WO2017186934A1 - Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases - Google Patents
Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases Download PDFInfo
- Publication number
- WO2017186934A1 WO2017186934A1 PCT/EP2017/060234 EP2017060234W WO2017186934A1 WO 2017186934 A1 WO2017186934 A1 WO 2017186934A1 EP 2017060234 W EP2017060234 W EP 2017060234W WO 2017186934 A1 WO2017186934 A1 WO 2017186934A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- veterinary
- topical
- retinal
- inhibitor
- composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*(C(C=C(N1Cc(cc(cc2)F)c2C#N)N(CCC2)C[C@@]2N)=O)C1=O Chemical compound C*(C(C=C(N1Cc(cc(cc2)F)c2C#N)N(CCC2)C[C@@]2N)=O)C1=O 0.000 description 2
- IVJHMMWCEBZJPH-ZDUSSCGKSA-N CCc(c([C@H]1OCCCC1)c1)ccc1F Chemical compound CCc(c([C@H]1OCCCC1)c1)ccc1F IVJHMMWCEBZJPH-ZDUSSCGKSA-N 0.000 description 1
- ZSBOMTDTBDDKMP-OAHLLOKOSA-N CN(C(C=C(N1Cc(cccc2)c2C#N)N(CCC2)C[C@@H]2N)=O)C1=O Chemical compound CN(C(C=C(N1Cc(cccc2)c2C#N)N(CCC2)C[C@@H]2N)=O)C1=O ZSBOMTDTBDDKMP-OAHLLOKOSA-N 0.000 description 1
- HCVKSKXKDOMVRW-WMZOPIPTSA-N Cc(cc1NCCN[C@@H](C2)CN[C@@H]2C(N2CSCC2)=O)n[n]1-c1ccccc1 Chemical compound Cc(cc1NCCN[C@@H](C2)CN[C@@H]2C(N2CSCC2)=O)n[n]1-c1ccccc1 HCVKSKXKDOMVRW-WMZOPIPTSA-N 0.000 description 1
- MFFMDFFZMYYVKS-SECBINFHSA-N N[C@@H](CC(N1Cc2nnc(C(F)(F)F)[n]2CC1)=O)Cc(cc(c(F)c1)F)c1F Chemical compound N[C@@H](CC(N1Cc2nnc(C(F)(F)F)[n]2CC1)=O)Cc(cc(c(F)c1)F)c1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/4985—Pyrazines or piperazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/415—1,2-Diazoles
- A61K31/4162—1,2-Diazoles condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/496—Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
- A61K31/52—Purines, e.g. adenine
- A61K31/522—Purines, e.g. adenine having oxo groups directly attached to the heterocyclic ring, e.g. hypoxanthine, guanine, acyclovir
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/06—Ointments; Bases therefor; Other semi-solid forms, e.g. creams, sticks, gels
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
Definitions
- the present invention relates to the field of medical approaches for ocular diseases that may lead to partial or total blindness.
- the invention provides the useful of a family of peptides -Dipeptidyl peptidase-4 (DPP-4) inhibitors- to be applied topically into the eyes.
- DPP-4 Dipeptidyl peptidase-4
- Retinal neurodegenerative diseases refer to retinal conditions characterized by progressive neuronal loss. Diabetic retinopathy, age-related macular degeneration, glaucoma and retinitis pigmentosa are considered retinal diseases in which neurodegeneration plays an essential role.
- Diabetic retinopathy is the most common complication of diabetes and remains the leading cause of blindness among working-age individuals in developed countries.
- Current treatments for DR such as laser
- Neurodegeneration is an early event in the pathogenesis of DR which participates in the microcirculatory abnormalities that occur in DR as can be deduced from Simo et al. on behalf of the European Consortium for Early Treatment of Diabetic Retinopathy (EUROCONDOR). "Neurodegeneration is an early event in diabetic retinopathy: therapeutic implications", Br. J.
- DR DR-retinal degeneration
- mfERG-IT mfERG-IT
- BRB disruption or breakdown
- OCT Optical Coherence Tomography
- a pyrrolidin derived compound named TG100572, 4-chloro-3-(5- methyl-3- ⁇ [4-(2-pyrrolidin-l-ylethoxy)phenyl]amino ⁇ -1 ,2,4-benzotriazin-7- yl)phenol)
- TG100572 4-chloro-3-(5- methyl-3- ⁇ [4-(2-pyrrolidin-l-ylethoxy)phenyl]amino ⁇ -1 ,2,4-benzotriazin-7- yl)phenol
- Topical drug application is useful in the treatment of many anterior segment disorders, but it is considered inefficient in delivering therapeutic
- concentrations of the drug to the posterior segment of the eye owing to the unique anatomical, physiological and biochemical barriers of the eye.
- Cornea is divided into 3 main complex layers: epithelium, stroma and endothelium.
- the corneal epithelium is lipophilic and consists of stratified squamous cells five to seven cell layers thick.
- stroma Immediately posterior to the corneal epithelium, there is the collagenous Bowman's membrane. Posterior to Bowman's membrane it is found the hydrophilic, lamellar stroma.
- the stroma Since it's hydrophilic, the stroma is a strong barrier to lipophilic molecules, though it lacks tight-junction complexes.
- the stroma lies the single-cell layer of Descemet's membrane and the extracellular matrix secreted by the deepest layer of the cornea, the endothelium.
- the corneal endothelium is a single cuboidal cell layer in thickness, and is a lipophilic region responsible for permitting leakage of nutrients from the aqueous humour to the cornea and for transporting water from the avascular cornea into the anterior chamber.
- the lipophilic- hydrophilic-lipophilic nature of the cornea is a major contributor to the challenge of any drug permeability.
- DPP-4 inhibitors are a relatively new class of oral diabetes drugs, also known as gliptins, which are prescribed for people with type 2 diabetes. They work by blocking the action of DPP-4, an enzyme which destroys a group of diseases and conditions.
- DPP-4 Dipeptidyl peptidase-4
- CD26 Cluster of differentiation 26
- the gene encodes a type II transmembrane protein of 766 amino acids, which is anchored to the lipid bilayer by a single hydrophobic segment located at the N-terminus and has a short cytoplasmic tail of six amino acids (see De Meester I et al., "CD26, let it cut or cut it down", Immunol Today- 1999, vol. no. 20, pp.:367-375).
- CD26 contains a glycosylation domain, a cysteine-rich domain, and a catalytic domain.
- DPP-4 preferentially cleaves N-terminal dipeptides from proteins and oligopeptides containing proline or alanine in the penultimate position (Xaa- Pro- or Xaa-Ala-) (see Abbott, et al., "Cloning, expression and chromosomal localization of a novel human dipeptidyl peptidase (DPP) IV homolog, DPP8", Eur J Biochem -2000; vol. no. 267, pp.: 6140-50).
- Substrates of DPP-4 include numerous neuropeptides (i.e. Substance P), hormones (i.e.
- GLP-1 GLP-2, insulin growth factor-1 , neuropeptide-Y, peptide YY, growth hormone- releasing hormone, erythropoietin) and chemokines (i.e. IP-10, RANTES, stromal cell-derived factor-1 )( see Kim et al., "The Nonglycemic Actions of Dipeptidyl Peptidase-4 Inhibitors"- BioMed Research International Volume 2014, Article ID 368703).
- chemokines i.e. IP-10, RANTES, stromal cell-derived factor-1
- DPP-4 inhibitors act through competitive enzymatic inhibition (sitagliptin and alogliptin) while others are substrate-enzyme blockers (saxagliptin and vildagliptin) (see Baetta et al., "Pharmacology of dipeptidyl
- Diabetes is a group of chronic diseases characterized by hyperglycemia. To prevent diabetic complications it is essential to reduce hyperglycemia using blood glucose lowering agents.
- the administration of any antidiabetic drug, such as DPP-4 inhibitors, can improve or attenuate DR symptoms, since the leading cause or the origin of the disease, in particular the high levels of glucose in blood, is at final instance improved.
- gemigliptin DPP-4 inhibitor
- DPP-4 inhibitor diabetic retinopathy
- Gemigliptin a dipeptidyl peptidase-4 inhibitor
- Biochimica et Biophvsica Acta Molecular Basis of Disease- 2015, vol. no. 1852(12), pp. :2618-2629.
- Jung et al. disclose that gemigliptin orally administered in diabetic mice (db/db) can ameliorate retinal pericyte apoptosis and vascular leakage in these mice.
- DPP-4 inhibitors do not pass the blood-brain barrier.
- blood-brain barrier and BRB are quite similar it is also broadly assumed and more than probably that they do not pass BRB.
- high doses will be required to reach the retina at therapeutic concentrations thus increasing the possibility of systemic adverse effects.
- neurodegeneration will be effective in reducing the progression to advanced stages needing aggressive therapies such as laser photocoagulation, intravitreal injections of corticosteroids or anti-VEGF agents, or surgical intervention.
- DDP-4 is present in human retina and highly expressed in the retina, namely in retinal pigment epithelium (RPE) of patients suffering from diabetes.
- Inhibitors of DPP-4 enzyme (acting through competitive enzymatic inhibition, such as sitagliptin, or being substrate- enzyme blockers, such as saxagliptin) have been tested and surprisingly they reached the retina when applied topically in the eye (i.e. in the cornea or conjunctival fornix or sclera, that is ophthalmic application to surface of the eye), despite their molecular weights and complexity of structures.
- These inhibitors were even able to protect and prevent the retina from degeneration and vascular leakage.
- These compounds acted as neuroprotectors of the retina (in particular the neuroretina, which is the part of the retina including the neurons but without the retinal pigment epithelium).
- the topical administration of the inhibitors according to the invention not only reach the retina, but also achieve effective concentrations for abrogating the evolution of early stages of DR by preventing BRB disruption and by preventing or treating microvascular impairment associated with DR. This impairment is mainly detected by protein retinal vascular leakage.
- the invention relates to DPP-4 inhibitors or a
- the topical eye treatment and/or prevention is a treatment and/or prevention, thus applied onto the eye surface (i.e. in the cornea, sclera or conjunctival fornix), due to the fact that surprisingly and unexpectedly these inhibitors can reach the retina when applied topically to eyes (that is ophthalmic drug administration). This applies to any of the embodiments and combination of embodiments disclosed in the present invention.
- the invention supposes a real contribution to the art for demonstrating that the DPP-IV inhibitors, commonly used anti-diabetic drugs, can also be applied topically onto the eye, in order to promote prevention of some of the more disabling accompanying diseases in diabetes; the retinal neurodegenerative diseases including in particular diabetic retinopathy.
- DPP-4 inhibitors that, by means of topical eye administration or as ingredients of topical compositions (thus topical eye compositions) can reach the retina and exert therein a neuroprotection effect.
- topical administration of these inhibitors limits their action to the eye and minimises the associated systemic adverse effects.
- This aspect of the invention can also be formulated as the use of dipeptidyl peptidase-4 inhibitors or a pharmaceutically acceptable salt or solvate thereof, , for the manufacture of a medicament for the topical eye treatment and/or prevention of retinal neurodegenerative diseases, in particular for the topical eye treatment and/or prevention of the retinal damage in early stages of retinal neurodegenerative diseases and its associated retinal microvascular impairment or damage, in particular early stages of DR, due to the
- the present invention also relates to a method for the topical eye treatment and/or prevention of retinal
- neurodegenerative diseases in particular for neuroprotection in early stages of retinal neurodegenerative diseases, in particular early stages of DR and its associated retinal microvascular impairment or damage, comprising
- administering meaning topically administering in the eye
- a dipeptidyl peptidase-4 inhibitor or a pharmaceutically acceptable salt or solvate thereof together with topical pharmaceutically or veterinary acceptable excipients and/or carriers, in a subject in need thereof, including a human.
- the invention also relates to DPP-4 inhibitors or a pharmaceutical or veterinary acceptable salt thereof, for use in the treatment and/or prevention of a retinal neurodegenerative disease; in particular for the topical eye treatment and/or prevention of the retinal damage in early stages of retinal neurodegenerative diseases and its associated retinal microvascular impairment or damage.
- Another aspect of the invention is a pharmaceutically or veterinary topical eye composition for use in the topical eye treatment and/or prevention of a retinal neurodegenerative disease, which comprises an effective amount of a dipeptidyl peptidase-4 inhibitor, or a pharmaceutically or veterinary acceptable salt or solvate thereof, and mixtures thereof, together with topical
- compositions comprising a therapeutically effective amount of a DPP-4 inhibitor, or a pharmaceutically or veterinary acceptable salt thereof, together with topical pharmaceutically or veterinary acceptable excipients and/or carriers, wherein the composition has a dynamic viscosity from 5.0 x 10 "4 Pa.s to 300 Pa.s, at 20°C, a pH from 4.5 to 9.0 and wherein the dipeptidyl peptidase-4 inhibitor is in a concentration from 5 mg/ml to 200 mg/ml in relation to the final volume of the composition.
- FIG. 1 is a graphic with bars showing DPP-4 concentration (ng/ml) in bowel, liver and human retina (RPE and neuroretina). White bars: non-diabetic donors. Black bars: diabetic donors. * p ⁇ 0.05
- FIG. 2 is a graphic with the percentage of TUNEL positive cells in the retinal layers. The percentage of Terminal Transfer dUTP Nick-End Labeling
- FIG. 3 is a graphic with bars with the retinal concentration of glutamate
- FIG. 4 is a graphic with bars with quantification of GLAST
- EMG electroretinography
- FIG. 6 (A) shows vascular leakage of serum albumin-bound Evans blue visualized with a laser scanning confocal microscope. The number and extent of Evans blue-albumin complex leakage is visualized and signalized with arrows in D-Sham.
- FIG. 6(B) the quantification of albumin immunofluorescence of digital images with Fluoview FV 1000 Laser Scanning Microscope is shown in arbitrary units (A.U.). Results are the mean ⁇ SD. * p ⁇ 0.05 between db/db treated with vehicle (D-Sham) and the other groups: D- Saxagliptin and C(db/+).
- FIG. 7, related with Example 3, shows the percentage of TUNEL positive cells in the retinal layers in db/db mice treated with vehicle (D-Sham) in comparison with the other groups (D-sitagliptin and Control(db/+)) in all retinal layers ( * p ⁇ 0.01 ).
- ONL outer nuclear layer
- INL inner nuclear layer
- GCL ganglion cell layer.
- N 10 mice per group (minimum 10 sections per retina).
- FIG. 8 is a graphic with bars with the retinal concentration of glutamate ( ⁇ /g protein) in the investigational groups. * p ⁇ 0.05 in comparison with the other groups.
- Sita sitagliptin.
- FIG. 9 (A) shows vascular leakage of serum albumin-bound Evans blue visualized with a laser scanning confocal microscope. The number and extent of Evans blue-albumin complex leakage is visualized and signalized with arrows in D-Sham.
- FIG. 9(B) the quantification of albumin immunofluorescence of digital images with Fluoview FV 1000 Laser Scanning Microscope is shown in arbitrary units (A.U.). Results are the mean ⁇ SD. * p ⁇ 0.05 between db/db treated with vehicle (D-Sham) and the other groups: D- Sitagliptin and C(db/+).
- neuroretina means any kind of treatment or prophylactic method that can be used in order that neurons constituting the neuroretina remain preserved and in a physiological state corresponding to the one of a health subject animal (including humans).
- the "neuroretina” is the part of the retina including the neurons and without the retinal pigment epithelium. Neuroretina is the responsible of the visual cycle.
- the expression “neuroprotection in the early stages of diabetic retinopathy” relates to any treatment or prophylactic method carried out before advanced stages of DR are established.
- retinal microvascular impairment or damage associated to diabetic retinopathy is to be understood as encompassing those retinal microvascular abnormalities, such as generalized and focal arteriolar narrowing, and arteriovenous nicking that reflect cumulative vascular damage due to diabetic retinopathy (in early or late stages of the disease.
- This retinal microvascular impairment or damage is mainly detected by the presence of retinal vascular leakage allowing the detection of proteins (such as albumin extravasation) from blood inside the retinal blood vessels to the different retinal layers.
- terapéuticaally effective amount refers to the amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disease which is addressed.
- pharmaceutically or veterinary acceptable refers to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical and veterinary judgment, suitable for use in contact with the tissues of a subject (e.g. human or any other animal) without significant toxicity, irritation, allergic response, or other problem or
- Each carrier, excipient, etc. must also be "acceptable” in the sense of being compatible with the other ingredients of the pharmaceutical composition. It must also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity or other problems or complications commensurate with a reasonable benefit/risk ratio.
- Suitable carriers, excipients, etc. can be found in standard pharmaceutical texts, and include, as a way of example preservatives, agglutinants, humectants, emollients, and antioxidants.
- retinal neurodegenerative diseases retinal diseases in which
- DPP-4 inhibitor is for use by inhibition of retinal dipeptidyl peptidase-4. That is, the topical treatment into the eye takes place due to direct inhibition of DPP-4 enzyme in the retina.
- DPP-4 inhibitors are selected from the group consisting of sitagliptin, saxagliptin, vildagliptin, linagliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, gemigliptin, omarigliptin, their
- the DPP-4 inhibitor for use as above exposed is a DPP-4 competitive enzymatic inhibitor and it is selected from the group consisting of sitagliptin, linagliptin, alogliptin, their pharmaceutically acceptable salts or solvates, and mixtures thereof.
- DPP- 4 inhibitors for the topical eye treatment and/or prevention of retinal neurodegenerative diseases is a DPP-4 substrate-enzyme blocker, and it is selected from the group consisting of a compound of formula saxagliptin, vildagliptin, anagliptin, their pharmaceutically acceptable salts or solvates, and mixtures thereof.
- the DPP-4 inhibitor is saxagliptin. In another also more particular embodiment, the DPP-4 inhibitor is sitagliptin.
- DPP-4 inhibitors can be grouped by similar functional groups or by similar parts of the molecules: Formula DPP-4 inhibitor Name; lUPAC name
- DPP-4 inhibitors are dutogliptin (and its tartrate salt), and lupeol .
- the DPP-4 inhibitor for use in the topical eye treatment and/or prevention according to the invention is for use in the treatment and/or prevention of retinal neurodegenerative disease selected from the group consisting of DR, age-related macular degeneration, glaucoma and retinitis pigmentosa.
- the DPP-4 inhibitor is for use in the treatment and/or prevention of diabetic retinopathy and associated to DR retinal microvascular impairment. This means that retinal microvascular impairment or damage taking place in DR, and usually detected by retinal vascular leakage of proteins in the retinal layers, can be treated with the topical eye administration of the DPP-4 inhibitors.
- the DPP-4 inhibitor is for use in the topical eye treatment and/ or prevention of the early stages of DR.
- the inhibitors of the invention applied topically act as neuroprotector agents of the neuroretina, thus exerting a neuroprotection effect as will be illustrated in the examples below. Neurons are preserved from damage and loss of function, and they are maintained in a health physiological state. The same reasoning applies with the other retinal neurodegenerative diseases. Indeed, the peptides can be used due to its neuroprotective properties.
- NPDR non-proliferative diabetic retinopathy
- DMO diabetic macular edema
- BBB blood retinal barrier
- PDR proliferative diabetic retinopathy
- capillary occlusion plays an essential role generating an imbalance between angiogenic and antiangiogenic factors, which finally stimulates neovascularization (the hallmark of PDR).
- PPC photocoagulation
- IVTR anti vascular endothelial growth factor agents
- VTR vitrectomy
- DDP-4 inhibitors for use in the topical eye treatment and /or prevention of DR according to the invention, some of these aggressive treatments can be avoided if in the early stages of the disease, when functional abnormalities (i.e. chromatic discrimination, contrast sensitivity and electroretinography abnormalities) and vascular leakage can be detected, the subject receives compounds aiding the neuroprotection of the retina. So that, if the retina is protected from the consequences of chronic blood glucose levels, major complications can be minimized, or even never appear with the real improvement of life quality of diabetic patients.
- the topical administration to eye of the DPP-4 inhibitors disclosed above represents a real advantage, avoiding further aggressive treatments.
- the protection of retinal neurodegeneration detected by means of several ophthalmological examinations represents a good approach for treating DR before vascular abnormalities are developed.
- DR neurodegeneration exists (which can be detected by the loss of both, chromatic discrimination and contrast sensitivity, glial activation and apoptosis of neural cells).
- the DPP-4 inhibitors for topical administration (topical administration to the eye) of the invention are useful in these early stages when no treatment is indicated and only the follow-up is recommended until more advances stages of DR are established (clinically significant diabetic macular edema and/or proliferative diabetic retinopathy).
- Treatment in the early stages of DR has the real advantage that further complications are avoided, namely microaneurysms, microhemorrhages, hard exudates, capillary occlusion, and neovascularization.
- the DPP-4 inhibitors for use according to the invention are ingredients (components) of pharmaceutically or veterinary topical eye compositions, said compositions comprising at least one DPP-4 inhibitor as defined above and any pharmaceutically or veterinary topical acceptable carriers and/or excipients.
- a pharmaceutically or veterinary topical composition for use in the topical eye treatment and/or prevention of a retinal neurodegenerative disease which comprises an effective amount of a dipeptidyl peptidase-4 inhibitor, or a pharmaceutically or veterinary acceptable salt or solvate thereof, and mixtures thereof, together with topical pharmaceutically or veterinary acceptable excipients and/or carriers.
- the pharmaceutically or veterinary topical eye compositions for use in the topical eye treatment and/or prevention of retinal neurodegenerative diseases comprises at least one DPP-4 inhibitor selected from the group consisting of sitagliptin, saxagliptin, vildagliptin, linagliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, gemigliptin, omarigliptin.
- DPP-4 inhibitor selected from the group consisting of sitagliptin, saxagliptin, vildagliptin, linagliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, gemigliptin, omarigliptin.
- Particular carriers and/or excipients relate to water, saline buffers, and mixtures of water in oil or oil in water.
- Particular excipients are selected from preserv
- the pharmaceutically or veterinary topical eye compositions for use as above indicated further comprises a compound selected from the group consisting of mammal GLP-1 , particularly human GLP-1 (UniProt: P01275), liraglutide, exenatide, lixisenatide, its salts and mixtures thereof.
- GLP-1 (glucagon-like peptide-1 ) is an endogenous insulinotropic peptide that is secreted from the L cells of the gastrointestinal tract in response to food
- GLP-1 by acting thorough its receptor (GLP-1 R), has potent effects on glucose-dependent insulin secretion, insulin gene
- GLP-1 R is a member of the peptide hormone binding class B1 (secretin-like receptors) family of seven transmembrane spanning, heterotrimeric G-protein coupled receptors
- GLP-1 Rs have a broad distribution and they are found in the pancreas, adipose tissue, muscle, heart, the gastrointestinal tract and the liver. In addition, GLP-1 Rs are found throughout the central nervous system (ie. hypothalamus, striatum, brain stem, substantia nigra, and subventricular zone), and there is some evidence that GLP-1 R stimulation by GLP-1 exerts neuroprotective effects in both the central and peripheral nervous systems.
- Human GLP-1 is a 37 amino acid residue peptide originating from
- preproglucagon which is synthesized i.a. in the L-cells in the distal ileum, in the pancreas and in the brain.
- the human preproglucagon is identified with the UniProt database Accesion Number P01275, February 6, 2007; Version 3.
- the processing of preproglucagon to give GLP-1 (7-36)amide, GLP-1 (7-37) and GLP-2 occurs mainly in the L-cells.
- a simple system is used to describe fragments and analogues of this peptide.
- Gly 8 -GLP-1 (7-37) designates a fragment (analogue) of GLP-1 formally derived from GLP-1 by deleting the amino acid residues Nos.
- Lys 34 (N E - tetradecanoyl)-GLP-1 (7-37) designates GLP-1 (7-37) wherein the ⁇ -amino group of the Lys residue in position 34 has been tetradecanoylated.
- Particular analogues of GLP-1 include liraglutide (also named Arg 34 Lys 26 (N E - (Y-glutamyl(N a -hexadecanoyl)))-GLP-1 (7-37)) and with CAS number
- Lixisenatide is another GLP-1 analogue (i.e. a GLP-1 agonist) with amino acid sequence
- the CAS number is 827033-10-3.
- Exenatide is the compound having the CAS number 141732-76-5. It is a peptide with the amino acid sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPXaa 1 wherein Xaa 1 is a serine residue in which the terminal -COOH has been modified
- Preferred pharmaceutically or veterinary topical eye compositions are selected from the group consisting of solutions (for example eye drops), creams, lotions, unguents, emulsions, aerosols and non-aerosol sprays, gels, ointments and suspensions.
- solutions for example eye drops
- creams for example eye drops
- lotions for example eye drops
- emulsions for example creams
- aerosols for example aerosol
- non-aerosol sprays for example eye drops
- gels for example eye drops
- ointments and suspensions are examples of topical eye compositions applicable to the cornea, sclera or to the conjunctival fornix.
- compositions also relate to solid or semi-solid matrices or supports, in particular bioerodible and/or biodegradable polymer matrices for the delivery of DPP-4 inhibitors, that are comprised in the matrices.
- compositions of the present invention may contain other ingredients, such as fragrances, colorants, and other components known in the state of the art for use in topical eye formulations.
- Topical eye compositions of the present invention can be prepared according to methods well known in the state of the art.
- the appropriate excipients and/or carriers, as well as any pH buffer, and their amounts, can readily be determined by those skilled in the art according to the type of formulation being prepared.
- humectants also named humectant solvents
- PEG polyethylene glycol
- n is the mean of oxyethylene groups in the polymer
- propylene glycol propylene glycol
- glycerin propylene glycol
- the humectant is a compound having solvent and humectant properties.
- PEG of different molecular weights are widely used in pharmaceutical compositions (being topical, parenteral, ophthalmicals, orals and rectal compositions).
- Appropriate PEGs to be used in the topical eye compositions for use according to the invention has a molecular weight from 300 to 35000 g/mol, more in particular from 600 to 20000 g/mol, even more in particular from 1000 to 8000 g/mol, more particularly from 3000 to 6000 g/mol, and preferably about 4000 g/mol.
- humectant is comprised in an amount froml % to 49% in
- weight/volume in relation to the total volume of the composition. More in particular from 5% to 40%, even from 10% to 30%, and even more in particular from 15% to 25%.
- pH buffers are those allowing a pH from 4.5 to 9.0, more in particular from 4.5 to 8.5, even more in particular from 6.0 to 8.2, and preferably from 7.0 to 8.1 , even more preferably from 7.5 to 8.0.
- pH buffers include citrate salts (citric acid/citrate buffer), phosphate salts
- pH buffers may in additional comprise amino acids, in particular arginine, lysine, and an amine-derived compound selected from methylglucamine and trometamol, and mixtures thereof.
- Excipients and/or carriers more appropriate for lipophilic compositions (which means compositions non miscible with water at 15-35 °C) include synthetic or semisynthetic lipophilic excipients comprising cocoa butter, vegetal
- compositions of the invention include, in particular embodiments, tensoactives, solvents (organic and inorganic solvents; i.e. water), viscosity agents, preservatives, agglutinants, emollients, and antioxidants, isotonifying and/or isoosmozing agents, mucoadhesive polymers, agent enhancing absorption of the active principle (i.e.: DPP-4 inhibitor).
- glycerides are in particular used glycerides, polysorbates, sodium lauryl sulphate, phospholipids, (such as phosphatidyl choline or phosphatidyl glycerol), polyoxyethylene fatty acids, mono-di and triglycerides, optionally polyoxyethylene substituted, and mixtures thereof.
- phospholipids such as phosphatidyl choline or phosphatidyl glycerol
- polyoxyethylene fatty acids mono-di and triglycerides, optionally polyoxyethylene substituted, and mixtures thereof.
- organic solvents are particularly used in the compositions ricin oil, PEG, poloxamers, polysorbates, glycerine, triglycerides with C6-C10 carbon atoms fatty acids, and mixtures thereof.
- the viscosity agents are in particular polyvynil alcohol, compounds derived from cellulose such as methylecellulose and hydroxypropylmethylcellulose, carbomers, PEG and mixtures thereof.
- the preservatives are in particular boric acid, benzalconium chloride, benzoic acid, p-hydroxybenzoic esters of C1 -C4-alkyl chains, chlorobuthanol, benzyl alcohol, and mixtures thereof.
- Isotonifying and/or isoosmozing agents are in particular sodium chloride, dextrose, trehalose, mannitol, amino acids and mixtures thereof.
- Agents enhancing absorption of the active principle include saponine, fatty acids, pyrrolydone, polyvinylpyrrolidone, pirivic acid and mixtures thereof.
- the mucoadhesive polymers are in particular hyaluronic acid, polygalacturonic acid, polyacrylic acid, chondroitin sulphate, methylecellulose, hydroxypropylmethylcellulose, gelatine, methycellulose, chantan gum, sodium carboxymethylcellulose, chitosan, carbopol, gellan gum, pectine, algunates, carragenates, and mixtures thereof.
- Emulsion and microemulsion bases are in particular fatty acid esters of glycerine, polyoxyethylene alcohols, ricin oil, triglycerides with C6-C10 carbon atoms fatty acids, and mixtures thereof.
- Cream and ointment bases are in particular vaseline, paraffin, PEG, silicones and mixtures
- the topical eye composition of the invention is a solution in the form of eye drops, also named eye drop solution.
- eye drop solution a solution in the form of eye drops
- the administration of the peptides in the form of eye drops implies the great advantage of being easy to be used by the subject in need thereof, and non-uncomfortable.
- compositions for use according to the invention are, in a particular embodiment optionally in combination with any embodiment above or below, sustained-release compositions. That is, the compositions are formulated as sustained-release delivery systems allowing the delivery of the active principle (i.e.: DPP-4 inhibitors) at a predetermined rate in order to maintain a constant drug concentration for a specific period of time with minimum side effects.
- the active principle i.e.: DPP-4 inhibitors
- compositions for the sustained-release delivery comprise
- polylactic acid poly(lactic-co-glycolic) acid
- polystyrenes chitosan
- albumin albumin
- lectins lectins
- gelatins acrylates and methacrylates
- polycaprolactones polyacrylamides
- dextranes dextranes
- agarose agarose
- sorbitan sorbitan
- compositions for the sustained-release delivery comprise a polymer conjugated with the DPP-4 inhibitors constituting hydrogels.
- All these pharmaceutical or veterinary topical eye compositions are, in another particular embodiment of the second aspect optionally in combinatin with any embodiments above or below, for use in the topical eye treatment and/or prevention of retinal neurodegenerative diseases selected from the group consisting of diabetic retinopathy (DR), age-related macular degeneration, glaucoma and retinitis pigmentosa.
- DR diabetic retinopathy
- age-related macular degeneration age-related macular degeneration
- glaucoma glaucoma
- retinitis pigmentosa are for use in the prevention and/or treatment of diabetic retinopathy, and its associated microvascular impairment or damage. More in particular, they are for use in the topical eye treatment of early stages of the diabetic retinopathy.
- the invention has as another aspect, a pharmaceutical or veterinary topical composition
- a pharmaceutical or veterinary topical composition comprising a therapeutically effective amount of a DPP-4 inhibitor, or a pharmaceutically or veterinary acceptable salt thereof, together with topical pharmaceutically or veterinary acceptable excipients and/or carriers, wherein the composition has a dynamic viscosity from 5.0 x 10 "4 Pa.s to 300 Pa.s, a pH from 4.5 to 9.0, and wherein the dipeptidyl peptidase-4 inhibitor is in a concentration from 5 mg/ml to 200 mg/ml in relation to the final volume of the composition.
- a pharmaceutical or veterinary topical composition comprising a therapeutically effective amount of a DPP-4 inhibitor, or a pharmaceutically or veterinary acceptable salt thereof, together with topical pharmaceutically or veterinary acceptable excipients and/or carriers, wherein the composition has a dynamic viscosity from 5.0 x 10 "4 Pa.s to 300 Pa.s at 20 °C, a pH from 4.5 to 9.0, and wherein the dipeptidyl peptidase-4 inhibitor is in a concentration from 20 mg/ml to 200 mg/ml in relation to the final volume of the composition.
- compositions of the invention are liquid compositions or semi-solid compositions having a consistency of that of a cream or an unguent.
- the pharmaceutical or veterinary topical compositions of the invention have a dynamic viscosity from 5.0 x 10 "4 Pa.s to 300 Pa.s, at room temperature (i.e. 20 ⁇ 0.1 °C) and normal atmospheric pressure.
- the dynamic viscosity of the pharmaceutical or veterinary topical composition is from 8.9 x 10 "4 Pa.s to 100 Pa.s
- dynamic viscosity or viscosity coefficient ⁇ is the tangencial force per unit surface, known as shearing stress T and expressed in pascals, necessary to move, parallel to the sliding plane, a layer of liquid of 1 square meter at a rate (v) of 1 meter per second relative to a parallel layer at a distance (x) of 1 meter.
- the ratio dv/dx is a speed gradient giving the rate of shear D
- these topical compositions with the specified viscosity are in the form of solutions (for example eye drops), creams, lotions (for example eye lotions), unguents, emulsions, aerosols and non-aerosol sprays, gels, ointments and suspensions. All of them can be applied onto the surface of the eye (cornea, conjunctiva, sclera) and allow DPP-4 inhibitors release to reach the retina.
- Particular compositions are eye drops, eye lotions, semi-solid eye preparations (i.e. ointments, creams or gels).
- Some of the eye solutions end lotions can be prepared at the time of administration from powders of eye drops and powders for eye lotions, supplied in a dry, sterile form to be dissolved or suspended in an appropriate liquid vehicle.
- DPP-4 inhibitors are, as before, selected from the group consisting of sitagliptin, saxagliptin, vildagliptin, linagliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, gemigliptin, omarigliptin and mixtures thereof, together with topical pharmaceutically or veterinary acceptable excipients and/or carriers.
- pH is from 5.5 to 7.5, more particularly 7.0.
- the DPP-4 inhibitor is in a concentration from 50 mg/ml to 150 mg/ml in relation to the final volume of the composition. More particularly the concentration is from 50 mg/ml to 150 mg/ml.
- the inhibitor is saxagliptin, it is in a concentration from 80 mg/ml to 120 mg/ml in relation to the final volume of the composition. More particularly the concentration is from 80 mg/ml to 100 mg/ml in relation to the final volume of the composition. Particularly, it is 100 mg/ml in relation to the final volume of the composition.
- the inhibitor is sitagliptin, it is in a concentration from 50 mg/ml to 120 mg/ml in relation to the final volume of the composition. More particularly the concentration is from 50 mg/ml to 80 mg/ml in relation to the final volume of the composition. Particularly, it is 50 mg/ml in relation to the final volume of the composition.
- DPP-4 concentration are elevated in human diabetic retinas
- the expression of DPP-4 were deternnined in human retinas from diabetic and non-diabetic donors. Retinas were obtained from Tissue Bank of our Centre (Banc de Sang i Teixits Hospital Universitari Vail d'Hebron). A total of 8 diabetic donors and 8 non-diabetic donors matched by age and gender were included in the study.
- One eye-cup was harvested in order to separate neuroretina from retinal pigment epithelium (RPE) and both tissues were immediately frozen with liquid nitrogen and stored at -80°C. Tissues derived from this eye-cup were used for the studies of gene expression and
- DPP-4 concentration was assessed in retinal extracts (RPE and neuroretina) by a quantitative sandwich enzyme immunoassay (R&D Systems,
- Alexa Fluor® 488 Molecular Probes, Eugene, OR
- DPP-4 was expressed in human retina. A higher expression of DPP-4 mRNA was detected in the RPE from diabetic donors in comparison with non-diabetic donors (5.69 ⁇ 1 .77 vs. control 1 .4 ⁇ 1 .38, p ⁇ 0.05). In the neuroretina no significant differences between the two groups were observed.
- DPP-4 concentration was significantly higher in RPE from diabetic donors in comparison with non-diabetic donors (p ⁇ 0.05). All these data are depicted in FIG. 1 , wherein levels of DDP-4 (ng/ml) are shown in bowel (reference), liver (reference), RPE and neuroretina. White bars: non-diabetic donors. Black bars: diabetic donors. In the neuroretina no significant differences between the two groups were observed. The immunohistochemistry analysis showed that DPP-4 was diffusely distributed along the entire retina. EXAMPLE 2. Saxagliptin administered in eye drops prevents retinal neurodegeneration induced by diabetes
- db/db mice reproduce the features of the neurodegenerative process that occurs in the human diabetic eye. Therefore, it is an appropriate model for testing neuroprotective drugs (according to Bogdanov et al., "The db/db mouse: a useful model for the study of diabetic retinal neurodegeneration", PLoS One-2014, vol. no. 9(5):e97302).
- a total of 20 male db/db (BKS.Cg- + Lepr db/+ Lepr db/OlaHsd) mice aged 10 weeks were purchased from Harlan Laboratories, Inc.
- 10 non- diabetic (db/+) mice matched by age were used as control group.
- Saxagliptin or vehicle eye drops were administered directly onto the superior corneal surface of each eye using a syringe.
- One drop (5 ⁇ _) of saxagliptin (1 ⁇ ) to each eye or vehicle (5 ⁇ _ of 0.9% sodium chloride) to each eye were administered twice daily for 14 days.
- the animals' eyes were instilled with a drop of saxagliptin or vehicle approximately one hour prior to necropsy.
- VHIR Animal Care and Use Committee of VHIR (Vail d'Hebron Research Institute). All the experiments were performed in accordance with the tenets of the European Community (86/609/CEE) and ARVO (Association for Research in Vision and Ophthalmology).
- Glial activation was evaluated by Laser Scanning Confocal microscopy using specific antibodies against GFAP (Glial fibrillar acidic protein). Sections were fixed in acid methanol (-20 °C) for 2 min, followed by three washes with PBS, 5 min each. Sections were permeabilized with TBS-Triton X-100 0,025% and were incubated in blocker (1 % BSA, and 10% goat serum in PBS) for 2 hours at room temperature. Sections were then incubated with rabbit anti-GFAP (Abeam Ltd, Cambridge, U.K.) (1 :500 dilution prepared in blocking solution) overnight at 4 °C in a humid atmosphere.
- GFAP Gaal fibrillar acidic protein
- This scoring system was as follows: Muller cell endfeet region/GCL only (score 1 ); Muller cell endfeet region/GCL plus a few proximal processes (score 2); Muller cell endfeet plus many processes, but not extending to ONL (score 3); Muller cell endfeet plus processes throughout with some in the ONL (score 4); Muller cell endfeet plus lots of dark processes from GCL to outer margin of ONL (score 5).
- the TUNEL (Terminal Transferase dUTP Nick-End Labeling) staining was carried out using the DeadEnd Fluorometric TUNEL System kit (PROMEGA, Madison, Wl, USA). Cryosections of retina were permeabilised by incubation for 2 min on ice with 0.1 % Triton X-100 in 0.1 % sodium citrate, freshly prepared. The secondary antibody was Alexa 488 goat-anti-rabbit (Invitrogen, San Diego CA, USA). For evaluation by Laser Scanning Confocal microscopy the excitation wavelength was 488 nm and detection in the range of 515 - 565 nm (green) was used.
- Glutamate accumulation in extracellular space and the overactivation of glutamate receptors plays an important role in retinal neurodegeneration. Glutamate transporters are essential for keeping the extracellular glutamate concentration below neurotoxic levels.
- Glutamate/aspartate transporter (GLAST) is the most dominant glutamate transporter, accounting for at least 50% of glutamate uptake in the mammalian retina.
- GFAP expression was confined to the retinal ganglion cell layer (GCL) and therefore the GFAP score was ⁇ 2.
- the diabetic mice treated with vehicle (D-Sham) presented significant higher GFAP expression than non-diabetic mice matched by age (C (db/+)).
- C (db/+) age
- 100% of diabetic mice presented a GFAP score >3.
- Saxagliptin (eye drops) administration for two weeks (D-saxagliptin) resulted in a significant decrease of reactive gliosis, and the GFAP score of the mice treated with saxagliptin was ⁇ 3 in all cases. All these data are derivable from digital images (not shown) with Fluoview FV
- GFAP Glial Fibrillar Acidic Protein
- This Table 1 shows quantification of glial activation based on the extent of GFAP staining.
- the scoring system was as follows: Muller cell endfeet region/GCL only (score 1 ); Muller cell endfeet region/GCL plus a few proximal processes (score 2); Muller cell endfeet plus many processes, but not extending to ONL (score 3); Muller cell endfeet plus processes throughout with some in the ONL (score 4); Muller cell endfeet plus lots of dark processes from GCL to outer margin of ONL (score 5).
- n 10 mice per group (5 retinal sections per mice).
- apoptosis rate was significantly higher in diabetic mice treated with vehicle than in non-diabetic mice in all retinal layers.
- Saxagliptin (eye drops) administration for two weeks resulted in a significant prevention of apoptosis in all retinal layers, as derivable from FIG. 2, a bar-graphic with the
- BTB blood-retinal barrier
- FIG. 6 shows vascular leakage of serum albumin-bound Evans blue visualized with a laser scanning confocal microscope. The number and extent of Evans blue-albumin complex leakage (arrows) were clearly increased in D- Sham than in the other groups. In the lower panel FIG.
- Electroretinograms at 3200 cd * s/m 2 (panel A) and at 12800 cd * s/m 2 (panel B) are represented for D-sham mice (diabetics treated with vehicle eye drops), Controls (C; d/+) and D-saxagliptin mice (diabetics treated with Saxagliptin eye drops).
- A means amplitude and is measured in microvolts ( ⁇ ); T means time in milliseconds (ms).
- EXAMPLE 3 Sitagliptin topically administered (eye drops) prevents retinal neurodegeneration induced by diabetes.
- Example 2 The design and methodology were the same than used in Example 2. The results obtained using sitagliptin eye drops were very similar to than obtained with saxagliptin eye drops treatment.
- apoptosis rate was significantly higher in diabetic mice treated with vehicle than in non-diabetic mice in all retinal layers.
- Sitagliptin (eye drops) administration for two weeks resulted in a significant prevention of apoptosis in all retinal layers, as derivable from FIG. 7, a bar-graphic with the
- TUNEL positive cells for D-Sham mice (diabetics and receiving vehicle eye-drops; black bars on the left of each set), D-Sitagliptin (receiving the Sitagliptin drops; grey bars in the middle of each set) and Control (db/+).
- Data for the different retina layers ganglion cell layer; GCL, inner nuclear layer; INN, and outer nuclear layer; ONL
- the percentage of TUNEL positive cells was significantly higher in db/db mice treated with vehicle in comparison with the other groups in all retinal layers ( * p ⁇ 0.01 ).
- ONL outer nuclear layer; INL: inner nuclear layer; GCL: ganglion cell layer.
- N 10 mice per group (minimum 10 sections per retina).
- FIG. 9(A) shows vascular leakage of serum albumin-bound Evans blue visualized with a laser scanning confocal microscope. The number and extent of Evans blue- albumin complex leakage (arrows) were clearly increased in D-Sham than in the other groups.
- FIG. 9(B) the quantification of albumin immunofluorescence of digital images with Fluoview FV 1000 Laser Scanning Microscope is shown.
- DPP-4 inhibitors (saxagliptin and sitagliptin) administered by eye drops led to a significant increase in the intraretinal content of GLP-1 and its main downstream messenger cAMP, thus preventing neurodegeneration and vascular leakage in db/db mice.
- This does not mean that the beneficial effects of DPP-4 inhibitors should exclusively be attributed to the enhancement of GLP-1 .
- inventors consider that, in fact, the DPP-4 inhibitors themselves activate unrelated downstream GLP-1 R pathways that might be involved in neuroprotection.
- G-protein-coupled receptor (GPcR) coagulation factor II receptor-like 1 F2rl 1 , previously known as Par2
- DPP-IV G-protein-coupled receptor
- DPP-4 inhibitors could effectively reach the retina when administered topically to the surface of the eye (via cornea, sclera or conjunctiva), they suppose a real alternative also to the use of GLP-1 or of any GLP-1 agonist topically to the eye surface to reach the retina, since due to its non-peptide nature, they are more stable and easy to be manipulated when compositions comprising them are prepared.
- the statistical analysis of the retrieved data was made. Normal distribution of the variables was evaluated using the Kolmogorov-Smirnov test. The data were presented as mean ⁇ SD. Comparisons of continuous variables were performed using the unpaired Student t-test. When multiple comparisons were performed, one-way ANOVA followed by the Bonferroni test was used.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Ophthalmology & Optometry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Inorganic Chemistry (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2018013022A MX383599B (es) | 2016-04-29 | 2017-04-28 | Inhibidores de la dipeptidil peptidasa-4 para su uso en el tratamiento topico ocular de enfermedades neurodegenerativas de la retina, en particular en estadios tempranos de retinopatia diabetica y otras enfermedades retinianas en las que la neurodegeneracion desempe?a un papel esencial |
| CA3022152A CA3022152C (en) | 2016-04-29 | 2017-04-28 | DIPEPTIDYL PEPTIDASE-4 INHIBITORS FOR THE TOPICAL OCULAR TREATMENT OF RETINAL NEURODEGENERATIVE DISEASES |
| KR1020187033209A KR102411574B1 (ko) | 2016-04-29 | 2017-04-28 | 망막 신경변성 질환의 국소 안구 치료를 위한 디펩티딜 펩티다제-4 저해제 |
| RU2018140127A RU2744878C2 (ru) | 2016-04-29 | 2017-04-28 | Ингибиторы дипептидилпептидазы-4 для местного офтальмологического лечения нейродегенеративных заболеваний сетчатки |
| ES17722716T ES2863701T3 (es) | 2016-04-29 | 2017-04-28 | Inhibidores de la dipeptidil peptidasa-4 para el tratamiento tópico ocular de enfermedades neurodegenerativas de la retina |
| JP2018555725A JP7068706B2 (ja) | 2016-04-29 | 2017-04-28 | 網膜神経変性疾患の眼局所治療のためのジペプチジルペプチダーゼ-4阻害剤 |
| AU2017256803A AU2017256803B2 (en) | 2016-04-29 | 2017-04-28 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
| BR112018072127-1A BR112018072127A2 (pt) | 2016-04-29 | 2017-04-28 | inibidores de dipeptidil peptidase-4 para o tratamento ocular tópico de doenças neurodegenerativas da retina |
| DK17722716.2T DK3448388T3 (da) | 2016-04-29 | 2017-04-28 | Dipeptidyl-peptidase-4-inhibitorer til topikal øjenbehandling af retinale neurodegenerative sygdomme |
| EP17722716.2A EP3448388B1 (en) | 2016-04-29 | 2017-04-28 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
| CN201780030017.3A CN109152776B (zh) | 2016-04-29 | 2017-04-28 | 用于对视网膜神经退行性疾病的局部眼治疗的二肽基肽酶-4抑制剂 |
| US16/095,621 US11013738B2 (en) | 2016-04-29 | 2017-04-28 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
| IL262526A IL262526B (en) | 2016-04-29 | 2018-10-22 | Dipeptidyl peptidase 4 inhibitors for local treatment of neurodegenerative retinal diseases |
| US17/244,889 US11918577B2 (en) | 2016-04-29 | 2021-04-29 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16382190 | 2016-04-29 | ||
| EP16382190.3 | 2016-04-29 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/095,621 A-371-Of-International US11013738B2 (en) | 2016-04-29 | 2017-04-28 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
| US17/244,889 Continuation US11918577B2 (en) | 2016-04-29 | 2021-04-29 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017186934A1 true WO2017186934A1 (en) | 2017-11-02 |
Family
ID=55953092
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/060234 Ceased WO2017186934A1 (en) | 2016-04-29 | 2017-04-28 | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
Country Status (14)
| Country | Link |
|---|---|
| US (2) | US11013738B2 (enExample) |
| EP (1) | EP3448388B1 (enExample) |
| JP (1) | JP7068706B2 (enExample) |
| KR (1) | KR102411574B1 (enExample) |
| CN (1) | CN109152776B (enExample) |
| AU (1) | AU2017256803B2 (enExample) |
| BR (1) | BR112018072127A2 (enExample) |
| CA (1) | CA3022152C (enExample) |
| DK (1) | DK3448388T3 (enExample) |
| ES (1) | ES2863701T3 (enExample) |
| IL (1) | IL262526B (enExample) |
| MX (1) | MX383599B (enExample) |
| RU (1) | RU2744878C2 (enExample) |
| WO (1) | WO2017186934A1 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2727898C1 (ru) * | 2020-02-25 | 2020-07-24 | Общество с ограниченной ответственностью «Необиотек» | Фармацевтическая композиция на основе действующего вещества, ингибитора дипептидилпептидазы-4, для предупреждения развития и лечения сахарного диабета 2 типа |
| WO2022058947A1 (en) * | 2020-09-18 | 2022-03-24 | Invex Therapeutics Ltd | Method of reducing intraocular pressure |
| WO2026078034A1 (en) | 2024-10-09 | 2026-04-16 | Fundació Hospital Universitari Vall D'hebron - Institut De Recerca | Sitagliptin for use in retinal diseases with neovascularization |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2017256803B2 (en) * | 2016-04-29 | 2022-12-01 | Fundació Hospital Universitari Vall D'hebron - Institut De Recerca | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
| CN111166870A (zh) * | 2020-03-18 | 2020-05-19 | 复旦大学附属眼耳鼻喉科医院 | 艾塞那肽在制备滴眼治疗眼部缺血疾病、改善眼部血液循环的药物中的应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080221200A1 (en) * | 2005-09-30 | 2008-09-11 | Malcolm Allison | Combination of Organic Compounds |
| EP2444094A1 (en) * | 2009-06-16 | 2012-04-25 | Hainan Deze Drug Research Co., Ltd. | Mangiferin-berberine salt, manufacturing method and use thereof |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE122010000020I1 (de) * | 1996-04-25 | 2010-07-08 | Prosidion Ltd | Verfahren zur Senkung des Blutglukosespiegels in Säugern |
| US7560597B2 (en) * | 2007-03-08 | 2009-07-14 | The University Court Of The University Of Aberdeen | 2′,4′-dichloro-biphenyl-4-yl-hydroxy-ketones and related compounds and their use as therapeutic agents |
| US8334385B2 (en) * | 2007-11-02 | 2012-12-18 | Glenmark Generics Limited | Process for the preparation of R-sitagliptin and its pharmaceutically acceptable salts thereof |
| EP2249643A4 (en) * | 2008-02-05 | 2013-10-09 | Merck Sharp & Dohme | PHARMACEUTICAL COMPOSITIONS OF A COMBINATION OF METFORMIN AND A DIPEPTIDYL PEPTIDASE IV HEMMER |
| EP2251028A1 (en) * | 2009-05-12 | 2010-11-17 | Biocompatibles Uk Ltd. | Treatment of eye diseases using encapsulated cells encoding and secreting an anti-angiogenic factor and/or a neuroprotective factor |
| TWI469785B (zh) * | 2012-04-25 | 2015-01-21 | Inovobiologic Inc | 用於治療代謝性疾病之膳食纖維組成物 |
| ES2644016T3 (es) * | 2013-03-01 | 2017-11-27 | Fundació Hospital Universitari Vall D' Hebron - Institut De Recerca | Péptidos para su uso en el tratamiento tópico de enfermedades neurodegenerativas retinianas, en particular en estadios tempranos de retinopatía diabética y otras enfermedades retinianas en las que la neurodegeneración desempeña un papel esencial |
| WO2014198906A1 (en) * | 2013-06-14 | 2014-12-18 | Boehringer Ingelheim International Gmbh | Dpp-4 inhibitors for treating diabetes and its complications |
| AU2017256803B2 (en) * | 2016-04-29 | 2022-12-01 | Fundació Hospital Universitari Vall D'hebron - Institut De Recerca | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases |
-
2017
- 2017-04-28 AU AU2017256803A patent/AU2017256803B2/en active Active
- 2017-04-28 ES ES17722716T patent/ES2863701T3/es active Active
- 2017-04-28 DK DK17722716.2T patent/DK3448388T3/da active
- 2017-04-28 EP EP17722716.2A patent/EP3448388B1/en active Active
- 2017-04-28 MX MX2018013022A patent/MX383599B/es unknown
- 2017-04-28 CA CA3022152A patent/CA3022152C/en active Active
- 2017-04-28 US US16/095,621 patent/US11013738B2/en active Active
- 2017-04-28 JP JP2018555725A patent/JP7068706B2/ja active Active
- 2017-04-28 KR KR1020187033209A patent/KR102411574B1/ko active Active
- 2017-04-28 WO PCT/EP2017/060234 patent/WO2017186934A1/en not_active Ceased
- 2017-04-28 CN CN201780030017.3A patent/CN109152776B/zh active Active
- 2017-04-28 RU RU2018140127A patent/RU2744878C2/ru active
- 2017-04-28 BR BR112018072127-1A patent/BR112018072127A2/pt not_active Application Discontinuation
-
2018
- 2018-10-22 IL IL262526A patent/IL262526B/en unknown
-
2021
- 2021-04-29 US US17/244,889 patent/US11918577B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080221200A1 (en) * | 2005-09-30 | 2008-09-11 | Malcolm Allison | Combination of Organic Compounds |
| EP2444094A1 (en) * | 2009-06-16 | 2012-04-25 | Hainan Deze Drug Research Co., Ltd. | Mangiferin-berberine salt, manufacturing method and use thereof |
Non-Patent Citations (3)
| Title |
|---|
| CHOON-SOO LEE ET AL: "Dipeptidyl Peptidase-4 Inhibitor Increases Vascular Leakage in Retina through VE-cadherin Phosphorylation", SCIENTIFIC REPORTS, vol. 6, no. 1, 6 July 2016 (2016-07-06), XP055392324, DOI: 10.1038/srep29393 * |
| RAHUL S. PANDIT ET AL: "Retinal and lens protective effect of sitagliptin in streptozotocin induced type-I diabetic wistar rats", BIOMEDICINE & AGING PATHOLOGY, vol. 3, no. 2, 1 April 2013 (2013-04-01), pages 65 - 73, XP055308016, ISSN: 2210-5220, DOI: 10.1016/j.biomag.2013.04.002 * |
| YUYA NAKAMURA ET AL: "Diabetes therapies in hemodialysis patients: Dipeptidase-4 inhibitors", WORLD JOURNAL OF DIABETES, vol. 6, no. 6, 1 January 2015 (2015-01-01), pages 840, XP055327062, ISSN: 1948-9358, DOI: 10.4239/wjd.v6.i6.840 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2727898C1 (ru) * | 2020-02-25 | 2020-07-24 | Общество с ограниченной ответственностью «Необиотек» | Фармацевтическая композиция на основе действующего вещества, ингибитора дипептидилпептидазы-4, для предупреждения развития и лечения сахарного диабета 2 типа |
| WO2021173036A1 (ru) * | 2020-02-25 | 2021-09-02 | Общество с ограниченной ответственностью "Необиотек" | Фармацевтическая композиция на основе ингибитора дипептидилпептидазы-4 |
| WO2022058947A1 (en) * | 2020-09-18 | 2022-03-24 | Invex Therapeutics Ltd | Method of reducing intraocular pressure |
| WO2026078034A1 (en) | 2024-10-09 | 2026-04-16 | Fundació Hospital Universitari Vall D'hebron - Institut De Recerca | Sitagliptin for use in retinal diseases with neovascularization |
Also Published As
| Publication number | Publication date |
|---|---|
| MX383599B (es) | 2025-03-14 |
| US20210315890A1 (en) | 2021-10-14 |
| EP3448388B1 (en) | 2020-11-18 |
| RU2018140127A3 (enExample) | 2020-07-02 |
| EP3448388A1 (en) | 2019-03-06 |
| CN109152776B (zh) | 2022-04-29 |
| KR102411574B1 (ko) | 2022-06-21 |
| US11013738B2 (en) | 2021-05-25 |
| CN109152776A (zh) | 2019-01-04 |
| JP2019519479A (ja) | 2019-07-11 |
| AU2017256803B2 (en) | 2022-12-01 |
| ES2863701T3 (es) | 2021-10-11 |
| AU2017256803A1 (en) | 2018-12-06 |
| CA3022152C (en) | 2024-10-29 |
| BR112018072127A2 (pt) | 2019-03-19 |
| KR20190003575A (ko) | 2019-01-09 |
| RU2744878C2 (ru) | 2021-03-16 |
| IL262526B (en) | 2022-05-01 |
| US11918577B2 (en) | 2024-03-05 |
| CA3022152A1 (en) | 2017-11-02 |
| DK3448388T3 (da) | 2021-02-08 |
| IL262526A (en) | 2018-12-31 |
| JP7068706B2 (ja) | 2022-05-17 |
| RU2018140127A (ru) | 2020-05-29 |
| US20190134030A1 (en) | 2019-05-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11918577B2 (en) | Dipeptidyl peptidase-4 inhibitors for topical eye treatment of retinal neurodegenerative diseases | |
| US9707273B2 (en) | Peptides for use in the topical treatment of retinal neurodegenerative diseases, in particular in early stages of diabetic retinopathy and other retinal diseases in which neurodegeneration plays an essential role | |
| EP3886858B1 (en) | Compounds for treatment of eye diseases associated with excessive vascularisation | |
| CN114786480B (zh) | 使用内皮素受体拮抗剂治疗眼部疾病 | |
| US20210299219A1 (en) | Compositions and methods for prevention and treatment of corneal haze and scarring | |
| CN107454841A (zh) | 内皮素受体拮抗剂的局部眼用制剂及其用途 | |
| Cherait et al. | More Than Three Decades After Discovery of the Neuroprotective Effect of PACAP, What Is Still Preventing Its Clinical Use? | |
| US20210353710A1 (en) | Glp-1r agonist and methods of treatment | |
| JP2022547324A (ja) | 網膜および脈絡膜の構造ならびに機能を回復させるための組成物および方法 | |
| US20240000891A1 (en) | Growth and differentiation factor 15 for treatment of proliferative vitreoretinopathy therapy | |
| Adán-Castro et al. | Topical ophthalmic administration of vian-c4551 antiangiogenic peptide for diabetic macular edema: preclinical efficacy and ocular pharmacokinetics | |
| KR20220051791A (ko) | Fas 신호전달 억제용 펩타이드를 포함하는 황반변성 예방 또는 치료용 조성물 | |
| RU2860337C2 (ru) | Офтальмологическая фармацевтическая композиция и ее применение | |
| HK40061312B (en) | Compounds for treatment of eye diseases associated with excessive vascularisation | |
| HK40061312A (en) | Compounds for treatment of eye diseases associated with excessive vascularisation | |
| Ferrer et al. | Ophthalmic therapeutics: new basic research and clinical studies | |
| KR20140097485A (ko) | 망막 보호용의 7-(1h-이미다졸-4-일메틸)-5,6,7,8-테트라하이드로-퀴놀린을 포함하는 약제학적 조성물 | |
| US20140213605A1 (en) | Methods for treating eye disorders using opioid receptor antagonists |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3022152 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018555725 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018072127 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20187033209 Country of ref document: KR Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17722716 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017722716 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017722716 Country of ref document: EP Effective date: 20181129 |
|
| ENP | Entry into the national phase |
Ref document number: 2017256803 Country of ref document: AU Date of ref document: 20170428 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112018072127 Country of ref document: BR Kind code of ref document: A2 Effective date: 20181026 |