lung, breast, and colon.
  • Sarcomas can arise from cells that are located in bone, cartilage, fat, connective tissue, muscle, and other supportive tissues.
  • Lymphomas can arise in the lymph nodes and immune system tissues.
  • Leukemias can arise in the bone marrow and accumulate in the bloodstream.
  • Adenomas can arise in the thyroid, the pituitary gland, the adrenal gland, and other glandular tissues.
  • Cancer begins when a cell breaks free from the normal restraints on cell division and begins to grow and divide abnormally. Genetic mutations in the cell can preclude the ability of the cell to control cell division or initiate apoptosis, and can result in uncontrolled growth and division of cells.
  • Oncogenes and tumor suppressor genes can regulate the proliferation of cells. Genetic mutations can affect oncogenes and tumor suppressors, potentially activating or suppressing activity abnormally, further facilitating uncontrolled cell division. Whereas oncogenes assist in cellular growth, tumor suppressor genes slow cell division by repairing damaged DNA and activating apoptosis.
  • Cellular oncogenes that can be mutated in cancer include, for example, Cdkl, Cdk2, Cdk3, Cdk4, Cdk6, c-MYC, EGFR, HER2, K-Ras, PDGFR, Raf kinase, and VEGF.
  • DNA damage can occur as a result of, for example, UV radiation, IR radiation, X-rays, reactive oxygen species, depurination, depyrimidination, single-strand breaks, double-strand breaks, cytosine deamination, 06-m ethyl guanines, base alkylation, cross-linking of DNA, replication errors, or free radicals.
  • Chemical compounds can also cause DNA damage by causing bulky adducts, interstrand crosslinks, intrastrand crosslinks, intercalation between DNA strands, or DNA alkylation.
  • Compounds that can cause DNA damage include, for example, actinomycin- D, benzo[a]pyrenes, cisplatin, daunorubicin, ethidium bromide, nitrogen mustards, methyl methanesulphonate (MMS), N-ethyl-N-nitrosourea (ENU), N-nitroso-N-methylurea (NMU), or psoralens.
  • Mutations or precocious expression of the DNA damage repair pathway can be found in cancer.
  • Genes that can be affected in the DNA damage repair pathway include, for example, ATM, ATRX, BRCAl, BRCA2, ERCCl, FANCB, FANCF, FENl, HMGAl, HMGAl, MDCl, MGMT, MLH1, MSH2, MSH4, Mrel lA, NBS1, NEILl, PARPl, PARP2, PMS2, RAD51, RAD52, RAD54, RAD51AP1, WRN, or XPF.
  • BRCAl and BRCA2 are tumor suppressors that are involved in the cellular DNA damage repair pathway. Both BRCAl and BRCA2 can interact with RAD51, a eukaryotic recombinase involved in DNA repair. Germline mutations in BRCAl or BRCA2 can predispose individuals to various cancers including, for example, breast, ovarian, prostate, lung, and liver cancers. Tumors with BRCA2 mutations can exhibit loss of heterozygosity of the wild-type allele.
  • BRCAl can combine with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCAl -associated genome surveillance complex (BASC). BRCAl can also associate with RNA polymerase II and histone deacetylase complexes. Thus, BRCAl can play a role in transcription, DNA repair of double-stranded breaks, and recombination. BRCAl has cell-cycle dependent localization and can be found in, for the example, the nucleus, cytoplasm, or endoplasmic reticulum.
  • BASC BRCAl -associated genome surveillance complex
  • BRCA2 can maintain genome stability, and both BRCAl and BRCA2 can specifically regulate the homologous recombination pathway for double-strand DNA repair.
  • the BRCA2 protein contains about seven copies of a 70 amino acid motif known as the BRC motif, which can mediate binding to the RAD51 recombinase.
  • RAD51 can perform certain biochemical activities required for homologous recombination and DNA repair, for example, promotion of joint molecule formation and DNA strand exchange between homologous DNA molecules. As a prerequisite for these functions, RAD51 can bind to DNA to form highly ordered nucleoprotein filaments in which the DNA is encased within a protein sheath.
  • RAD51AP1 is a RAD51 accessory protein that can stimulates joint molecule formation through the combination of structure-specific DNA binding and physical contact with RAD51.
  • RAD51 API can protect cells from the adverse effects of DNA double-strand break-inducing agents.
  • BRC3 or BRC4 repeats in BRCA2 and RAD51 can sequester RAD51 in a form that is ready to be localized to sites of DNA damage, and thus become activated for DNA repair.
  • Lack of functional BRCA2, or overexpression of BRCA2 can perturb RAD51 function by, for example, preventing RAD51 from localizing to sites of DNA damage.
  • These damaged sites which can contain double-strand breaks formed at stalled or broken replication forks, or double-strand breaks induced by exogenous agents, can provide the signal for activation of the mammalian SOS repair response. Activation can involve the posttranslational modification of RAD51 or occur via interactions with other repair proteins.
  • the BRC motifs of BRCA2 can bind monomelic or oligomeric forms of RAD51 in a cell cycle-dependent manner and in response to DNA damage.
  • BRCA2 protein can be directly involved in the nuclear transport of RAD51.
  • the pancreatic adenocarcinoma cell line CAP AN- 1 is defective in BRCA2, which can lead to impaired nuclear transportation of RAD51 in CAPAN-1.
  • RAD51 can require BRCA2 for nuclear translocation and proper homologous recombination processes.
  • Double-strand DNA breaks can be caused by, for example, natural and medical radiation and other environmental exposures. Double-strand DNA breaks can also occur when
  • chromosomes exchange genetic material during meiosis and during repair of DNA crosslinks.
  • BRCA1 and BRCA1 play a role in maintaining the stability of the human genome and reducing the likelihood of dangerous gene rearrangements that can lead to malignancies.
  • Cancer treatments using chemotherapy or radiotherapy can target and disrupt the function of the DNA of tumor cells by inducing adducts or DNA double-strand or single-strand breaks. Cancer cells can overcome these therapies by developing resistance mechanisms, which can either be induced or intrinsic to the cancer cells.
  • a high level of homologous recombination can be present in cancer cells due to the overexpression of RAD51.
  • This overexpression of RAD51 can be seen in, for example, breast cancer, pancreatic, NSCLC, mCRPC, AML, ICC, and CML.
  • the overexpression of RAD51 can provide cancer resistance by promoting the repair of double strand breaks induced by chemotherapy.
  • the compounds of the present invention can interfere with the activity of RAD51, or other proteins involved in the DNA damage repair pathway, to resensitize cancer cells to chemotherapy, or to potentiate the effect of chemotherapy.
  • Two-hybrid screening can be used to identify and characterize protein-protein
  • the two-hybrid system was initially developed using yeast as a host organism.
  • bacterial two-hybrid systems can also be used to characterize protein-protein interactions.
  • the present disclosure provides a system that can use a unified yeast and bacterial two-hybrid system in which a single bait expression plasraid is used in both organismai contexts. Additionally, an extensive series of leucine zipper fusion proteins of known affinities can be generated to compare the effi ciency of interaction detection using both systems.
  • the yeast system can produce a quantitative readout over a dynamic range. "Auto-activation" by baits can be less prevalent in the bacterial system.
  • modified expression vectors disclosed herein can be used for expression of a protein of interest in both yeast and bacteria.
  • reporter gene refers to a gene whose expression can be assayed.
  • genes include, for example, LacZ, ⁇ -glucuronidase (GUS), amino acid biosynthetic genes, the yeast LEU2, HIS3, LYS2, or URA3 genes, nucleic acid biosynthetic genes, the mammalian chloramphenicol transacetylase (CAT) gene, the green fluorescent protein (GFP) or any surface antigen gene for which specific antibodies are available.
  • GUS ⁇ -glucuronidase
  • CAT mammalian chloramphenicol transacetylase
  • GFP green fluorescent protein
  • a "promoter” is a DNA sequence located proximal to the start of transcription at the 5' end of an operably linked transcribed sequence.
  • the promoter can contain one or more regulator ⁇ ' elements or modules, which interact in modulating transcription of the operably linked gene. Promoters can come be switchable or constitutive. Switchable promoters allow for reversible induction or repression of operably linked target genes upon administration of an agent. Examples of switchable promoters include but are not limited to the TetO operator and the alcohol dehydrogenase I (ale A) gene promoter. Examples of constitutive promoters include the human beta-actin gene promoter,
  • 'Operably linked describes two macromolecular elements arranged such that modulating the activity of the first element induces an effect on the second element.
  • modulation of the activity of a promoter element can be used to alter or regulate the expression of an operably-linked coding sequence.
  • the transcription of a coding sequence that is operably-linked to a promoter element is induced by factors that activate the promoter's activity; transcription of a coding sequence that is operably-linked to a promoter element is inhibited by factors that repress the promoter's activity.
  • a promoter region is operably-linked to the coding sequence of a protein if transcription of such coding sequence activity is influenced by the activity of the promoter.
  • In frame refers to the proper positioning of a desired sequence of nucleotides within a DNA fragment or coding sequence operably linked to a promoter sequence that results in optimal transcription or translation.
  • Fusion construct refers to recombinant genes that encode fusion proteins.
  • a "fusion protein” is a hybrid protein, i.e., a protein that has been constructed to contain domains from at least two different proteins.
  • a fusion protein is a hybrid protein that possesses (a) transcriptional regulatory domain from a transcriptional regulatory protein, or (b) a DNA binding domain from a DNA binding protein linked to a heterologous protein to be assayed for interaction.
  • the structure of the fusion protein is such that the transcriptional regulatory domain and the DNA binding domain are arranged in a manner that allows both domains to be biologically active.
  • the protein that is the source of the transcriptional regulatory domain is different from the protein that is the source of the DNA binding domain, in other words, the two domains are heterologous to each other.
  • the transcriptional regulator domain of the fusion protein can either activate or repress transcription of target genes, depending on the native biological activity of the domain.
  • the bait proteins of the invention are also fusion proteins encoded by a fusion gene that can contain a protein of interest operably linked to a DNA binding moiety.
  • fusion protein gene refers to a DNA sequence which encodes a fusion protein.
  • a fusion protein gene can further provide transcriptional and translational regulatory elements for the transcriptional and translational control thereof.
  • “Expression” is the process by which the information encoded within a gene is revealed. If the gene encodes a protein, then expression involves both transcription of the DNA into mRNA, the processing of mRNA (if necessary) into a mature mRNA product, and translation of the mature mRNA into protein.
  • a nucleic acid molecule such as a DNA or gene is said to be "capable of expressing" a polypeptide if the molecule contains the coding sequences for the polypeptide and the expression control sequences that, in the appropriate host environment, provide the ability to transcribe, process and translate the genetic information contained in the DM A into a protein product, and if such expression control sequences are operably-linked to the nucleotide sequence that encodes the polypeptide.
  • a "cloning vehicle” is any entity that is capable of delivering a nucleic acid sequence into a host cell for cloning purposes.
  • examples of cloning vehicles include plasmids or phage genomes.
  • a p!asmid that can replicate autonomously in the host cell is especially desired.
  • a nucleic acid molecule that can insert (integrate) into the host cell 's chromosomal DNA is useful, especially a molecule that inserts into the host cell's chromosomal DNA in a stable manner, that is, a manner that allows such molecule to be inherited by daughter cells.
  • a "host cell” as described herein can be a bacterial, fungal, or mammalian cell.
  • Examples of bacterial host cells are E. coli and B. subtilis.
  • Examples of fungal cells are S. cerevisiae and S. pombe.
  • Non-limiting examples of mammalian cells are immortalized mammalian cell lines, such as HE 293, A549, HeLa, or CHO cells, or isolated patient primary tissue cells that have been genetically immortalized (such as by transfection with hTERT).
  • Cloning vehicles are often characterized by one or a small number of endonuclease recognition sites at which such DNA sequences may be cut in a determinable fashion without loss of an essential biological function of the vehicle, and into which DNA may be spliced in order to bring about its replication and cloning.
  • the cloning vehicle can further contain a marker suitable for use in the identification of cells transformed with the cloning vehicle.
  • a marker gene can be a gene that confers resistance to a specific antibiotic on a host cell.
  • vector can be used interchangeably wit “cloning vehicle”.
  • an "expression vehicle” is a vehicle or vector similar to the cloning vehicle but is especially designed to provide an environment that allows the expression of the cloned gene after transformation into the host.
  • One manner of providing such an environment is to include transcriptional and translatioiial regulatory sequences on such expression vehicles, such transcriptional and translational regulatory sequences being capable of being operabiy linked to the cloned gene.
  • Another manner of providing such an environment is to provide a cloning site or sites on such vehicle, wherein a desired cloned gene and a desired expression regulator ⁇ ' element can be cloned.
  • the gene to be cloned is usually operably-linked to certain control sequences such as promoter sequences.
  • Expression control sequences will vary depending on whether the vector is designed to express the operably-linked gene in a prokaryotic or eukaryotic host and can additionally contain transcriptional elements such as enhancer elements, termination sequences, tissue-specificity elements, or translational initiation and termination sites.
  • a "host” refers to any organism that is the recipient of a cloning or expression vehicle.
  • the host may be a yeast cell or a cultured animal cell such as a mammalian or insect cell.
  • the yeast host may be Saccharomyces cerevisiae.
  • a "binding moiety” or a "DNA-binding moiety” is a stretch of amino acids that is capable of directing specific polypeptide binding to a particular DNA sequence (i.e., a "protein binding site”). Also referred to herein as a DNA binding domain, these proteins can be homodimers or monomers that bind DNA in a sequence specific manner. Exemplar ⁇ ' DNA binding domains of the invention include LexA, cl, glucocorticoid receptor binding domains, and the Ume6 domain.
  • a "gene activating moiety” is a stretch of amino acids that is capable of weakly inducing the expression of a gene to whose control region it is bound (one example is an activation domain from a transcription factor).
  • weakly is meant below the level of activation effected by GAL4 activation region II and is preferably at or below the level of activation effected by the B42 activation domain.
  • Levels of activation can be measured using any downstream reporter gene system and comparing, in parallel assays, the level of expression stimulated by the GAL4 region ⁇ -polypeptide with the level of expression stimulated by the polypeptide to be tested.
  • the large and broad surfaces that form the contact interface between two proteins can be potential targets of canonical small molecule inhibitors.
  • the large and broad surfaces can have size limitations, and evolved resistance can occur readily.
  • the specificity of antibodies can be combined with cell permeability in the form of short peptides, for example, peptides of less than 25 residues.
  • Screening for short peptide blockers of protein-protein interaction (PPIs) can be performed using technologies such as phage display or mRNA display; however, these screens are performed in vitro and can require the purification of one of the interacting proteins of interest.
  • secondary screens can be performed to validate that the peptide interferes with the binding interface of the second protein. This secondary screening can further rely upon the proper folding of the proteins and the replication of intracellular biophysical conditions in the assays.
  • a method of the invention can involve the intracellular selection of potent peptide disruptors of PPIs.
  • a model organism for example, Saccharomyces cerevisiae, can be employed, and the coexpression of a PPI of interest with a test gene comprising a DNA sequence that encodes randomized peptide library can allow the selection of unbiased peptides that interfere with a PPI using stringent selection mechanisms.
  • the method can begin with a permutation of a yeast two-hybrid system that can rely on the reconstitution of a transcription factor that requires an interaction between a first test protein fused to a DNA binding domain (DBD) and a second test protein fused to a transcription activation domain (AD) or gene activating moiety.
  • DBD DNA binding domain
  • AD transcription activation domain
  • An efficient interaction between the two proteins of interest can direct RNA polymerase to a specific genomic site, and allow for the expression of a genetic element.
  • the genetic element can be, for example, a gene that encodes a protein that enables an organism to grown on selection media.
  • the selection media can be specific to, for example, ADE2, URA3, TRPI, KAN , or NAT*.
  • Markers that can detect when an interaction is no longer present, for example, disrupted by an external object can be referred to as counter- selection markers, such as the URA3 gene, and can be poor or leaky (easily masked by the selection of mutants that escape the selection). This leakiness of the selection marker can lead to a high false positive rate.
  • a method of the invention can combine a strong negative selection marker with the intracellular stabilization of the production of short peptides to screen for blockers of PPIs.
  • An inducible two-hybrid approach can be employed, which can drive the expression of any one or combination of several cytotoxic reporters (death agents).
  • a method of the invention involving induced expression of a combination of cytotoxic reporters in a two-hybrid system can allow for a multiplicative effect in lowering the false-positive rate of the two-hybrid assay, as all of the cytotoxic reporters must simultaneously be "leaky” to allow for an induced cell to survive ,
  • the cytotoxic reporters can be, for example:
  • SMSNTCDEKTQ SLGVKFLDEYQ SKVKRQIF S GYQ SDIDTHNRI
  • SpvB SEQ ID MLILNGFSSATLALITPPFLPKGGKALSQSGPDGLASITLPLPIS
  • HopPtoE SEQ ID MNRVSGS S S ATWQ AVNDLVEQ VSERTTLSTTGYQT AMGRLN
  • HopPtoF SEQ ID MGNICGTSGSRHVYSPSHTQRITSAPSTSTHVGGDTLTSIHQLS
  • AvrPtoB SEQ ID MAGINGAGPSGAYF VGHTDPEP ASGGAHGS S SGAS S SNSPRLP
  • VpdA SEQ ID MKTKQEVSQQDKLKDSKSSTPLQTKETWFISDALNITFDPYDF
  • GGI YLD SDILC S APFPDEI Y APF GFLL SP W S QGANNTLC DIILC
  • SopE2 SEQ ID MTNITLSTQHYRIHRSDVEPVKEKTTEKDIFAKSITAVRNSFISL
  • a cytotoxic reporter of the invention can be, for example, a ribosomally-encoded xenobiotic agent, a ribosomally-encoded poison, a ribosomally-encoded endogenous or exogenous gene that results in severe growth defects upon mild overexpression, a ribosomally- encoded recombinase that excises an essential gene for viability, or a limiting factor (or multiple factors) that can be involved in the synthesis of a toxic secondary metabolite.
  • the system of the invention can use the reconstitution of a transcription factor mediated by the interaction between a protein fused to an AD, for example, Dofl, and another protein fused to a DBD, for example, TetR.
  • AD for example, Dofl
  • DBD for example, TetR
  • FIGURE 7 a selection and library plasmid (Plasmid 2; FIGURE 9), and a confirmation (Plasmid 3; FIGURE 11) can be used.
  • Plasmid 1 can contain, for example, two restriction sites that enable the integration of two proteins that constitute the PPI of interest.
  • the PPI of interest can involve a pair of domains having known importance for carcinogesis, such as p53-MDM2, RAS-RASRBD, and MYC- MAX.
  • the PPI of interest can also involve the interaction of an oncogene (such as Cdkl, Cdk2, Cdk3, Cdk4, Cdk6, c-MYC, EGFR, HER2, K-Ras, PDGFR, Raf kinase, and VEGF) or a tumor suppressor (such as BRCA1, BRCA2, cyclin-dependent kinase inhibitor 1C, PTEN, pi 6, p27, p53, p73, and Retinoblastoma protein (pRb)) with a known cellular interaction partner.
  • an oncogene such as Cdkl, Cdk2, Cdk3, Cdk4, Cdk6, c-MYC, EGFR, HER2, K-Ras, PDGFR, Raf kinase, and VEGF
  • a tumor suppressor such as BRCA1, BRCA2, cyclin-dependent kinase inhibitor 1C, PTEN, pi 6, p27, p
  • the PPI of interest can involve the interaction of a protein involved in the DNA repair pathway (such as ATM, ATRX, BRCA1, BRCA2, ERCC1, FANCB, FANCF, FEN1, HMGA1, HMGA1, MDC1, MGMT, MLH1, MSH2, MSH4, Mrel lA, NBS1, EIL1, PARPl, PARP2, PMS2, RAD51, RAD52, RAD54, RAD51AP1, WRN, and XPF) with another cellular factor.
  • a protein involved in the DNA repair pathway such as ATM, ATRX, BRCA1, BRCA2, ERCC1, FANCB, FANCF, FEN1, HMGA1, HMGA1, MDC1, MGMT, MLH1, MSH2, MSH4, Mrel lA, NBS1, EIL1, PARPl, PARP2, PMS2, RAD51, RAD52, RAD54, RAD51AP1, WRN, and XPF
  • an N means any possible deoxynucleotide.
  • Plasmid 1 can encode for the fusion of an AD (such as Dofl) or another gene activating moiety and a DBD (such as TetR) to each protein driven by either a strong promoter and terminator (such as ADH1), or by an inducible promoter (such as GAL1).
  • AD such as Dofl
  • DBD such as TetR
  • Other exemplary activation domains include those of VP 16 and B42AD.
  • Other exemplary DBDs include those of GAL4 or LexA.
  • Each protein fusion can be tagged for subsequent biochemical experiments with, for example, a FLAG, HA, or His tag.
  • Plasmid 1 can also include bacterial selection and propagation markers (i.e. ori and AmpR), and yeast replication and selection markers (i.e. TRP1 and CEN or 2um).
  • the plasmid can also be integrated into the genome at a specified locus.
  • the sequence of Plasmid 1 can be:
  • Plasmid 2 can include, for example, a restriction site for integration of a randomized peptide library (such as a randomized N K 60-mer sequences) driven by a strong promoter (such as the ADH1 promoter) or an inducible promoter (such as the GAL1 promoter).
  • the library can also initiate with a fixed sequence of, for example, Methionine Valine Asparagine (MVN; SEQ ID NO.: 66) or another combination of high-half-life N-end residues (see, for e.g.,
  • the peptide can also be tagged with a protein tag such as Myc.
  • Lactococcus lactis (LanB, LanC, LanM, LanP) patellamide biosynthesis factors from
  • cyanobacteria PatD, PatG
  • butelase 1 from Clitoria ternatea
  • POPB Galerina marginata or Amanita bisporigera.
  • Plasmid 2 can additionally encode for one or more of the agents outlined as 'death agents' (e.g. cytotoxic reporters) driven by a promoter which depends on the DBD present in the PPI integration plasmid, for example, the TetO sequence which can become bound by TetR.
  • ' Plasmid 2 can include a silencing construct such as a TetR' -Tup 11 fusion driven by a strong promoter (such as ADH1) to bind the DBD and silence transcription in the presence of doxycycline.
  • Plasmid 2 can include bacterial selection and propagation markers (i.e. ori and AmpR), and yeast replication and selection markers (i.e. LEU2 and CEN or 2um).
  • the sequence of Plasmid 2 can be:
  • AAAGATTC T AC AAT AC T AGC TTTT ATGGTT ATG AAGAGG AAAA ATTGGC AGT AACCT
  • Plasmid 3 can be used to confirm expression of the reporters and the successful construction of the strains. Plasmid 3 can include a direct fusion between the AD and DBD.
  • Plasmid 3 can further include bacterial selection and propagation markers (i.e. ori and AmpR), and yeast replication and selection markers (i.e. TRP1 and CEN or 2um).
  • bacterial selection and propagation markers i.e. ori and AmpR
  • yeast replication and selection markers i.e. TRP1 and CEN or 2um.
  • Plasmid 3 can be:
  • the host cell used for identification of the peptide that disrupts a PPI can be
  • Saccharomyces cerevisiae of either mating type or a diploid and include the genomic integration of genetic reporters (such as ADE2, HIS3, and/or URA3) driven by the recognition sequence of the DBD used in Plasmid 1 (such as TetO).
  • the host cell used for identification of the peptide that disrupts a PPI can also be another host cell as previously described herein, such as a bacterial cell (e.g. E. coli, B. subtilis) or a mammalian cell (e.g. immortalized primary cells or immortalized cell lines).
  • the host cell can also express enzymes necessary for the cyclization and methylation of peptides (e.g.
  • lanthipeptides maturation enzymes from Lactococcus lactis (LanB, LanC, LanM, LanP), patellamide biosynthesis factors from cyanobacteria (PatD, PatG), butelase 1 from Clitoria ternatea, or POPB from Galerina marginata or Amanita bisporigera.
  • Exemplary POPs necessary for cyclization of peptides can also comprise any of the sequences outlined below in Table 2.
  • kits comprising Plasmid 1, Plasmid 2, Plasmid 3, transfectable host cells compatible with Plasmids 1-3, or any combination thereof.
  • Plasmids 1 or 2 are provided already transfected into host cells.
  • kits according to this disclosure include selectable agents for use with host cells transfected with Plasmids 1-3.
  • a library of variants of Plasmid 1 are provided, wherein more than a single pair of Y2H interactors are represented. Such a library can be used to, for example, screen for protein-protein interactions that are inhibited by a defined agent.
  • a library of variants of Plasmid 1 are provided, wherein a plurality of different short test polypeptide sequences for screening are represented.
  • the plurality of different short peptide sequences can be randomly generated by any method (e.g. N K or NNN nucleotide randomization).
  • the plurality of different short peptide sequences can also be preselected, either by previous experiments selecting for binding to a target, or from existing data sets in the scientific literature that have reported rationally-designed peptide libraries.
  • Plasmids 1, 2, and 3 can be used in various permutations.
  • integration of Plasmid 1 into the genome of the host cell (as confirmed using Plasmid 3) can be followed by transformation of a library of Plasmid 2 with randomly encoded peptides using, for example, NNK or NNN codons.
  • the host cell 1 can be propagated in selection media to ensure the presence of Plasmid 1 and that a faithful PPI is occurring (e.g. on media lacking Trp for yeast, or in media containing antibiotic for human or bacterial cells). This host cell can then be transformed with Plasmid 2, and immediately be transferred to selection media to ensure all components are present (i.e. on media lacking Trp and Leu for yeast, or antibiotics for bacterial or mammalian cells), and are inducing expression of any inducible component (e.g. with Gal, doxycycline, etc).
  • any inducible component e.g. with Gal, doxycycline, etc.
  • the plasmids can be used as a 'plug and play platform' utilizing the yeast mating type system (FIGURE 12), where the 2 or more plasmids (or the genetic elements therein) can be introduced into the same cell by cell fusion or cell fusion followed by meiosis instead of transfection.
  • This cell fusion involves two different yeast host cells bearing different genetic elements.
  • yeast host cell 1 can be one of MAT a or MAT alpha and include an integration of Plasmid 1. This strain can be propagated on positive selection media to ensure a faithful PPI is present.
  • the yeast host cell 2 is of the opposite mating type.
  • This strain carries (or has integrated) the randomized peptide library and 'death agent' (e.g. cytotoxic reporter) plasmid (Plasmid 2).
  • Yeast host cell 2 can be generated via large batch high efficiency transformation protocols which ensure a highly diversified library variation within the cell culture. Aliquots of this library batch can then be frozen to maintain consistency.
  • the strains are mated in batch to result in a diploid strain that carries all the markers, the PPI, 'death agents' and peptide.
  • This batch culture then can be propagated on solid medium that enables selection of all the system components (i.e. media lacking Leu and Trp), and inducing expression of any inducible component (i.e. with Gal).
  • the inducible marker can be used to inactivate the production of either the PPI or the peptide and confirm specificity. For example, observation of cell survival only on media with galactose wherein all the components are expressed, and no survival on media without galactose when expression of the peptide is lost.
  • the plasmid can also be isolated and re-transformed into a fresh host cell to confirm specificity. Biochemical fractionation of the viable host cells which contains the PPI, peptide and 'death agent' followed by pull-down experiments can confirm an interaction between the peptide sequence and either PPI partner using the encoded tags (e.g. Myc-tag, HA-tag, His-tag).
  • encoded tags e.g. Myc-tag, HA-tag, His-tag.
  • non-naturally occurring compounds that can bind to a protein interface of RAD51 and inhibit the function of RAD51 in vitro or in cells.
  • the protein interface can be a subregion of the ATPase domain of RAD51.
  • the protein interface can be RAD51APl 's binding site on RAD51.
  • the protein interface can be amino acid residues 190-218 of human RAD51.
  • An exemplary model of a protein interface where non-naturally occurring compounds according to the invention can bind on RAD51 is presented in Figure 22, wherein compound interacts with residues highlighted in black. Gray shows the binding of BRCA2 to RAD51..
  • compounds as disclosed herein can inhibit RAD51 multimerization, RAD51 interaction with another known interacting partner of RAD51 (e.g. BRCA2 or RAD51AP1), or RAD51 chelati on/binding of Ca2+ ions.
  • the inhibition of interaction with another known interacting partner of RAD51 may be competitive or allosteric.
  • Inhibition of RAD51 multimerization, RAD51 interaction with another known interacting partner of RAD51 (e.g. BRCA2 or RAD51AP1), or RAD51 chelation/binding of Ca2+ ions may be accompanied by inhibition of RAD51 ATPase activity.
  • Inhibition of RAD51 multimerization, RAD51 interaction with another known interacting partner of RAD51 (e.g. BRCA2 or RAD51AP1), or RAD51 chelation/binding of Ca2+ ions may be without inhibition of RAD51 ATPase activity.
  • another known interacting partner of RAD51 e.g. BRCA2 or RAD51AP1
  • RAD51 chelation/binding of Ca2+ ions may be without inhibition of RAD51 ATPase activity.
  • compounds as disclosed herein can inhibit assembly of RAD51 filaments on DNA.
  • compounds as disclosed herein can inhibit DNA damage repair.
  • compounds as disclosed herein can inhibit cellular homologous recombination.
  • compounds as disclosed herein can result in sensitization to genotoxic chemotherapeutics of cancer cells.
  • compounds as disclosed herein can reduce drug resistance to
  • chemotherapeutic agents either through inhibition of DNA damage repair, or through inducing cellular stress through increase in intracellular free calcium concentration.
  • compounds as disclosed herein can result in cell death.
  • compounds as disclosed herein may cause death in cellular conditions depending on RAD51 overexpression.
  • cells can be cancer cells or cells of patients with inheritable benign proliferative disorders (e.g. Cowden's syndrome).
  • any of the compounds disclosed herein can be used in combination with, for example, immuno-oncology agents or PARP inhibitors, or other chemotherapeutics for the purpose of inducing cell death.
  • the compounds disclosed herein can be used in methods of treatment of a disorder or condition where cell growth inhibition occurs by downregulation of homologous recombination, or where there is overexpression of proteins involved in the DNA damage repair pathway.
  • the compounds disclosed herein can be used in methods of treatment of a disorder or condition associated with aberrant RAD51 activity.
  • the interface of RAD51 that can be targeted by a compound of the invention can be important for the control of the activity of the BRCAl/2 homologous recombination DNA repair pathway. Blocking of this interface important for the control of the activity of the BRCAl/2 homologous recombination DNA repair pathway with the compounds disclosed herein can have clinical relevance for several therapeutic indications.
  • a compound disclosed herein can be used as a monotherapy for the treatment of, for example, intrahepatic cholangiocarcinoma (ICC), metastatic castration-resistant prostate cancer (mCRPC), and other cancers that display upregulation of effectors of the RAD51/BRCA2 DNA damage repair pathway.
  • ICC intrahepatic cholangiocarcinoma
  • mCRPC metastatic castration-resistant prostate cancer
  • other cancers that display upregulation of effectors of the RAD51/BRCA2 DNA damage repair pathway.
  • ICC cells can depend on the BRCA2 pathway for survival and render subjects untreatable.
  • the inactivation of the homologous recombination pathway through RAD51 disrupting compounds can lead to cell death.
  • This cell death can be selective for cells that depend on the BRCA2 pathway such as ICC cells.
  • An example of this kind of selectivity is demonstrated in Figure 2, wherein both HeLa cells (cervical cancer cells) and SSP-25 cells (ICC-derived cells) are treated with compounds 1 and 5 and little cell death is generated in the HeLa cells compared to the SSP-25 cells upon compound treatment
  • hepatocellular carcinoma hepatocellular carcinoma
  • AML acute myeloid leukemia
  • aggressive mantle cell lymphoma ovarian cancer
  • imatinib-resistant BCR/ABL cancers include, for example, hepatocellular carcinoma, acute myeloid leukemia (AML), aggressive mantle cell lymphoma, ovarian cancer, and imatinib-resistant BCR/ABL cancers.
  • the mechanism of action of the compounds disclosed herein can involve, for example, dislodging a pair of calcium ions coordinated by the RAD51 polymer in an acute manner leading to an acute intracellular free calcium concentration increase.
  • the increase in the intracellular free calcium concentration can lead to cell death.
  • This mechanism of cell death can occur in cells overexpressing the RAD51 protein, and the cell death can be orders of magnitude higher than cells without RAD51 overexpression.
  • the cell death in cells contacted with compounds disclosed herein that overexpress the RAD51 protein may be at least 3, at least 10, at least 50, or at least 100 times greater than in cells contacted with compounds disclosed herein that do not overexpress RAD51.
  • the mechanism of action of the compounds disclosed herein in cell death can involve inactivation of the recombination pathway through RAD51 alongside increases in cellular free calcium concentration.
  • the mechanism of action of the compounds in cell death can involve increases in cellular free calcium concentration without inhibition of the recombination pathway through RAD51.
  • the mechanism of action of the compounds in cell death can involve inhibition of RAD51 ATPase activity alongside increases in cellular free calcium concentration.
  • the mechanism of action of the compounds in cell death can involve increases in cellular free calcium concentration without inhibition RAD51 ATPase activity.
  • the compounds can also be used in the treatment of rare and orphan diseases including, for example, Bloom's syndrome, Fanconi Anemia, Werner's Syndrome, and Nijmegen Breakage Syndrome, which can display an increase in homologous recombination in their patients' cells.
  • Downregulation of recombination by administration of RAD51 disrupting compounds as disclosed herein to individuals cells can reverse the DNA damage hypersensitivity of the cells.
  • Downregulation of recombination by contact of the RAD51 disrupting compounds as disclosed herein to the cells can reverse the DNA damage hypersensitivity of the cells.
  • An example of this phenomenon can be seen in Figure 6, where compound 5 is able to rescue the
  • the compounds can also be used in combination with other therapeutic agents including, for example, immuno-oncology agents, PARP inhibitors, and canonical chemotherapeutics.
  • other therapeutic agents including, for example, immuno-oncology agents, PARP inhibitors, and canonical chemotherapeutics.
  • metastatic melanoma patients who are responsive to anti-PDl therapy can be highly enriched for somatic mutations in the BRCA2 gene within the patient tumors. This correlation can indicate that inactivation of the BRCA2 pathway sensitizes cells to anti-PDl immunotherapy.
  • the anti-PDl agents can be, for example, nivolumab, pembrolizumab, or pidilizumab.
  • An example of synergy of compounds as described herein with other therapeutic agents targeting the BRCA pathway can be seen in Figure 26, where co-administration of compound 10 and
  • Olaparib (a PARP inhibitor) cause enhanced cell death relative to either alone.
  • PARP inhibitors can exhibit potent and selective activity against BRCA1 and BRCA2 mutated breast, ovarian, and other cancers.
  • the use of a RAD51 -disrupting compound can mimic the effects of a BRCA2 mutation and can potentially render a wider array of cancers treatable by PARP inhibitors.
  • the PARP inhibitors can be, for example, olaparib, veliparib, niraparib, talazoparib, rucaparib, and CEP-9722.
  • a compound disclosed herein can be used in combination with other chemotherapeutic agents.
  • the chemotherapeutic agents can include, for example, anti-PDl agents, pembrolizumab, melphalan, doxorubicin, adrianmycin, etoposide, camptothecins, mitomycin C, cisplatin, oxaliplatin, carboplatin, or gemcitabine.
  • the compounds can be, for example, small molecules, biologies, antibodies,
  • the compound may be a peptide.
  • the compounds disclosed herein can harbor a cell penetration entity (CPP) or a protein transduction domain (PTD) to facilitate entry into the target cell.
  • CPP cell penetration entity
  • PTD protein transduction domain
  • Protein transduction can refer to the delivery of peptides, proteins, and other molecules across cytoplasmic membranes into cells.
  • the compounds can include at least one cell-penetration peptide (CPP) signal sequence.
  • CPPs examples include HIV-TAT (GRKKRRQRRRPPQ; SEQ ID NO.: 13), R8
  • Any of the peptide compounds referred to herein can be N-terminally (e.g. alpha-amine) acetylated, C-terminally amidated, or backbone N-methylated. Any of the compounds referred to herein can be modified to include a 5FAM (Fluorescein amidite) label linked via a 6 carbon chain to the epsilon amino group of a lysine residue. Examples of compounds according to the invention that encompass various amino acid chemical modifications and display activity against SSP25 cells can be seen in Figure 17.
  • 5FAM Fluorescein amidite
  • the peptides disclosed herein can also be stabilized by conversion to peptidomimetic entities.
  • a peptidomimetic can be a polymer encompassing amino acid residues joined together through amide bonds.
  • Such stabilization approaches can include, for example, cyclization to macrocycles, lactam esterification, N-methylation of the backbone residues, hydrocarbon stapling, and combinations thereof.
  • Retro-inverso peptides are linear peptides whose amino acid sequence is reversed and the alpha-carbon-center chirality of the amino acid subunits is inverted as well. Such a modification is known to increase stability of peptides when the original peptide is an (L)-peptide.
  • a compound of the invention can have, for example, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,
  • a compound of the invention is not an antibody.
  • a compound of the invention is an antibody, or a functional binding fragment/derivative thereof (e.g. a Fab fragment or an ScFv).
  • a compound of the invention can contain a RAD51 interacting motif with the following consensus sequence: R-L-G-L/M/V-S-R-R/L/K-R/F/V (SEQ ID NO.: 19).

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Biotechnology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Plant Pathology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Bioinformatics & Computational Biology (AREA)
PCT/US2017/034870 2016-05-27 2017-05-26 Protein interfaces Ceased WO2017205852A2 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
BR112018074472-7A BR112018074472A2 (pt) 2016-05-27 2017-05-26 interfaces proteicas
JP2019514203A JP7080878B2 (ja) 2016-05-27 2017-05-26 タンパク質界面
CN201780046940.6A CN109562138B (zh) 2016-05-27 2017-05-26 蛋白质界面
EP17803737.0A EP3463414B1 (en) 2016-05-27 2017-05-26 Protein interfaces
CN202310203866.1A CN116217657A (zh) 2016-05-27 2017-05-26 蛋白质界面
AU2017271678A AU2017271678B2 (en) 2016-05-27 2017-05-26 Protein interfaces
CA3025423A CA3025423A1 (en) 2016-05-27 2017-05-26 Protein interfaces
EP23188944.5A EP4269427A3 (en) 2016-05-27 2017-05-26 Protein interfaces
MX2018014366A MX2018014366A (es) 2016-05-27 2017-05-26 Interfaces de proteina.
US15/683,586 US10188691B2 (en) 2016-05-27 2017-08-22 Protein interfaces
US16/215,432 US20190216879A1 (en) 2016-05-27 2018-12-10 Protein interfaces
US17/171,841 US12214008B2 (en) 2016-05-27 2021-02-09 Protein interfaces
AU2021205010A AU2021205010B2 (en) 2016-05-27 2021-07-13 Protein interfaces
JP2022084997A JP7479421B2 (ja) 2016-05-27 2022-05-25 タンパク質界面
AU2022259709A AU2022259709A1 (en) 2016-05-27 2022-10-24 Protein interfaces
JP2024070016A JP2024099695A (ja) 2016-05-27 2024-04-23 タンパク質界面
AU2024204362A AU2024204362A1 (en) 2016-05-27 2024-06-26 Protein interfaces
US18/975,990 US20250177474A1 (en) 2016-05-27 2024-12-10 Protein interfaces

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662342840P 2016-05-27 2016-05-27
US62/342,840 2016-05-27
US201662384226P 2016-09-07 2016-09-07
US62/384,226 2016-09-07

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/683,586 Continuation US10188691B2 (en) 2016-05-27 2017-08-22 Protein interfaces

Publications (2)

Publication Number Publication Date
WO2017205852A2 true WO2017205852A2 (en) 2017-11-30
WO2017205852A3 WO2017205852A3 (en) 2018-01-25

Family

ID=60411842

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/034870 Ceased WO2017205852A2 (en) 2016-05-27 2017-05-26 Protein interfaces

Country Status (9)

Country Link
US (4) US10188691B2 (https=)
EP (2) EP3463414B1 (https=)
JP (3) JP7080878B2 (https=)
CN (2) CN109562138B (https=)
AU (4) AU2017271678B2 (https=)
BR (1) BR112018074472A2 (https=)
CA (1) CA3025423A1 (https=)
MX (2) MX2018014366A (https=)
WO (1) WO2017205852A2 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10188691B2 (en) 2016-05-27 2019-01-29 Synthex, Inc. Protein interfaces
WO2019104244A1 (en) * 2017-11-22 2019-05-31 Synthex, Inc. Peptides for inhibiting rad51
US11306306B1 (en) 2019-05-15 2022-04-19 Synthex, Inc. Selective degradation of proteins
US11840743B2 (en) 2017-11-16 2023-12-12 Synthex, Inc. Selective modulation of protein-protein interactions

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020223601A1 (en) * 2019-05-01 2020-11-05 Innate Biologics Llc Immunomodulatory compositions and methods
JP2023145812A (ja) * 2020-08-17 2023-10-12 国立大学法人東海国立大学機構 人工タンパク質、Ras阻害剤及び抗がん剤

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6037125A (en) 1996-11-05 2000-03-14 Lexicon Genetics Incorporated Disruption of the mammalian RAD51 protein and disruption of proteins that associate with mammalian RAD51 for hindering cell proliferation and/or viability of proliferating cells

Family Cites Families (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69636866D1 (en) 1995-04-11 2007-03-15 Gen Hospital Corp Reverse "two-hybrid"-systeme
US5733726A (en) 1995-06-07 1998-03-31 Emory University Cytotoxicity-based genetic selection system (TOXSEL)
US5925523A (en) 1996-08-23 1999-07-20 President & Fellows Of Harvard College Intraction trap assay, reagents and uses thereof
WO1998007845A1 (en) 1996-08-23 1998-02-26 President And Fellows Of Harvard College Interaction trap assay, reagents and uses thereof
US6303302B1 (en) 1997-11-19 2001-10-16 The Whitehead Institute For Biomedical Research Regulation of fungal gene expression
CA2417135C (en) 1997-11-19 2005-04-12 Microbia, Inc. Chimeric pre-activated transcription factors
CA2310624A1 (en) 1997-11-19 1999-05-27 Microbia, Inc. Chimeric pre-activated transcription factors
CA2317816C (en) 1998-01-09 2009-02-17 Tvw Telethon Institute For Child Health Research Peptide detection method
CA2325447C (en) 1998-03-26 2007-08-21 Glaxo Group Limited Assay methods
US6332897B1 (en) 1998-03-27 2001-12-25 Glaxo Wellcome Inc. Assay methods
US6114111A (en) 1998-03-30 2000-09-05 Rigel Pharmaceuticals, Inc. Mammalian protein interaction cloning system
US6316223B1 (en) 1998-03-30 2001-11-13 Rigel Pharmaceuticals, Inc. Mammalian protein interaction cloning system
DE19901008A1 (de) * 1999-01-13 2000-07-20 Deutsches Krebsforsch Peptide zur Inhibierung von HPV E6-Proteinen
AU3733100A (en) 1999-03-09 2000-09-28 Lexicon Genetics Incorporated Compounds that disrupt mammalian rad51 activity
US7270969B2 (en) * 1999-05-05 2007-09-18 Phylogica Limited Methods of constructing and screening diverse expression libraries
AU783233B2 (en) 1999-06-07 2005-10-06 Tet Systems Holding Gmbh & Co. Kg Novel TET repressor-based transcriptional regulatory proteins
US6790607B1 (en) 1999-10-07 2004-09-14 Hybrigen, Inc. Adjustable sensitivity, genetic molecular interaction systems, including protein-protein interaction systems for detection and analysis
CA2386258A1 (en) 1999-10-07 2001-04-12 Hybrigen, Inc. Adjustable sensitivity, genetic molecular interaction systems, including protein-protein interaction systems for detection and analysis
US20020086840A1 (en) 2000-01-26 2002-07-04 Zarling David A. Use of Rad51 inhibitors for p53 gene therapy
AU2001247296A1 (en) 2000-03-06 2001-09-17 Rigel Pharmaceuticals, Inc. In vivo production of cyclic peptides
US7566765B2 (en) 2000-03-06 2009-07-28 Rigel Pharmaceuticals, Inc. Heterocyclic compounds containing a nine-membered carbon-nitrogen ring
US7252952B2 (en) 2000-03-06 2007-08-07 Rigel Pharmaceuticals, Inc. In vivo production of cyclic peptides for inhibiting protein—protein interaction
US7378248B2 (en) 2000-03-06 2008-05-27 Rigel Pharmaceuticals, Inc. In vivo production of cyclic peptides for inhibiting protein-protein interaction
EP1268842B1 (en) 2000-03-08 2006-06-21 Phylogica Limited Improved reverse n-hybrid screening method
US20030211495A1 (en) 2000-03-08 2003-11-13 Richard Hopkins Reverse n-hybrid screening method
AU2001245584B2 (en) 2000-03-08 2007-02-08 Phylogica Limited Improved reverse n-hybrid screening method
GB0006572D0 (en) 2000-03-17 2000-05-10 Isis Innovation Novel transcription transactivator protein
WO2003013488A2 (en) 2001-08-09 2003-02-20 Pangene Corporation Methods and compositions for inhibiting rad51
US20030229004A1 (en) 2002-03-20 2003-12-11 Pangene Corporation Modulation of tumor cells using BER inhibitors in combination with a sensitizing agent and DSBR inhibitors
WO2004042064A2 (en) * 2002-11-07 2004-05-21 Imperial College Innovations Limited Disorders of lipid metabolism
JP2004215624A (ja) * 2003-01-17 2004-08-05 Celestar Lexico-Sciences Inc 相互作用インヒビターの検出方法、相互作用インヒビターライブラリーおよびインヒビター検出キット
ITMI20030821A1 (it) * 2003-04-18 2004-10-19 Internat Ct For Genetic En Gineering And Polipeptidi chimerici e loro uso.
US20060003391A1 (en) * 2003-08-11 2006-01-05 Ring Brian Z Reagents and methods for use in cancer diagnosis, classification and therapy
JP2005095613A (ja) 2003-09-04 2005-04-14 Taiyo Parts Kk 昇降装置
CN1905864B (zh) * 2003-12-01 2011-04-06 库多斯药物有限公司 用于治疗癌症的dna损伤修复抑制剂
WO2005095613A1 (ja) 2004-03-30 2005-10-13 Genomidea Inc. Rad51の発現抑制剤、該発現抑制剤を有効成分として含む医薬、及びその使用
WO2006052391A2 (en) 2004-10-14 2006-05-18 Rigel Pharmaceuticals, Inc. Heterocyclic inhibitors of ires-mediated translation and methods of use thereof
RU2446796C2 (ru) 2006-12-26 2012-04-10 Фармасайкликс, Инк. Способ использования ингибиторов гистондеацетилазы и мониторинга биомаркеров в комбинированной терапии
US7892823B2 (en) 2007-02-06 2011-02-22 Geneprotech, Inc. Methods and systems for high homologous recombination (“HR”) targeting efficiency
US8759089B2 (en) 2007-02-06 2014-06-24 Geneprotech, Inc. Methods and systems for high homologous recombination (“HR”) targeting efficiency
US8105493B2 (en) 2007-06-29 2012-01-31 Jnc Corporation Aggregation and dispersion methods of magnetic particles, separation and detection methods using the same and detection kit
WO2009018219A2 (en) 2007-07-28 2009-02-05 University Of Chicago Methods and compositions for modulating rad51 and homologous recombination
US9518097B2 (en) 2007-11-09 2016-12-13 Board Of Trustees Of Michigan State University Identification and use of genes encoding amatoxin and phallotoxin
US9273100B2 (en) 2007-11-09 2016-03-01 Board Of Trustees Of Michigan State University Use of Galerina marginata genes and proteins for peptide production
WO2012019157A2 (en) 2010-08-06 2012-02-09 The Regents Of The University Of California Expression and purification of fusion protein with multiple mbp tags
US9249410B2 (en) 2010-12-15 2016-02-02 The Johns Hopkins University Two-hybrid based screen to identify disruptive residues at multiple protein interfaces
AU2012275841A1 (en) * 2011-06-27 2014-01-16 The Jackson Laboratory Methods and compositions for treatment of cancer and autoimmune disease
US10912761B2 (en) 2012-11-30 2021-02-09 The University Of Chicago Methods and compositions involving RAD51 inhibitors
US20170014360A1 (en) 2014-03-10 2017-01-19 The University Of Chicago Methods of treating cancer using rad51 small molecule stimulators
WO2016140971A1 (en) 2015-03-02 2016-09-09 The Regents Of The University Of California Novel rad51 inhibitors and uses thereof
WO2017205852A2 (en) 2016-05-27 2017-11-30 Synthex, Inc. Protein interfaces
GB2584211B (en) 2017-11-16 2023-05-24 Synthex Inc Selective modulation of protein-protein interactions

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6037125A (en) 1996-11-05 2000-03-14 Lexicon Genetics Incorporated Disruption of the mammalian RAD51 protein and disruption of proteins that associate with mammalian RAD51 for hindering cell proliferation and/or viability of proliferating cells

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
"Pharmaceutical Dosage Forms", 1980, MARCEL DECKER
CREIGHTON: "Proteins: Structures and Molecular Properties", December 1993, W H FREEMAN & CO.
HOOVER, JOHN E.: "Remington's Pharmaceutical Sciences", 1975, MACK PUBLISHING CO.
INOUE, EUR. UROL., vol. 49, no. 1, 2006, pages 161 - 168
JERABEK-WILLEMSEN, M.WIENKEN, C. J.BRAUN, D.BAASKE, P.DUHR, S.: "Molecular interaction studies using microscale thermophoresis", ASSAY DRUG DEV. TECHNOL., vol. 9, 2011, pages 342 - 353
KOVALENKO ET AL., NUCLEIC ACIDS RES., vol. 25, no. 19, 1997, pages 3868 - 3874
MILLETTI, F., DRUG DISCOV. TODAY, vol. 17, no. 15-16, 2012
QIAN ET AL., BIOCHEMISTRY, vol. 53, no. 24, 24 June 2014 (2014-06-24), pages 4034 - 46
REMINGTON: "The Science and Practice of Pharmacy", 1995, MACK PUBLISHING COMPANY
VARSHAVSKY, PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 12142 - 12149

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10188691B2 (en) 2016-05-27 2019-01-29 Synthex, Inc. Protein interfaces
US12214008B2 (en) 2016-05-27 2025-02-04 Synthex, Inc. Protein interfaces
US11840743B2 (en) 2017-11-16 2023-12-12 Synthex, Inc. Selective modulation of protein-protein interactions
US12410487B2 (en) 2017-11-16 2025-09-09 Synthex, Inc. Selective modulation of protein-protein interactions
WO2019104244A1 (en) * 2017-11-22 2019-05-31 Synthex, Inc. Peptides for inhibiting rad51
GB2584210A (en) * 2017-11-22 2020-11-25 Synthex Inc Peptides for inhibiting RAD51
GB2584210B (en) * 2017-11-22 2022-03-16 Synthex Inc Peptides for inhibiting RAD51
US11780881B2 (en) 2017-11-22 2023-10-10 Synthex, Inc. Compounds for selective disruption of protein-protein interactions
US12590126B2 (en) 2017-11-22 2026-03-31 Synthex, Inc. Compounds for selective disruption of protein-protein interactions
US11306306B1 (en) 2019-05-15 2022-04-19 Synthex, Inc. Selective degradation of proteins

Also Published As

Publication number Publication date
EP3463414C0 (en) 2023-09-13
JP2019527066A (ja) 2019-09-26
EP3463414A2 (en) 2019-04-10
EP4269427A3 (en) 2023-11-22
CN109562138B (zh) 2023-03-21
AU2022259709A1 (en) 2022-11-24
MX2023002591A (es) 2024-02-08
CN116217657A (zh) 2023-06-06
WO2017205852A3 (en) 2018-01-25
US20250177474A1 (en) 2025-06-05
US20170368132A1 (en) 2017-12-28
AU2017271678A1 (en) 2018-12-13
AU2024204362A1 (en) 2024-07-11
AU2021205010A1 (en) 2021-08-05
CA3025423A1 (en) 2017-11-30
US10188691B2 (en) 2019-01-29
CN109562138A (zh) 2019-04-02
JP7479421B2 (ja) 2024-05-08
JP7080878B2 (ja) 2022-06-06
AU2017271678B2 (en) 2021-05-06
BR112018074472A2 (pt) 2019-03-19
MX2018014366A (es) 2019-04-11
AU2021205010B2 (en) 2022-08-11
EP4269427A2 (en) 2023-11-01
US20210252100A1 (en) 2021-08-19
US20190216879A1 (en) 2019-07-18
EP3463414B1 (en) 2023-09-13
JP2022119883A (ja) 2022-08-17
JP2024099695A (ja) 2024-07-25
US12214008B2 (en) 2025-02-04
EP3463414A4 (en) 2019-10-23

Similar Documents

Publication Publication Date Title
AU2021205010B2 (en) Protein interfaces
US12590126B2 (en) Compounds for selective disruption of protein-protein interactions
US12528846B2 (en) BH4 stabilized peptides and uses thereof
JP2013508346A (ja) Gadd45β標的医薬
US12410141B2 (en) Anti-cancer spirocyclic-guanidine compounds and uses thereof
US12281180B2 (en) Peptoid-peptide macrocycles, pharmaceutical compositions and methods of using the same
HK40007101A (en) Protein interfaces
HK40007101B (en) Protein interfaces
IL272080B2 (en) Peptide derivative, pharmaceutical composition containing same and use thereof in cancer therapy
JP2013538558A (ja) Tlr媒介疾患を治療するためのtoll様受容体(tlr)の膜貫通型ドメインに基づくペプチド
WO2020165570A1 (en) Methods relating to disrupting the binding of af9 partner proteins to af9 and/or enl
US9145554B2 (en) Cancer therapy method
Mihara et al. Designed Peptide Libraries for Cell Analyzing Microarrays

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3025423

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019514203

Country of ref document: JP

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17803737

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018074472

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017271678

Country of ref document: AU

Date of ref document: 20170526

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017803737

Country of ref document: EP

Effective date: 20190102

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17803737

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112018074472

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20181127