WO2017009484A1 - Anti-inflammatory peptides, and uses thereof - Google Patents
Anti-inflammatory peptides, and uses thereof Download PDFInfo
- Publication number
- WO2017009484A1 WO2017009484A1 PCT/EP2016/067090 EP2016067090W WO2017009484A1 WO 2017009484 A1 WO2017009484 A1 WO 2017009484A1 EP 2016067090 W EP2016067090 W EP 2016067090W WO 2017009484 A1 WO2017009484 A1 WO 2017009484A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- sequence
- seq
- fragment
- composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0014—Skin, i.e. galenical aspects of topical compositions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q5/00—Preparations for care of the hair
- A61Q5/02—Preparations for cleaning the hair
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P20/00—Technologies relating to chemical industry
- Y02P20/50—Improvements relating to the production of bulk chemicals
- Y02P20/55—Design of synthesis routes, e.g. reducing the use of auxiliary or protecting groups
Definitions
- Inflammation is a vast biological process and an integral part of our immune response.
- the inflammatory response may be acute (short lived) or chronic (longer lasting) and can occur in almost every part of the body whether it be internal or external.
- the biological changes that occur within the body due to the inflammation response are the same throughout the body, meaning the modes of reducing inflammation, which different anti-inflammatory agents carry are the same in all parts of the body.
- inflammation is a natural response and a necessary one that rids the cells of injury causes, foreign attacks, or removes dead cells.
- excess inflammation has drastic and sometimes detrimental effects on the human body.
- an inflammatory response can have long-lasting, negative consequences such as tissue damage.
- tissue damage During an inflammatory response, the body releases lysosomal enzymes which can damage tissue and can even lead to a life-threatening hypersensitivity reaction.
- These conditions can have long-lasting effects both externally, with the development of acute skin rashes and eczema, and internally, triggering diseases such as inflammatory bowel disease.
- maintaining a normal level of inflammation is very important for our health and wellbeing, both inside and out.
- inflammation is on the rise.
- One of the major factors of this increase comes from our exposure to an increasing variety of external agents that our bodies are not accustomed to.
- NSAIDs non-steroidal anti-inflammatory drugs
- NSAIDs non-steroidal anti-inflammatory drugs
- NSAIDs include: Immunosuppressives (methotrexate, ciclosporin); Specific biological drugs (mostly TNF-alpha inhibitors, but also inhibitors of cyclooxygenase enzyme for example); Cytotoxic drugs; and Oral retinoids (acitretin).
- topical treatments exist to specifically reduce skin inflammation. Examples include creams and ointment (mostly cortisone based), and physical treatments like UV radiations.
- These drugs however have drastic side-effects such as gastrointestinal toxicity and anaphylactoid reactions. They can even suppress the immune system to such a point that it is made vulnerable to other diseases and pathogens.
- the pea genome codes for over 70,000 different proteins.
- the Applicant has identified seven of these proteins, each of which contains one or more anti-inflammatory fragments.
- the Applicant has identified eight proteins, each of which contains one or more anti-inflammatory fragments.
- the anti-inflammatory fragments of the sixteen identified proteins have been shown to have anti-inflammatory activity when incubated with LPS-stimulated human cells (Figs 1 to 19), do not cause human cell viability issues (Fig. 20) and are not toxic to human cells (Fig. 21).
- the specific plant proteins from which the natural peptides are derived are provided in SEQUENCE ID NO: 1-15 and 353-355, especially from regions of the proteins provided in SEQUENCE ID NO: 17-69.
- the specific pea proteins from which the peptides are derived are provided in SEQUENCE ID NO: 1 to 5, 8 and 9, and the specific rice proteins from which the peptides are derived are provided in SEQUENCE ID NO: 6, 7 and 10 to 15. Homologs of these proteins are described in SEQUENCE ID NO: 222-267.
- the specific peptides initially identified in the pea proteins are shown in SEQUENCE ID NO's: 71-107 and 110-111.
- the specific peptides initially identified in the rice proteins are shown in SEQUENCE ID NO's: 108-109 and 112-220.
- Additional peptides of the invention identified in the pea and rice proteins are provided herein, for example in SEQUENCE ID NO: 320, 331 to 352, and 356-424.
- the peptide of the invention encompasses peptides comprising or consisting of any of the afore-mentioned peptides.
- EWQINEK (SEQ ID 331) - Fragment of rice protein of SEQ ID 7
- FLPQHTD (SEQ ID 332) - Fragment of pea protein of SEQ ID 1
- RGPQQYA (SEQ ID 341) - Fragment of rice protein of SEQ ID 7
- DALEPDNR (SEQ ID 342) - Fragment of pea protein of SEQ ID 354
- SEEGYYGEQQQQPGMTR (SEQ ID 343) - Fragment of rice protein of SEQ ID 353
- GYYGEQQQQPGMTR (SEQ ID 344) - Fragment of rice protein of SEQ ID 353
- IDGYDTPVEGR (SEQ ID 345) - Fragment of rice protein of SEQ ID 15
- NGVLRPGQL (SEQ ID 346) - Fragment of rice protein of SEQ ID 14
- LDALEPDNR [SEQ ID 352] - Fragment of pea protein of SEQ ID 354
- the invention provides a peptide, typically 3 to 50 amino acids in length, and comprising a fragment of a protein disclosed herein, for example selected from SEQUENCE ID NO's: 1 to 16, 349 or 350, or a homolog thereof, or a variant or fragment of the peptide (hereafter "peptide of the invention").
- the peptide or variant or fragment thereof is bioactive.
- the peptide or variant or fragment thereof has anti- inflammatory activity.
- the peptide of the invention comprises a sequence selected from SEQUENCE ID NO: 17-220, 268-352, and 356-424. In one embodiment, the peptide of the invention consists essentially of a sequence selected from SEQUENCE ID NO: 17-220, 268-352, and 356-424.
- the peptide consists of 3-50 amino acids. In one embodiment, the peptide consists of 4-50 amino acids. In one embodiment, the peptide consists of 5-50 amino acids. In one embodiment, the peptide consists of 6-50 amino acids.
- the fragment has between 7 and 37 amino acids and a charge of between -9 and +3.
- the c-terminal amino acid is not cysteine (C) or methionine (M).
- the n-terminal amino acid is not cysteine (C), histidine (H), proline (P) or threonine (T)
- the c-terminal domain of the fragment does not contain cysteine (C).
- the n-terminal domain of the fragment does not contain cysteine (C).
- the fragment does not contain cysteine (C).
- the peptide does not contain cysteine (C).
- the fragment is from a region of the proteins of SEQUENCE ID NO's: 1 to 16, which regions are characterised by the following features:
- the c-terminal amino acid is not aspartic acid (D), phenylalanine (F), methionine (M) or tryptophan (W);
- n-terminal amino acid is not aspartic acid (D), histidine (H), methionine (M), proline (P) or tryptophan (W).
- the c-terminal domain of the region does not contain tryptophan (W).
- the regions of the proteins of SEQUENCE ID NO's: 1 to 7 are selected from the SEQUENCE ID NO's: 17-33.
- the regions of the proteins of SEQUENCE ID NO's: 8 to 16 are selected from the SEQUENCE ID NO's: 34-70.
- the regions of the proteins of SEQUENCE ID NO's: 1 to 16 are selected from the SEQUENCE ID NO's: 17-70.
- the fragment is selected from SEQUENCE ID NO's: 71 to 221, or a variant of the fragment.
- the peptide consists of a fragment selected from SEQUENCE ID NO's: 71 to 221, or a variant of the fragment.
- the peptide consists of a sequence selected from SEQUENCE ID NO's: 71 to 221.
- the peptide comprises a fragment of a pea protein, wherein the fragment is selected from SEQUENCE ID NO: 71-107, 332, 334, 335, 337-340, 342, 348 and 351-352. In one embodiment, the peptide comprises a fragment of a pea protein, wherein the fragment is selected from SEQUENCE ID NO: 71-107, 332, 334, 335, 337-340, 342, 348 and 351-352. In one embodiment, the fragment is selected from 339, 352, 351, 93, 92, 75, 76, 105.
- the peptide comprises a fragment of a rice protein, wherein the fragment is selected from SEQUENCE ID NO: 108-109, 112-220, 320, 331, 333, 336, 341, 343-346, 349-350. In one embodiment, the fragment is selected from 341, 144, 320, 349, 350, 177, 343-346.
- the peptide is a modified peptide. In one embodiment the peptide is modified with a protecting group. In one embodiment, the peptide is modified to increase its lipophilicity. In none embodiment, the peptide is modified to increase its half-life. In one embodiment, an N or C-terminal amino acid of the peptide is modified. In one embodiment, the N or C-terminal amino acid of the peptide is modified with a protecting group.
- the invention also provides a conjugate comprising a peptide of the invention conjugated to a binding partner.
- the peptide of the invention is modified with a reactive group configured to allow conjugation to the binding partner.
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 1, or a homolog thereof, or a bioactive variant of the protein fragment.
- the peptide comprises a bioactive fragment of one of seven regions of SEQUENCE ID NO: 1, namely SEQUENCE ID NO'S: 17 to 23, or a bioactive variant of the protein fragment.
- the peptide comprises a bioactive fragment selected from SEQUENCE ID NO'S: 71 to 91 or 360, or a bioactive variant of the protein fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO: 17, for example SEQUENCE ID NO: 71, or a bioactive variant of the protein fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO: 18, for example SEQUENCE ID NO: 72, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO: 19, for example either or both of SEQUENCE ID NO: 73 or 74, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:20, for example either or both of SEQUENCE ID NO: 75 or 76. or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:21, for example one or more or all of SEQUENCE ID NO: 77 to 84, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:22, for example one or more or all of SEQUENCE ID NO: 85 to 89, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:23, for example SEQUENCE ID NO: 90 or a bioactive variant of the fragment.
- the peptide comprises SEQUENCE ID NO: 91, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one peptide of the invention, which peptide includes a fragment of SEQUENCE ID NO: 1 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a different fragment of SEQUENCE ID NO: 1 or a homolog thereof.
- the peptide or peptides are bioactive.
- the peptide or peptides are anti-inflammatory.
- the composition comprises a first peptide of the invention that comprises afragment of a first region selected from SEQUENCE ID NO'S: 17 to 23, and a second peptide of the invention that comprises fragment of a second region selected from SEQUENCE ID NO'S: 17 to 23.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 71 to 91 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO: 71 to 91 (or a bioactive variant of the fragment).
- Pea Protein 1 Homologs of Pea Protein 1 (SEQUENCE ID NO: 1) include Vicia fabia, Cicer arietinum and Lens culinaris homologs (SEQ ID NO: 222-224). [SEQUENCE ID NO: 2 (Pea Protein 2)1
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 2, or a homolog thereof.
- the peptide comprises a bioactive fragment of one of two regions of SEQUENCE ID NO: 2, namely SEQUENCE ID NO'S: 24 or 25.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:24, for example SEQUENCE ID NO: 92, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:25, for example SEQUENCE ID NO: 93, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 2 or a homolog thereof.
- the invention also provides a composition comprising at least two bioactive peptides of the invention, each of which comprises a different bioactive fragment of SEQUENCE ID NO: 2 or a homolog thereof.
- the composition comprises a first bioactive peptide comprising a bioactive fragment of the region of SEQUENCE ID NO 24, and a second bioactive peptide comprising a bioactive fragment of the region of SEQUENCE ID NO 25.
- the composition comprises a first bioactive peptide comprising a bioactive fragment of SEQUENCE ID NO 92, and a second bioactive peptide comprising a bioactive fragment of SEQUENCE ID NO 93.
- Homologs of Pea Protein 2 include Lens culinaris, Vicia narbonensis and Glycine max (SEQ ID NO: 225-227).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO:
- the peptide comprises a bioactive fragment of one of two regions of SEQUENCE ID NO: 3, namely SEQUENCE ID NO'S: 26 or 27.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:26, for example SEQUENCE ID NO: 94, or a bioactive variant the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:27, for example SEQUENCE ID NO: 95, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 3 or a homolog thereof.
- the invention also provides a composition comprising at least two bioactive peptides of the invention, each of which comprises a different bioactive fragment of SEQUENCE ID NO: 3 or a homolog thereof.
- the composition comprises a first peptide comprising a bioactive fragment of the region of SEQUENCE ID NO 26, and a second peptide comprising a bioactive fragment of SEQUENCE ID NO 27.
- the composition comprises a first bioactive peptide comprising a bioactive fragment of SEQUENCE ID NO 94 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a bioactive fragment of SEQUENCE ID NO 95 (or a bioactive variant of the fragment).
- Homologs of Pea Protein 3 include Vicia sativa, Medicago truncatula, and Lotus japonicas (SEQ ID NO: 228-230).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO:
- the peptide comprises a bioactive fragment of one of five regions of SEQUENCE ID NO: 4, namely SEQUENCE ID NO'S: 28 to 32.
- the region is SEQUENCE ID NO: 28, preferably SEQUENCE ID NO: 29, preferably SEQUENCE ID NO: 30, preferably SEQUENCE ID NO: 31 , preferably SEQUENCE ID NO: 32.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:28, for example SEQUENCE ID NO: 96, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:29, for example SEQUENCE ID NO: 97 to 103, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:30, for example SEQUENCE ID NO: 104, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:31, for example SEQUENCE ID NO: 105, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:32, for example SEQUENCE ID NO: 106, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 4 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention that comprise different bioactive fragments of SEQUENCE ID NO: 4 or a homolog thereof.
- the composition comprises a first peptide comprising a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 28 to 32, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 28 to 32.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 96 to 106 (or an a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO 96 to 106 (or a bioactive variant of the fragment).
- Homologs of Pea Protein 4 include Pisum abyssinicum, Lathyrus annuus, and Vicia villosa (SEQ ID 231-233).
- SEQUENCE ID NO: 5 (Pea Protein 5)1
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 5, or a homolog thereof.
- the peptide comprises a bioactive fragment of a region of SEQUENCE ID NO: 5, namely the region of SEQUENCE ID NO 33, for example SEQUENCE ID NO: 107, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 5 or a homolog thereof.
- the invention also provides a composition comprising at least two peptides of the invention that comprise at least one bioactive fragment of SEQUENCE ID NO: 5 or a homolog thereof, for example SEQUENCE ID NO: 107.
- Homologs of Pea Protein 5 include Medicago truncatula, Vicia peregrine, and Vicia lutea (SEQ ID NO: 234-236).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 6 or a homolog thereof.
- the peptide comprises a bioactive fragment of SEQUENCE ID NO: 108, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 6 or a homolog thereof.
- the invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQUENCE ID NO: 6 or a homolog thereof, for example SEQUENCE ID NO: 108 (SP1).
- Homologs of Rice Protein 7 include Oryza, brachyantha, Avena sativa, and Brachypodium distachyon (SEQ ID NO: 237-239).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO:
- the peptide comprises a bioactive fragment of SEQUENCE ID NO: 109 (SP2), or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 7 or a homolog thereof.
- the invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQUENCE ID NO: 7 or a homolog thereof, for example SEQUENCE ID NO: 109 (SP2).
- Homologs of Rice Protein 8 include Oryza sativa Japonica Group, Oryza sativa Indica Group, and Oryza brachyantha (SEQ ID NO: 240-242). [SEQUENCE ID NO: 8 (Pea Protein 6 - PI 3919)1
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO:
- the peptide comprises a bioactive fragment of SEQUENCE ID NO: 110 (SP3), or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 8 or a homolog thereof.
- the invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQUENCE ID NO: 8 or a homolog thereof, for example SEQUENCE ID NO: 110 (SP3).
- Pea Protein 8 Homologs of Pea Protein 8 (SEQUENCE ID NO: 8) include Pisum fulvum, Pisum abyssinicum and Vicia villosa (SEQ ID NO: 243-245). [SEQUENCE ID NO: 9 (Pea Protein 7 - P02855 !
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 9 or a homolog thereof.
- the peptide comprises a bioactive fragment of SEQUENCE ID NO: 111 (SP4), or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 9 or a homolog thereof.
- the invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQUENCE ID NO: 9 or a homolog thereof, for example SEQUENCE ID NO: 111 (SP4).
- Homologs of Pea Protein 9 include Lathyrus hirsutus, Lathyrus cicero, Lathyrus sativus (SEQ ID NO: 246-248).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 10 or a homolog thereof.
- the peptide comprises a fragment of one of nine regions of SEQUENCE ID NO: 10, namely SEQUENCE ID NO'S: 34 to 42.
- the region is SEQUENCE ID NO: 34, preferably SEQUENCE ID NO: 35, preferably SEQUENCE ID NO: 36, preferably SEQUENCE ID NO: 37, preferably SEQUENCE ID NO: 38, preferably SEQUENCE ID NO: 39, preferably SEQUENCE ID NO: 40, preferably SEQUENCE ID NO: 41, preferably SEQUENCE ID NO: 42.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:34, for example SEQUENCE ID NO: 112 or SEQUENCE ID NO: 113 or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:35, for example SEQUENCE ID NO: 114, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:36, for example SEQUENCE ID NO: 115 or SEQUENCE ID NO: 116, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:37, for example SEQUENCE ID NO: 117 or SEQUENCE ID NO: 118, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:38, for example SEQUENCE ID NO: 119, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:39, for example SEQUENCE ID NO: 120, 121 or 122, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:40, for example SEQUENCE ID NO: 123, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:41, for example SEQUENCE ID NO: 124, 125, 126, 127, 128 or 129, or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:42, for example SEQUENCE ID NO: 130, 131 or 132, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 10 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a different bioactive fragment of SEQUENCE ID NO: 10 or a homolog thereof.
- the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 34 to 42, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 34 to 42.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 112 to 132 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO 112 to 132 (or a bioactive variant of the fragment).
- Homologs of Rice Protein 1 include Oryza brachyantha, and Zizania latifolia (SEQ ID NO: 249-251). [SEQUENCE ID NO: 11 (Rice Protein 2 - P07728)!
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 11 or a homolog thereof.
- the peptide comprises a bioactive fragment of one of four regions of SEQUENCE ID NO: 11, namely SEQUENCE ID NO'S: 43 to 46.
- the region is SEQUENCE ID NO: 43, preferably SEQUENCE ID NO: 44, preferably SEQUENCE ID NO: 45, preferably SEQUENCE ID NO: 46.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:43, for example SEQUENCE ID NO: 133 or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:44, for example SEQUENCE ID NO: 134 to 137, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:45, for example SEQUENCE ID NO: 138 to 144, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:46, for example SEQUENCE ID NO: 145, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 11 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQUENCE ID NO: 11 or a homolog thereof.
- the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 43 to 46, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 43 to 46.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 133 to 145 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO 133 to 145 (or a bioactive variant of the fragment).
- Homologs of Rice Protein 2 include Oryza sativa Indica Group, Zizania latifolia, Avena sativa (SEQ ID NO: 252-254).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 12 or a homolog thereof.
- the peptide comprises a bioactive fragment of one of eight regions of SEQUENCE ID NO: 12, namely SEQUENCE ID NO'S: 47 to 54.
- the region is SEQUENCE ID NO: 47, preferably SEQUENCE ID NO: 48, preferably SEQUENCE ID NO: 49, preferably SEQUENCE ID NO: 50, preferably SEQUENCE ID NO: 51, preferably SEQUENCE ID NO: 52, preferably SEQUENCE ID NO: 53, preferably SEQUENCE ID NO: 54.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:47, for example one of SEQUENCE ID NO: 146 to 150, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:48, for example one of SEQUENCE ID NO: 151 to 157, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:49, for example one of SEQUENCE ID NO: 158 or SEQUENCE ID NO: 159, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:50, for example one of SEQUENCE ID NO: 160 to 162, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:51, for example one of SEQUENCE ID NO: 163 or 164, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:52, for example SEQUENCE ID NO: 165, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:53, for example one of SEQUENCE ID NO: 166 to 171, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:54, for example one of SEQUENCE ID NO: 172 to 176, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 12 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQUENCE ID NO: 12 or a homolog thereof.
- the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 47 to 54, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 47 to 54.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 146 to 172 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second anti-inflammatory fragment selected from SEQUENCE ID NO 146 to 172 (or a bioactive variant of the fragment).
- Homologs of Rice Protein 3 include Oryza brachyantha, Brachipodium distachyon (SEQ ID NO: 255-257).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 13 or a homolog thereof.
- the peptide comprises a bioactive fragment of a region of SEQUENCE ID NO: 13, namely SEQUENCE ID NO 55, for example SEQUENCE ID NO: 177, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 13 or a homolog thereof.
- the invention also provides a composition comprising at least 2 peptides of the invention, at least one of which comprises a bioactive fragment of SEQUENCE ID NO: 13 or a homolog thereof, for example SEQUENCE ID NO: 177, or a bioactive variant of the fragment.
- Homologs of Rice Protein 4 include Oryza sativa Indica Group, Zizania latifolia, Avena sativa (SEQ ID NO: 252-254). [SEQUENCE ID NO: 14 (Rice Protein 5 - P14614)!
- the peptide comprises a fragment of the protein of SEQUENCE ID NO: 14 or a homolog thereof.
- the peptide comprises a bioactive fragment of one of seven regions of SEQUENCE ID NO: 14, namely SEQUENCE ID NO'S: 56 to 62.
- the region is SEQUENCE ID NO: 56, preferably SEQUENCE ID NO: 57, preferably SEQUENCE ID NO: 58, preferably SEQUENCE ID NO: 59, preferably SEQUENCE ID NO: 60, preferably SEQUENCE ID NO: 61, preferably SEQUENCE ID NO: 62.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:56, for example one of SEQUENCE ID NO: 178 to 180 or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:57, for example one of SEQUENCE ID NO: 181 to 182, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:58, for example SEQUENCE ID NO: 183, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:59, for example one of SEQUENCE ID NO: 184 to 190, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:60, for example SEQUENCE ID NO: 191, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:61, for example one of SEQUENCE ID NO: 192 to 195, or a bioactive variant of the fragment.
- the peptide comprises a bioactive fragment of the region of SEQUENCE ID NO:62, for example one of SEQUENCE ID NO: 196 to 197, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 14 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQUENCE ID NO: 14 or a homolog thereof.
- the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 56 to 62, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 56 to 62.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 178 to 197 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO 178 to 197 (or a bioactive variant of the fragment).
- Homologs of Rice Protein 5 include Oryza sativa Japonica Group, Brachipodium distachyon (SEQ ID NO: 261-263).
- SEQUENCE ID NO: 15 (Rice Protein 6 - O0DEV5)l
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 15 or a homolog thereof.
- the peptide comprises a bioactive fragment of one of seven regions of SEQUENCE ID NO: 15, namely SEQUENCE ID NO'S: 63 to 67.
- the region is SEQUENCE ID NO: 63, preferably SEQUENCE ID NO: 64, preferably SEQUENCE ID NO: 65, preferably SEQUENCE ID NO: 66, preferably SEQUENCE ID NO: 67.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:63, for example one of SEQUENCE ID NO: 198 to 200, or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:64, for example one of SEQUENCE ID NO: 201 to 203 or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:65, for example SEQUENCE ID NO: 204 or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:66, for example one of SEQUENCE ID NO: 205 to 208 or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:67, for example one of SEQUENCE ID NO:209 to 215 or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:68, for example one of SEQUENCE ID NO: 216 to 219, or a bioactive variant of the fragment.
- the peptide comprises a fragment of the region of SEQUENCE ID NO:69, for example SEQUENCE ID NO: 220, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 15 or a homolog thereof.
- the invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQUENCE ID NO: 15 or a homolog thereof.
- the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQUENCE ID NO'S: 63 to 69, and a second peptide that comprises a bioactive fragment of a second region selected from SEQUENCE ID NO'S: 63 to 69.
- the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQUENCE ID NO: 198 to 220 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQUENCE ID NO 198 to 220 (or a bioactive variant of the fragment).
- Homologs of Rice Protein 6 include Oryza rufipogon, Oryza officinalis, Hordeum vulgare subsp. vulgare (SEQ ID NO: 264-266).
- the peptide comprises a bioactive fragment of the protein of SEQUENCE ID NO: 16 or a homolog thereof.
- the peptide comprises a bioactive fragment of a region of SEQUENCE ID NO: 16, namely the region of SEQUENCE ID NO 70.
- the peptide is SEQUENCE ID NO 221, or a bioactive variant of the fragment.
- the invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQUENCE ID NO: 16 or a homolog thereof.
- the invention also provides a composition comprising at least 2 peptides of the invention, at least one of which comprises a fragment of SEQUENCE ID NO: 16 or a homolog thereof, for example SEQUENCE ID NO: 212 or a bioactive variant of the fragment.
- Homologs of Bacterial Protein 1 include:
- the invention also provides bioactive composition comprising at least one and preferably a plurality of bioactive peptides of the invention, wherein each of the peptides of the invention comprises a bioactive fragment of a protein described herein.
- the protein is selected from SEQUENCE ID NO: 1 to 16.
- the or each peptide of the invention is selected from, or comprises a bioactive fragment selected from, SEQUENCE ID NO: 71- 220, or a bioactive variant of the fragment.
- the composition comprises a peptide of the invention, which peptide comprises a sequence selected from SEQUENCE ID NO: 17-220, 268-352, and 356-424.
- the composition comprises peptide of the invention, which peptide consists essentially of a sequence selected from SEQUENCE ID NO: 17-220, 268-352, and 356-424.
- the or each peptide of the invention is selected from, or comprises a bioactive fragment selected from, SEQUENCE ID NO: 71-107 and 110-111, or a bioactive variant of the fragment.
- the or each peptide of the invention is selected from, or comprises an antiinflammatory fragment selected from, SEQUENCE ID NO: 108-109 and 112 to 220, or an anti-inflammatory variant of the fragment.
- the bioactive peptide, variant or fragment of the invention is antiinflammatory.
- the composition comprises at least two distinct peptides of the invention.
- the composition comprises at least three distinct peptides of the invention.
- the composition comprises at least four distinct peptides of the invention.
- the composition comprises at least five distinct peptides of the invention.
- the composition comprises at least six distinct peptides of the invention.
- the composition comprises at least seven distinct peptides of the invention.
- the composition comprises at least eight distinct peptides of the invention.
- the composition comprises at least nine distinct peptides of the invention.
- the composition comprises at least ten distinct peptides of the invention.
- the invention comprises a composition comprises one or more of SEQUENCE ID NO: 71-107 and 110-111, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.
- the composition comprises at least one, two, three, four, five or all of SEQUENCE ID NO'S 75, 91, 92, 93, 110 and 111.
- the composition comprises substantially all of fragments SEQUENCE ID NO: 71-107 and 110-111.
- the invention comprises a composition comprises one or more of SEQUENCE ID NO: 108-109 and 112 to 220, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.
- the composition comprises at least one, two or three of SEQUENCE ID NO'S 108, 109 and 144.
- the composition of the invention is enriched in peptides having a molecular weight of less than 10 KD. In one embodiment, the composition is depleted of cell debris.
- the composition of the invention is a powder.
- the invention comprises a composition comprising substantially all of fragments SEQUENCE ID NO: 108-109 and 112 to 220, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.
- the composition is edible (comestible).
- the composition is a food or beverage.
- the composition is a personal care composition.
- the composition is a pharmaceutical composition.
- the composition is nutritional supplement.
- the composition is solid.
- the composition is semi-solid (i.e. a cream, gel or lotion).
- the composition is liquid.
- the invention also relates to a comestible product comprising a peptide of the invention.
- the comestible product is man-made.
- the invention also relates to a comestible product comprising a composition of peptides of the invention.
- the comestible product is man-made.
- the comestible product is a food product for human or animal (mammalian) consumption.
- the man-made comestible product is a beverage. In one embodiment the man-made comestible product is a bakery product. In one embodiment the man-made comestible product is a dairy product. In one embodiment the man-made comestible product is a snack product. In one embodiment the man-made comestible product is a baked extruded food product. In one embodiment the man-made comestible product is powdered milk. In one embodiment the man-made comestible product is an infant formula product. In one embodiment the man-made comestible product is a confectionary product. In one embodiment the man-made comestible product is a yoghurt. In one embodiment the man- made comestible product is a yoghurt drink.
- the man-made comestible product is an ice cream product. In one embodiment the man-made comestible product is a frozen food product. In one embodiment the man-made comestible product is a breakfast cereal. In one embodiment the man-made comestible product is a bread. In one embodiment the man-made comestible product is a flavoured milk drink. In one embodiment the man- made comestible product is a confectionary bar. In one embodiment the man-made comestible product is a tea or tea product. In one embodiment the man-made comestible product is a based extruded snack product. In one embodiment the man-made comestible product is a fried snack product. In one embodiment the man-made comestible product is a nutritional supplement.
- the man-made comestible product is a sports nutritional product. In one embodiment the man-made comestible product is a baby food product. In one embodiment the man-made comestible product is a speciality food product for immunocompromised individuals. In one embodiment the man-made comestible product is a food for geriatric patients.
- the invention also relates to a man-made personal care composition comprising a peptide of the invention.
- the invention also relates to a man-made personal care composition comprising a composition of peptides of the invention.
- the personal care composition is a skincare product. In one embodiment the personal care composition is a haircare product. In one embodiment the personal care composition is a dentrifice product. In one embodiment the personal care composition is a perfumery product. In one embodiment the personal care composition is a deodorant product. In one embodiment the personal care composition is an anti-perspirant product. In one embodiment the personal care composition is a soap. In one embodiment the personal care composition is a liquid soap. In one embodiment the personal care composition is a cream. In one embodiment the personal care composition is a lotion. In one embodiment the personal care composition is a gel. In one embodiment the personal care composition is a powder. The invention also relates to a peptide of the invention for use in treatment or prevention of inflammation in a mammal. The invention also relates to a composition of peptides of the invention for use in treatment or prevention of inflammation in a mammal.
- the invention also relates to a peptide of the invention for use in treatment or prevention of an inflammatory disorder in a mammal.
- the invention also relates to a composition of peptides of the invention for use in treatment or prevention of an inflammatory disorder in a mammal.
- the inflammation is symptomatic inflammation.
- the inflammatory disorder is an inflammatory disorder of the joints. In one embodiment the inflammatory disorder is an inflammatory disorder of the cardiovascular system. In one embodiment the inflammatory disorder is an autoimmune disease. In one embodiment the inflammatory disorder is a lung and airway inflammatory disorder. In one embodiment the inflammatory disorder is an intestinal inflammatory disorder. In one embodiment the inflammatory disorder is dermatitis. In one embodiment the inflammatory disorder is acne vulgaris. In one embodiment the inflammatory disorder is psoriasis. In one embodiment the inflammatory disorder is rheumatoid arthritis. In one embodiment the inflammatory disorder is cardiovascular disease. In one embodiment the inflammatory disorder is atherosclerosis. In one embodiment the inflammatory disorder is Type I diabetes. In one embodiment the inflammatory disorder is Graves disease.
- the inflammatory disorder is Guillain-Barre disease. In one embodiment the inflammatory disorder is Lupus. In one embodiment the inflammatory disorder is Psoriatic arthritis. In one embodiment the inflammatory disorder is Ulcerative colitis. In one embodiment the inflammatory disorder is asthma. In one embodiment the inflammatory disorder is cystic fibrosis. In one embodiment the inflammatory disorder is COPD. In one embodiment the inflammatory disorder is emphysema. In one embodiment the inflammatory disorder is acute respiratory distress syndrome. In one embodiment the inflammatory disorder is colitis. In one embodiment the inflammatory disorder is inflammatory bowel disease. The invention also relates to a peptide of the invention for use in treatment or prevention of pain in a mammal. The invention also relates to a composition of peptides of the invention for use in treatment or prevention of pain in a mammal.
- the invention also relates to a peptide of the invention for use in treatment or prevention of a metabolic disorder in a mammal.
- the invention also relates to a composition of peptides of the invention for use in treatment or prevention of a metabolic disorder in a mammal.
- the metabolic disorder is pre-diabetes. In one embodiment, the metabolic disorder is diabetes. In one embodiment, the metabolic disorder is Type-1 diabetes. In one embodiment, the metabolic disorder is Type-2 diabetes. In one embodiment, the metabolic disorder is metabolic syndrome. In one embodiment, the metabolic disorder is obesity. In one embodiment, the metabolic disorder is diabetic dyslipidemia. In one embodiment, the metabolic disorder is hyperlipidemia. In one embodiment, the metabolic disorder is hypertension. In one embodiment, the metabolic disorder is hypertriglyceridemia. In one embodiment, the metabolic disorder is hyperfattyacidemia. In one embodiment, the metabolic disorder is hypercholerterolemia. In one embodiment, the metabolic disorder is hyperinsulinemia. In one embodiment, the metabolic disorder is MODY The invention also relates to a peptide of the invention for use in maintaining or restoring gut health in a mammal.
- the invention also relates to a composition of peptides of the invention for use in maintaining or restoring gut health in in a mammal.
- the invention also relates to a peptide of the invention for use in maintaining or restoring muscle health (for example lean tissue mass) in a mammal.
- the invention also relates to a composition of peptides of the invention for use in maintaining or restoring muscle health (for example lean tissue mass) in in a mammal.
- the invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising a peptide of the invention in combination with a pharmaceutically acceptable carrier.
- the invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising a composition of peptides of the invention in combination with a pharmaceutically acceptable carrier.
- peptides can be used in personal care, supplement, food and pharmaceutical products to treat and maintain healthy levels of inflammation throughout the body.
- the present invention meets the huge need for food-derived specific peptides and peptide compositions that reduces inflammation in a way that is able to be processed by the body without completely blocking the immune response and causing autoimmune issues and other undesirable side effects.
- the invention is ultimately helping the 2 billion people suffering from inflammation.
- the invention also relates to a comestible product, for example a food product comprising a composition of the invention, for example a dairy or non-dairy product, a solid food or a beverage, a food additive or supplement.
- a dairy product may be a milk, a cheese, or yoghurt.
- the food product is a snack bar.
- the food product may comprise any amount of the composition of the invention, for example from 0.1% to 30% (w/w).
- the peptides of the invention are used in the topical cosmetic or pharmaceutical composition of this invention at cosmetically or pharmaceutically effective concentrations to achieve the desired effect; in a preferred form with regards to the total weight of the composition, between 0.00000001% (in weight) and 20% (in weight); preferably between 0.000001% (in weight) and 15% (in weight), more preferably between 0.0001% (in weight) and 10% (in weight) and even more preferably between 0.0001% (in weight) and 5% (in weight).
- the peptides of the present invention are preferably used from about 0.00001% w/w to about 0.5% w/w [0.1 to 5000 ppm], and more preferably from 0.00005 w/w to about 0.05 w/w [0.5 to 500 ppm], and most preferably from about 0.0001 w/w to about 0.01 w/w of the composition [1 to 100 ppm].
- the peptides of the present invention are preferably used from about 0.0001% w/w to about 0.004% w/w of the composition.
- a typical daily dosage may be 0.2g to lOOg.
- compositions of the invention for use in food products and food supplements will be broadly in the 0.2-100 g/day range.
- the daily dosage is 1-10 g/day, ideally about 3-8 g/day.
- the daily dosage is 10-20 g/day.
- the daily dosage is 20-30 g/day.
- the daily dosage is 30-40 g/day.
- the daily dosage is 10-100 g/day.
- the daily dosage is about 5 g/day, ideally about 3-8 g/day.
- the dosage is 2-1000 mg/day/kg body weight.
- the dosage is 10-500 mg/day/kg body weight.
- the dosage is 10-100 mg/day/kg body weight. In one embodiment, the dosage is 30-70 mg/day/kg body weight.
- the dosage of peptides of the invention for food supplements may be 0.0000 lmg-O.Olmg per day or dose.
- the food product may be a Food for Specific Medicinal Purposes (FSMP) which is defined as foods that are specifically formulated, processed and intended for the dietary management of diseases, disorders or medical conditions of individuals who are being treated under medical supervision. These foods are intended for the exclusive or partial feeding of people whose nutritional requirements cannot be met by normal foods.
- the dose may be 50-500g per day depending on the age and condition of the patient. When administered as a food for special medicinal purpose, or medical food, the daily dosage may be 50-500g per day.
- the peptides and compositions of the invention may also be employed in the non-therapeutic treatment of inflammation.
- non-therapeutic treatment of inflammation include use to relieve normal, non-pathological, inflammation, for example inflammation in the muscles and joints following exercise.
- the invention also provides topical composition comprising a peptide of the invention.
- the topical composition may comprise a plurality of peptides, fragments and/or variants.
- the topical composition comprises substantially all the peptides.
- the topical composition comprises substantially all the variants.
- the topical composition of the invention may be presented in a formulation selected from the group comprising creams, multiple emulsions, anhydrous compositions, aqueous dispersions, oils, milks, balsams, foams, lotions, gels, cream gels, hydro-alcoholic solutions, hydro- glycolic solutions, cosmetic, personal care product, hydrogels, liniments, sera, soaps, dusting powder, paste, semi solid formulations, liniments, serums, shampoo, conditioner, ointments, any rinse off formulation, talc, mousses, powders, sprays, aerosols, solutions, suspensions, emulsions, syrups, elixirs, polysaccharide films, patches, gel patches, bandages, an adhesive system, water- in-oil emulsions, oil-in- water emulsions, and silicone emulsions.
- the emulsion contains a lipid or oil.
- the emulsion may be, but is not limited to, oil-in-water, water-in-oil, water-in- oil-in- water and oil-in-water- in-silcone emulsions.
- the emulsion may contain a humectant.
- the emulsion may contain an anti-foaming agent, such as silicone.
- the emulsion may have any suitable viscosity.
- Emulsions may further contain an emulsifier and/or an anti-foaming agent. Methods of preparing an emulsion are known to a person skilled in the art.
- the topical composition of the invention may be incorporated into a medical device for administration.
- a medical device can include but is not limited to a fabric, patch, bandage, gauge, sock, tight, underwear, dressing, glove, mask, adhesive patches, non-adhesive patches, occlusive patches and microelectric patches or suitable adhesive system.
- the device is in direct contact with the keratinous layer such as the skin, thus releasing the peptides of the invention.
- the topical composition may be incorporated in any suitable form as detailed herein.
- the topical composition or peptides of the invention can be incorporated into the device or be present on the surface of the device or can be in a cream, gel or wax formulation or any suitable formulation defined herein and incorporated into the device or on the surface of the device.
- the device may be adapted for adhesion or attachment to the skin.
- the device is adapted to release a constant quantity of the composition or the peptides of the invention. It will be understood that the amount of the composition contained in the sustained release system will depend, for example, on where the composition is to be administered, the kinetics and duration of the release of the composition of the invention, as well as the nature of the condition, disorder and/or disease to be treated and/or cared for.
- the device may be such that the composition is released by biodegradation of the device, or by friction between the device and the body, due to bodily moisture, the skin's pH or body temperature.
- the topical composition may further comprise at least one cosmetically or pharmaceutically acceptable excipient. Excipient may be used interchangeably with functional ingredient or additive. It will be understood that although the topical compositions of the current invention can be administered alone, they will generally be administered in admixture with a cosmetic or pharmaceutical excipient. Cosmetically or pharmaceutically acceptable excipient are well known in the art and any known excipient, may be used provided that it is suitable for topical administration and is dermatologically acceptable without undue toxicity, incompatibility and/or allergic reaction.
- any excipient included is present in trace amounts.
- the amount of excipient included will depend on numerous factors, including the type of excipient used, the nature of the excipient, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any excipient should not unacceptably alter the benefits of the peptides of this invention.
- the excipient may be a suitable diluent, carrier, binder, lubricant, suspending agent, coating agent, preservative, stabilisers, dyes, vehicle, solubilising agent, base, emollient, emulsifying agent, fragrance, humectant, and/or surfactants.
- suitable diluents include, but are not limited to, any diluent disclosed in disclosed in US2014120131 or US2004132667.
- suitable diluents include ethanol, glycerol and water.
- suitable carriers include, but are not limited to, lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and any suitable carrier disclosed in US2014120131 or US2004132667.
- binders include, but are not limited to, starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol and any suitable binder disclosed in US2014120131 or US2004132667.
- suitable lubricants include, but are not limited to, sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, and sodium chloride and any suitable lubricant disclosed in US2014120131 or US2004132667.
- the carrier may be any suitable carried known in the art or disclosed in US2014120131 or US2004132667.
- the carrier may include, but is not limited to, a liquid, such as water, oils or surfactants, including those of petroleum, animal, plant or synthetic origin, polymer, oil, such as peanut oil, mineral oil, castor oil, soybean oil, alcohol, polysorbates, sorbitan esters, ether sulfates, sulfates, betaines, glycosides, maltosides, fatty alcohols, nonoxynols, poloxamers, polyoxyethylenes, polyethylene glycols, dextrose, glycerol, or digitonin. It will be understood that the carrier will be dermatologically acceptable.
- Preferred carriers contain an emulsion such as oil-in-water, water-in-oil, water-in- oil-in- water and oil-in- water-in- silicone emulsions.
- Emulsions may further contain an emulsifier and/or an anti-foaming agent.
- the topical composition may further comprise one or more additional ingredients.
- the topical composition of the invention may be administered consecutively, simultaneously or sequentially with the one or more other additional agents.
- additional ingredients may be those of benefit to include in a topical composition, or of benefit depending on the intended use of the topical composition.
- the additional ingredient may be active or functional or both.
- additional ingredients include, but are not limited to, one or more of cleaning agents, conditioning agents, sunscreen, pigment, moisturiser, thickening agents, gelling agents, essential oil, astringents, pigments, anti-caking agent, anti-foaming agent, binders, additives, buffers, chelating agents, external analgesics, film formers or materials, bulking agents, polymers, opacifying agents, pH adjusters, propellants, reducing agents, sequestrants, skin bleaching and lightening agents, skin conditioning agents, aloe vera, healing agents, soothing agents, smoothing agents, pantothenic acid, treating agents, thickeners, vitamins, colourants, pharmaceuticals, antiseptic agents, antifoaming agents, buffering agents, astringents, polymers, pH adjuster, deodorant or any other dermatologically acceptable carrier or surfactant.
- the additional ingredient has glucose transport activity or aids glucose transport activity. In some embodiments, the additional ingredient has anti-inflammatory activity or aids anti-inflammatory activity. In some embodiments, the additional ingredient has anti-aging activity or aids anti-aging activity. In some embodiments, the additional ingredient is for keratinous layer health and/or development, skin health and/or development, and/or muscle health, recovery and/or development.
- the active agent may be a pharmacological enhancer. Such active agents are known and available on the market. In such cases, the topical composition of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.
- the additional ingredient may be farnesol ([2E, 6E], -3, 7, 11,- trimethyl-2, 6, 10, dodecatrien-l-ol), phytantriol (3, 7, 11, 15, tetramethylhexadecane-1, 2, 3, -triol), desquamation actives, enzymes, enzyme inhibitors, enzyme activators, botanical extracts and marine extracts, anti-acne actives, anti-wrinkle or anti atrophy actives, anti- oxidant/radical scavengers, chelators, flavonoids, anti-inflammatory agents, anti-cellulite agents, topical anaesthetics, tanning actives, skin lightening agents, skin healing agents, bisabolol, antimicrobial or antifungal active, sunscreen actives, particulate material, conditioning agents, structuring agents, thickening agent,
- the desquamation active may be any suitable agent that enhances the skin appearance or texture of the skin and is as disclosed in US2014120131 or US2004132667.
- anti-acne actives are as disclosed in US2014120131 or US2004132667 and include, resorcinol, salicylic acid, erythromycin, zine, sulfur, benzoyl peroxides.
- thickening agents are as disclosed in US2014120131 or US2004132667 and include carboxylic acid polymers, crosslinked polyacrylate polymers, polyacrylamide polymers, polysaccharides.
- conditioning agents are as disclosed in US2014120131 or US2004132667 and include humectants, moisturiser or skin conditioner.
- structuring agents are as disclosed in US2014120131 or US2004132667 and include any agent that provide rheological characteristics to the composition and contributes to the stability of the composition.
- Any suitable antimicrobial or antifungal active may be used and examples are as disclosed in US2014120131 or US2004132667. Such actives are capable of destroying microbes, preventing growth or action of microbes. Examples include but are not limited to ⁇ -lactam drugs, quinolone drugs, tetracycline, erythromycin, streptomycin sulfate, salicylic acid, benzoyl peroxide.
- Examples of a particulate material include metallic oxide.
- Examples of anti-cellulite agents include xanthine agents.
- Examples of tanning actives includes 1, 3-dihydroxy-2-propanone and those disclosed in US2014120131 or US2004132667.
- Examples of topical anaesthetics include benzocaine, lidocaine and bupivacaine and those disclosed in US2014120131 or US2004132667.
- Examples of skin lightening agents include any agent known in the art such as kojic acid, ascorbic acid and those disclosed in US2014120131 or US2004132667.
- sunscreen actives include any suitable organic or inorganic sunscreen active. Examples include metallic oxides, 2-ethylhexyl-p-methoxycinnamate and those disclosed in US2014120131 or US2004132667.
- Examples of skin healing agents includes panthenoic acid as disclosed in US2014120131 or US2004132667.
- anti-inflammatory agents include any agent that enhances the skin appearance, tone or colour and include but are not limited to corticosteroids, hydrocortisone, non-steroidal agents such as ibuprofen and aspirin and those disclosed in US2014120131 or US2004132667.
- flavonoids includes flavanones, methoxy flavonones, unsubstituted chalcone and mixtures thereof and those disclosed in US2014120131 or US2004132667.
- enzymes include lipases, proteases, catalase, super oxide-dismutase, amylase, peroxidase, glucuronidase, ceramidases, hyaluronidases.
- enzyme inhibitors include trypsine inhibitors, Bowmann Birk inhibitors, chymotrypsin inhibitors, botanical extracts, flavonoids, quercetin chalcone and those disclosed in US2014120131 or US2004132667 and mixtures thereof.
- enzyme activators include coenzyme A, Q10 (ubiquinone), glycyrrhizin, berberine, chrysin and those disclosed in US2014120131 or US2004132667 and mixtures thereof
- anti-wrinkle or anti atrophy actives include sulfur containing D and L amino acids, particular, N-acyl derivatives such as N-acetyl-L-cysteine, hydroxyl acids, phytic acid, lipoic acid, lysophosphatidic acid, skin peel agents, vitamin B 3 , retinoids and those disclosed in US2014120131 or US2004132667 and mixtures thereof.
- the anti-oxidant/radical scavenger agent may be any agent that is useful for providing protection against UV radiation or other environmental agents which may cause skin damage such as those disclosed in US2014120131 or US2004132667.
- anti- oxidant/radical scavengers examples include ascorbic acid, its salts and derivatives (vitamin C), tocopherol its salts and derivatives (vitamin E), butylated hydroxyl benzoic acids and their salts, peroxides, gallic acids and alkyl esters, sorbic acid, lipoic acid, amines, lycine pidolate, arginine pilolate, nordihydroguaiaretic acid, bioflavonoids, curcumin, lysine, methionine, proline, superoxide dismutase, silymarin, tea extracts and mixtures thereof.
- chelators examples include EDTA, NTA, hydoxamic acids, phytic acid, lactoferrin and those disclosed in US2014120131 or US2004132667 and mixtures thereof.
- a chelator means an agent capable of removing a metal ion by forming a complex so that the metal ion cannot participate in or catalyse chemical reactions.
- a chelator is useful for protection against UV radiation or other environmental agents that can cause skin damage. It will be appreciated that a plurality of additional ingredients may be added.
- the amount of the additional ingredient may be from about 0.001 to about 50% weight of the composition, preferably, about 0.01% to about 20%, preferably about 0.1% to about 10%, about 0.5% to about 10%, about 1% to about 5%, preferably 2% weight of the composition.
- the amount of additional ingredient included will depend on numerous factors, including the type of additional ingredient used, the nature of the additional ingredient, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any additional ingredient should not unacceptably alter the benefits of the peptides of this invention.
- the topical composition may be alcohol free.
- the composition further comprises one or more additional active agents, in addition to the peptide of the invention (also known as the active of the composition).
- the composition may be administered with one or more other additional active agents. Typical said additional active agent is present in trace amounts only. In some embodiments, there may be no additional active agent present in the composition.
- the amount of additional active agent included will depend on numerous factors, including the type of additional active agent used, the nature of the additional active agent, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any additional active agent should not unacceptably alter the benefits of the peptides of this invention.
- an ingredient that is considered to be an "active" ingredient in one product may be a "functional” or “excipient” ingredient in another and vice versa. It will also be appreciated that some ingredients play a dual role as both an active ingredient and as a functional or excipient ingredient.
- the additional active agents include glucose transport promoting drugs, skin supplement, agent for treatment and/or care of the skin, anti-inflammatory agent, an anti- aging agent, a cellular growth promoting agent and pharmacological enhancers. Such agents are well known in the art and it will be appreciated that any suitable additional active agent may be used.
- Additional active agents for treatment and/or care of the skin may include collagen synthesis agents, retinoids, exfoliating agents, anti-cellulite agents, elastase inhibiting agents, melanin synthesis stimulating or inhibiting agents, self-tanning agents, antiaging agents, antimicrobial agents, antifungal agents, fungistatic agents, bactericidal agents, and healing agents. Active agents also include anti-inflammatory agents. Any additional active agent should be suitable for application to the skin without undue toxicity, incompatibility and/or allergic reaction.
- the methods and uses of the invention involve administration of a peptide or composition of the invention in combination with one or more other active agents, for example, existing growth promoting drugs or pharmacological enhancers available on the market.
- the compounds of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.
- Topical delivery preferably means delivery to a keratinous layer such as the skin, hair and/or nails, but can also mean delivery to a body lumen lined with epithelial cells, for example the lungs or airways, the gastrointestinal tract, the buccal cavity. The effect may be confined to the surface of the skin or may be within the skin or a combination of both.
- the topical composition of the invention is administered in a cosmetically or pharmaceutically effective amount. In other words, in an amount that is non-toxic but sufficient amount to provide the desired effect. It will be appreciated that a person skilled in the art would be capable of determining an appropriate dose of the topical compositions of the invention to administer without undue experimentation. Alternatively, a physician will determine the actual dose that is most suitable for a patient depending on the particular condition, disease or disorder to be treated or cared for and the age, body weight and/or health of the person.
- the composition may be administered at a dose of from 0.01 to 50 mg/kg body weight, such as from 0.1 to 30 mg/kg, more preferably from 0.1 to 20 mg/kg body weight, more preferably from 0.1 to 10 mg/kg body weight, preferably 0.1 to 5mg/kg body weight.
- one or more doses of 10 to 300 mg/day or more preferably, 10 to 150 mg/day will be administered to the patient.
- the amount and the frequency is as best suited to the purpose.
- the frequency of application or administration can vary greatly, depending on the needs of each subject, with a recommendation of an application or administration range from once a month to ten times a day, preferably from once a week to four times a day, more preferably from three times a week to three times a day, even more preferably once or twice a day.
- the topical composition may be applied by, but not limited to, rubbing, or massaging into the keratinous tissue, skin or area of the body to be treated or cared for.
- the composition is left on or not removed from the area of the body.
- the composition is removed after a period of time, such as, but not limited to, from about 2 minutes to 60 minutes, from about 5 minutes to about 30 minutes, preferably from about 10 minutes to about 20 minutes.
- the composition may be removed immediately after application.
- the composition of the invention may be applied to an area to be treated by means to achieve a greater penetration of the composition and/or peptide of the invention, such as, but not limited to, iontophoresis, sonophoresis, electroporation, microelectric patches, mechanical pressure, osmotic pressure gradient, occlusive cure, microinjections or needle-free injections by means of pressure, such as injections by oxygen pressure, or any combination thereof.
- the peptides of the invention are used in the topical cosmetic or pharmaceutical composition of this invention at cosmetically or pharmaceutically effective concentrations to achieve the desired effect; in a preferred form with regards to the total weight of the composition, between 0.00000001% (in weight) and 20% (in weight); preferably between 0.000001% (in weight) and 15% (in weight), more preferably between 0.0001% (in weight) and 10% (in weight) and even more preferably between 0.0001% (in weight) and 5% (in weight).
- the composition may be delivered via any one of liposomes, mixed liposomes, oleosomes, niosomes, ethosomes, millicapsules, capsules, macrocapsules, nanocapsules, nano structured lipid carriers, sponges, cyclodextrins, vesicles, micelles, mixed micelles of surfactants, surfactant-phospholipid mixed micelles, millispheres, spheres, lipospheres, particles, nanospheres, nanoparticles,milliparticles, solid nanopartciles as well as microemulsions including water-in-oil microemulsions with an internal structure of reverse micelle and nanoemulsions microspheres, microparticles.
- Suitable methods include, for example, sonication, extrusion, high pressure/homogenization, microfluidization, detergent dialysis, calcium-induced fusion of small liposome vehicles and ether fusion methods, all of which are well known in the art.
- the delivery system may be a sustained release system wherein the compound or peptide of the invention is gradually released during a period of time and preferably with a constant release rate over a period of time.
- the delivery systems are prepared by methods known in the art. The amount of peptide contained in the sustained release system will depend on where the composition is to be delivered and the duration of the release as well as the type of the condition, disease and/or disorder to be treated or cared for.
- the topical composition of the invention may be for human or animal usage in human and veterinary medicine.
- the topical composition of the invention may be used for pharmaceutical, personal care and/or cosmetic uses.
- composition can be used to treat or care for any disease, disorder or condition of the skin, including but not limited to, psoriasis, dermatitis, allergic dermatitis, eczema, spongiosis, edema, skin cancer, ulcers, acne, scars, cellulitis, elastosis, keratosis, rosacea, varicose veins, inflammatory disorders.
- the topical composition may be used to for treating or caring for visible signs of aging including but not limited to wrinkles, stretch marks and dark circles, dryness, fine lines, age spots, red blotches, sagging skin, and conditions caused by sun exposure including sunburn, stress, pollution and/diet.
- the topical composition may also be used for delaying, slowing or inhibiting the skins or the onset of aging.
- the composition may be administered by a medical device, such as a plaster or a patch as described herein.
- the topical composition may be used to treat or care for a wound in a mammal.
- the topical composition is for use in the treatment or prevention of a disease or condition characterised by damaged epithelial cells or tissue, and/or damaged dermal or epithelial cells or tissue.
- the disease may be but is not limited to cancer and trauma.
- the topical composition may be used to treat or care for any muscle condition, to improve, muscle status in a mammal, to promote recovery of muscle, typically following exercise, to maintain or restore muscle health (for example lean tissue mass) in a mammal, to enhance physical performance, in treatment or prevention of a disease or condition characterised by lethargy or low energy levels.
- the topical composition may be used to promote growth of a tissue, promote growth of epithelial tissue, promote growth of skin, promote growth of an organ, promote growth of an organism.
- the skin can have a normal pathology and/or an abnormal pathology.
- the topical composition may also be used to treat or care for any inflammatory disorder.
- a further aspect of the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising a peptide of the invention or a composition of peptides of the invention, admixed with one or more pharmaceutically acceptable diluents, excipients or carriers.
- a pharmaceutical carrier excipient or diluent
- the pharmaceutical compositions may be for human or animal usage in human and veterinary medicine. Examples of such suitable excipients for the various different forms of pharmaceutical compositions described herein may be found in the "Handbook of Pharmaceutical Excipients, 2 nd Edition, (1994), Edited by A Wade and PJ Weller.
- compositions for topical delivery are described in Topical drug delivery formulations edited by David Osborne and Antonio Aman, Taylor & Francis, the complete contents of which are incorporated herein by reference.
- Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).
- suitable carriers include lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and the like.
- suitable diluents include ethanol, glycerol and water.
- the choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice.
- the pharmaceutical compositions may comprise as, or in addition to, the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s).
- suitable binders include starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol.
- Suitable lubricants include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like.
- Preservatives, stabilizers, dyes and even flavouring agents may be provided in the pharmaceutical composition.
- preservatives include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid.
- Antioxidants and suspending agents may be also used.
- the peptide or composition of the invention may be adapted for topical, oral, rectal, parenteral, intramuscular, intraperitoneal, intra-arterial, intrabronchial, subcutaneous, intradermal, intravenous, nasal, vaginal, buccal or sublingual routes of administration.
- parenteral intramuscular, intraperitoneal, intra-arterial, intrabronchial, subcutaneous, intradermal, intravenous, nasal, vaginal, buccal or sublingual routes of administration.
- these compositions contain from 1 to 250 mg and more preferably from 10-100 mg, of active ingredient per dose.
- Other forms of administration comprise solutions or emulsions which may be injected intravenously, intra-arterial, subcutaneously, intradermally, intraperitoneally or intramuscularly, and which are prepared from sterile or sterilisable solutions.
- compositions of the present invention may also be in form of suppositories, vaginal rings, pessaries, suspensions, emulsions, lotions, ointments, creams, gels, sprays, solutions or dusting powders.
- the composition of the invention may be formulated for topical delivery.
- Topical delivery generally means delivery to the skin, but can also mean delivery to a body lumen lined with epithelial cells, for example the lungs or airways, the gastrointestinal tract, the buccal cavity.
- formulations for topical delivery are described in Topical drug delivery formulations edited by David Osborne and Antonio Aman, Taylor & Francis, the complete contents of which are incorporated herein by reference.
- compositions or formulations for delivery to the airways are described in O'Riordan et al (Respir Care, 2002, Nov. 47), EP2050437, WO2005023290, US2010098660, and US20070053845.
- Composition and formulations for delivering active agents to the iluem, especially the proximal iluem include microparticles and microencapsulates where the active agent is encapsulated within a protecting matrix formed of polymer or dairy protein that is acid resistant but prone to dissolution in the more alkaline environment of the ileum. Examples of such delivery systems are described in EP1072600.2 and EP13171757.1.
- An alternative means of transdermal administration is by use of a skin patch.
- the active ingredient can be incorporated into a cream consisting of an aqueous emulsion of polyethylene glycols or liquid paraffin.
- the active ingredient can also be incorporated, at a concentration of between 1 and 10% by weight, into an ointment consisting of a white wax or white soft paraffin base together with such stabilisers and preservatives as may be required.
- Injectable forms may contain between 10-1000 mg, preferably between 10-250 mg, of active ingredient per dose.
- compositions may be formulated in unit dosage form, i.e., in the form of discrete portions containing a unit dose, or a multiple or sub-unit of a unit dose.
- a person of ordinary skill in the art can easily determine an appropriate dose of one of the instant compositions to administer to a subject without undue experimentation.
- a physician will determine the actual dosage which will be most suitable for an individual patient and it will depend on a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy.
- the dosages disclosed herein are exemplary of the average case. There can of course be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
- the agent may be administered at a dose of from 0.01 to 30 mg/kg body weight, such as from 0.1 to 10 mg/kg, more preferably from 0.1 to 1 mg/kg body weight.
- one or more doses of 10 to 300 mg/day or more preferably, 10 to 150 mg/day will be administered to the patient for the treatment of an inflammatory disorder.
- the methods and uses of the invention involve administration of a peptide or composition of the invention in combination with one or more other active agents, for example, existing anti-inflammatory drugs or pharmacological enhancers available on the market.
- the compounds of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.
- the peptide of the invention may be administered in the form of a conjugate comprising the peptide, and may optionally include a linker, and a partner molecule, for example a protein such as an antibody molecule intended to increase the half-life of the conjugate in-vivo.
- the peptide may be modified to substitute one or more amino acids with amino acids employed to attach partner molecules.
- an amino acid may be substituted with a lysine residue for the purpose of conjugating a partner molecule such as a PEG molecule.
- the term “comprise,” or variations thereof such as “comprises” or “comprising,” are to be read to indicate the inclusion of any recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) but not the exclusion of any other integer or group of integers.
- the term “comprising” is inclusive or open-ended and does not exclude additional, unrecited integers or method/process steps.
- the term "disease” is used to define any abnormal condition that impairs physiological function and is associated with specific symptoms.
- the term is used broadly to encompass any disorder, illness, abnormality, pathology, sickness, condition or syndrome in which physiological function is impaired irrespective of the nature of the aetiology (or indeed whether the aetiological basis for the disease is established). It therefore encompasses conditions arising from infection, trauma, injury, surgery, radiological ablation, poisoning or nutritional deficiencies.
- treatment refers to an intervention (e.g. the administration of an agent to a subject) which cures, ameliorates or lessens the symptoms of a disease or removes (or lessens the impact of) its cause(s) (for example, the reduction in accumulation of pathological levels of lysosomal enzymes).
- intervention e.g. the administration of an agent to a subject
- cures ameliorates or lessens the symptoms of a disease or removes (or lessens the impact of) its cause(s) (for example, the reduction in accumulation of pathological levels of lysosomal enzymes).
- cause(s) for example, the reduction in accumulation of pathological levels of lysosomal enzymes
- treatment refers to an intervention (e.g. the administration of an agent to a subject) which prevents or delays the onset or progression of a disease or reduces (or eradicates) its incidence within a treated population.
- intervention e.g. the administration of an agent to a subject
- treatment is used synonymously with the term “prophylaxis”.
- an effective amount or a therapeutically effective amount of an agent defines an amount that can be administered to a subject without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio, but one that is sufficient to provide the desired effect, e.g. the treatment or prophylaxis manifested by a permanent or temporary improvement in the subject's condition.
- the amount will vary from subject to subject, depending on the age and general condition of the individual, mode of administration and other factors. Thus, while it is not possible to specify an exact effective amount, those skilled in the art will be able to determine an appropriate "effective" amount in any individual case using routine experimentation and background general knowledge.
- a therapeutic result in this context includes eradication or lessening of symptoms, reduced pain or discomfort, prolonged survival, improved mobility and other markers of clinical improvement. A therapeutic result need not be a complete cure.
- peptide refers to a polymer composed of up to 50 amino acid monomers typically via peptide bond linkage.
- the peptide may be 3-50 amino acids in length.
- the peptide may be 4 to 50 amino acids in length.
- the peptide may be 5-50 amino acids in length.
- the peptide may be 7 to 50 amino acids in length.
- Peptides (including fragments and variants thereof) of and for use in the invention may be generated wholly or partly by chemical synthesis or by expression from nucleic acid.
- the peptides of and for use in the present invention can be readily prepared according to well-established, standard liquid or, preferably, solid-phase peptide synthesis methods known in the art (see, for example, J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd edition, Pierce Chemical Company, Rockford, Illinois (1984), in M. Bodanzsky and A. Bodanzsky, The Practice of Peptide Synthesis, Springer Verlag, New York (1984).
- any of the peptides employed in the invention can be chemically modified to increase their stability.
- a chemically modified peptide or a peptide analog includes any functional chemical equivalent of the peptide characterized by its increased stability and/or efficacy in vivo or in vitro in respect of the practice of the invention.
- the term peptide analog also refers to any amino acid derivative of a peptide as described herein.
- a peptide analog can be produced by procedures that include, but are not limited to, modifications to side chains, incorporation of unnatural amino acids and/or their derivatives during peptide synthesis and the use of cross-linkers and other methods that impose conformational constraint on the peptides or their analogs.
- side chain modifications include modification of amino groups, such as by reductive alkylation by reaction with an aldehyde followed by reduction with NaBH 4 ; amidation with methylacetimidate; acetylation with acetic anhydride; carbamylation of amino groups with cyanate; trinitrobenzylation of amino groups with 2, 4, 6, trinitrobenzene sulfonic acid (TNBS); alkylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; and pyridoxylation of lysine with pyridoxa-5'-phosphate followed by reduction with NABH 4 .
- modification of amino groups such as by reductive alkylation by reaction with an aldehyde followed by reduction with NaBH 4 ; amidation with methylacetimidate; acetylation with acetic anhydride; carbamylation of amino groups with cyanate; trinitrobenzylation of amino groups with 2, 4, 6, trinitrobenzene sulfonic acid (TNBS); alkylation
- the guanidino group of arginine residues may be modified by the formation of heterocyclic condensation products with reagents such as 2,3- butanedione, phenylglyoxal and glyoxal.
- the carboxyl group may be modified by carbodiimide activation via o-acylisourea formation followed by subsequent derivatization, for example, to a corresponding amide.
- Sulfhydryl groups may be modified by methods, such as carboxymethylation with iodoacetic acid or iodoacetamide; performic acid oxidation to cysteic acid; formation of mixed disulphides with other thiol compounds; reaction with maleimide; maleic anhydride or other substituted maleimide; formation of mercurial derivatives using 4-chloromercuribenzoate, 4-chloromercuriphenylsulfonic acid, phenylmercury chloride, 2-chloromercuric-4-nitrophenol and other mercurials; carbamylation with cyanate at alkaline pH.
- Tryptophan residues may be modified by, for example, oxidation with N-bromosuccinimide or alkylation of the indole ring with 2-hydroxy-5- nitrobenzyl bromide or sulphonyl halides. Tryosine residues may be altered by nitration with tetranitromethane to form a 3-nitrotyrosine derivative. Modification of the imidazole ring of a histidine residue may be accomplished by alkylation with iodoacetic acid derivatives or N- carbethoxylation with diethylpyrocarbonate.
- Examples of incorporating unnatural amino acids and derivatives during peptide synthesis include, but are not limited to, use of norleucine, 4-amino butyric acid, 4-amino-3-hydroxy-5-phenylpentanoic acid, 6- aminohexanoic acid, t-butylglycine, norvaline, phenylglycine, ornithine, sarcosine, 4-amino- 3-hydroxy-6-methylheptanoic acid, 2-thienyl alanine and/or D-isomers of amino acids.
- Peptide structure modification includes the generation of retro-inverso peptides comprising the reversed sequence encoded by D-amino acids.
- Modified peptide In an embodiment of the invention the peptide is a modified peptide.
- the term modified peptide is used interchangeably with the term derivative of the peptide.
- the modified peptide includes a peptide which has been substituted with one or more groups as defined herein.
- the modification may be any modified that provides the peptides and or the composition of the invention with an increased ability to penetrate a cell.
- the modification may be any modification that increases the half-life of the composition or peptides of the invention.
- the group is a protecting group.
- the protecting group may be an N-terminal protecting group, a C-terminal protecting group or a side-chain protecting group.
- the peptide may have one or more of these protecting groups.
- These groups can be added by preparation methods known in the art, for example the methods as outlined in paragraphs [0104] to [0107] of US2014120141.
- the groups may remain on the peptide or may be removed.
- the protecting group may be added during synthesis.
- the peptides may be substituted with a group selected from one or more straight chain or branched chain, long or short chain, saturated, or unsaturated, substituted with a hydroxyl, amino, amino acyl, sulfate or sulphide group or unsubstituted having from 1 to 29 carbon atoms.
- N-acyl derivatives include acyl groups derived from acetic acid, capric acid, lauric acid, myristic acid, octanoic acid, palmitic acid, stearic acid, behenic acid, linoleic acid, linolenic acid, lipoic acid, oleic acid, isosteric acid, elaidoic acid, 2- ethylhexaneic acid, coconut oil fatty acid, tallow fatty acid, hardened tallow fatty acid, palm kernel fatty acid, lanolin fatty acid or similar acids. These may be substituted or unsubstituted.
- the peptide is Ri-X- R 2 .
- Ri and/or R 2 groups respectively bound to the amino-terminal (N-terminal) and carboxyl-terminal (C-terminal) of the peptide sequence.
- the peptide is Ri-X.
- the peptide is X- R 2 .
- Ri is H, Ci-4 alkyl, acetyl, benzoyl or trifluoroacetyl;.
- X is the peptide of the invention; R 2 is OH or NH 2 .
- R 1 is selected from the group formed by H, a non-cyclic substituted or unsubstituted aliphatic group, substituted or unsubstituted alicyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted heteroarylalkyl, substituted or unsubstituted aryl, substituted or unsubstituted aralkyl, Tert-butyloxycarbonyl, 9- fluorenylmethyloxycarbonyl (Fmoc) and R5-CO-, wherein R5 is selected from the group formed by H, a non-cyclic substituted or unsubstituted aliphatic group, substituted or unsubstituted alicyclyl, substituted or unsubstituted aryl, substituted or unsubstituted aralkyl, substituted or unsubstituted heterocyclyl and substituted or unsubstituted heteroarylalkyl; R 2 is selected from the
- R 2 is -NR3R4, -OR 3 or -SR 3 wherein R3 and R 4 are independently selected from the group formed by H, substituted or unsubstituted C i-C 24 alkyl, substituted or unsubstituted C 2 -C 24 alkenyl, Tert- butyloxycarbonyl, 9-fluorenylmethyloxycarbonyl (Fmoc), substituted or unsubstituted C 2 -C 24 alkynyl, substituted or unsubstituted C3-C 24 cycloalkyl, substituted or unsubstituted C 5-C 24 cycloalkenyl, substituted or unsubstituted Cs-C 24 cycloalkynyl, substituted or unsubstituted C 6-C 30 aryl, substituted or unsubstituted C7-C 24 aralkyl, substituted or unsubstituted heterocyclyl ring of 3-10 members, and
- R 3 and R 4 can be bound by a saturated or unsaturated carbon-carbon bond, forming a cycle with the nitrogen atom.
- R 2 is -NR3R 4 or -OR 3, wherein R3 and R 4 are independently selected from the group formed by H, substituted or unsubstituted Ci-C 2 4 alkyl, substituted or unsubstituted C2-C2 4 alkenyl, substituted or unsubstituted C2-C2 4 alkynyl, substituted or unsubstituted C3-C10 cycloalkyl, substituted or unsubstituted C6-C 15 aryl and substituted or unsubstituted heterocyclyl of 3- 10 members, substituted or unsubstituted heteroarylalkyl with a ring of 3 to 10 members and an alkyl chain of 1 to 6 carbon atoms.
- R3 and R 4 are selected from the group formed by H, methyl, ethyl, hexyl, dodecyl, or hexadecyl. Even more preferably R3 is H and R 4 is selected from the group formed by H, methyl, ethyl, hexyl, dodecyl, or hexadecyl. In accordance with an even more preferred embodiment, R2 is selected from -OH and -NH2.
- R 1 is selected from the group formed by H, acetyl, lauroyl, myristoyl or palmitoyl
- R2 is -NR3R 4 or -OR3 wherein R3 and R 4 are independently selected from H, methyl, ethyl, hexyl, dodecyl and hexadecyl, preferably R2 is -OH or -NH2. More preferably, Ri is acetyl or palmitoyl and R2 is -NH2.
- the acyl group is bound to the N-terminal end of at least one amino acid of the peptide.
- the peptide is modified to comprise a side chain protecting group.
- the side chain protecting group may be one or more of the group comprising benzyl or benzyl based groups, t-butyl-based groups, benzyloxy-carbonyl (Z) group, and allyloxycarbonyl (alloc) protecting group.
- the side chain protecting group may be derived from an achiral amino acid such as achiral glycine. The use of an achiral amino acid helps to stabilise the resultant peptide and also facilitate the facile synthesis route of the present invention.
- the peptide further comprises a modified C-terminus, preferably an amidated C-terminus.
- the achiral residue may be alpha-aminoisobutyric acid (methylalaine). It will be appreciated that the specific side chain protecting groups used will depend on the sequence of the peptide and the type of N-terminal protecting group used.
- Conjugate In one embodiment of the invention the peptide is conjugated, linked or fused to a binding partner, for example one or more polyethylene glycol polymers or other compounds, such as molecular weight increasing compounds or lipophilic groups.
- the molecular weight increasing compound is any compound that will increase the molecular weight, typically by 10% to 90%, or 20% to 50% of the resulting conjugate and may have a molecular weight of between 200 and 20, 000, preferably between 500 and 10, 000.
- the molecular weight increasing compound may be PEG, any water-soluble (amphiphilic or hydrophilic) polymer moiety, homo or co-polymers of PEG, a monomethyl-subsitututed polymer of PEG (mPEG) and polyoxyethylene glycerol (POG), polyamino acids such as poly-lysine, poly-glutamic acid, poly-aspartic acid, particular those of L conformation, pharmacologically inactive proteins such as albumin, gelatin, a fatty acid, olysaccharide, a lipid amino acid and dextran.
- PEG any water-soluble (amphiphilic or hydrophilic) polymer moiety
- mPEG monomethyl-subsitututed polymer of PEG
- POG polyoxyethylene glycerol
- polyamino acids such as poly-lysine, poly-glutamic acid, poly-aspartic acid, particular those of L conformation
- pharmacologically inactive proteins
- the polymer moiety may be straight chained or branched and it may have a molecular weight of 500 to 40000Da, 5000 to 10000 Da, 10000 to 5000, Da.
- the compound (binding partner) may be any suitable cell penetrating compound, such as tat peptide, penetratin, pep-1.
- the compound (binding partner) may be an antibody molecule.
- the compound (binding partner) may be a lipophilic moiety or a polymeric moiety. The lipophilic substituent and polymeric substituents are known in the art.
- the lipophilic substituent includes an acyl group, a sulphonyl group, an N atom, an O atom or an S atom which forms part of the ester, sulphonyl ester, thioester, amide or sulphonamide.
- the lipophilic moiety may include a hydrocarbon chain having 4 to 30 C atoms, preferably between 8 and 12 C atoms. It may be linear or branched, saturated or unsaturated. The hydrocarbon chain may be further substituted. It may be cycloalkane or heterocycloalkane.
- the peptide may be modified at the N-terminal, C-terminal or both.
- the polymer or compound (binding partner) is preferably linked to an amino, carboxyl or thio group and may be linked by N-termini or C-termini of side chains of any amino acid residue.
- the polymer or compound (binding partner) may be conjugated to the side chain of any suitable residue.
- the polymer or compound (binding partner) may be conjugated via a spacer.
- the spacer may be a natural or unnatural amino acid, succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl, gamma-amino butanoyl.
- the polymer or compound (binding partner) may be conjugated via an ester, a sulphonyl ester, a thioester, an amide, a carbamate, a urea, a sulphonamide.
- a person skilled in the art is aware of suitable means to prepare the described conjugate.
- “Fragment” means a segment of a protein, typically selected from SEQUENCE ID NO's: 1 to 16 and 353-355, and particularly from a region of those proteins selected SEQUENCE ID NO'S: 17 to 70.
- the fragment is typically 3 to 37 contiguous amino acids in length. In one embodiment, the fragment is typically 5 to 37 contiguous amino acids in length.
- the fragment is typically 5 to 37 contiguous amino acids in length.
- the fragment generally having a charge of between -9 and +3; typically a c-terminal amino acid that typcially is not cysteine (C) or methionine (M); and typically an n-terminal amino acid that typcially is not cysteine (C), histidine (H), proline (P) or threonine (T).
- the charge of a peptide, fragment or region is determined using the method of Cameselle, J.C., Ribeiro, J.M., and Sillero, A. (1986). Derivation and use of a formula to calculate the net charge of acid-base compounds. Its application to amino acids, proteins and nucleotides.
- a peptide that includes (a) a fragment of a plant protein, typically rice or pea protein, or variants of pea protein including lentil, sweet pea, or chick pea or variants of rice protein including oat, grass, corn, wild rice and bananas, or (b) a variant of the fragment of a plant protein, for example a fragment of a homolog of the plant protein.
- the peptides or fragments of the invention may be isolated from plant proteins or made synthetically.
- C-terminal domain as applied to a fragment means the first three amino acids at the c- terminus of the fragment.
- N-terminal domain as applied to a fragment means the last three amino acids at the n- terminus of the fragment.
- Bioactive as applied to a peptide or fragment means having a health promoting effect when administered a mammal, for example one or more of glucose transport promoting, anti- bacterial, anti-inflammatory, or cellular growth or proliferation promoting.
- bioactive means anit-inflammatory.
- Glucose transport promoting or “glucose transport promoting activity” as applied to peptide or variant or fragment means a peptide, variant or fragment that is capable increasing GLUT4 translocation into skeletal muscle compared with an untreated control when employed at a concentration of 2 ⁇ in the following in-vitro assay.
- L6-GLUT4myc cells were grown in 10% FBS and 2 ⁇ g/ml blasticidin. Cells were grown for 48-72 hours before being seeded in 24-well plates at 15,000 cells per well in 2% FBS and allowed to differentiate for 6 to 8 days prior to experimentation.
- L6-GLUT4myc cells were serum- starved for three hours prior to incubation with 100 nM of insulin for 30mins, or 200, 20, 2.0 and 0.2 ⁇ of SP, and 2, 1, 0.5 and .25mg/ml of peptide composition for 3 hours respectively.
- a 3 hour incubation period was selected based on previous findings identifying that incubation with branch chain amino acid containing di-peptides for 3 hours increases glucose uptake in L6 myotubes 1.
- Treatments were staggered in order to determine GLUT4myc translocation at the same time point.
- the quantity of myc-tagged GLUT4 at the cell surface was measured by antibody-coupled colorimetric assay.
- L6-GLUT4myc cells were fixed via incubation with 3% paraformaldehyde (PFA). A 0.1 M glycine solution was then added to quench PFA and cells were blocked with 5% goat serum. The myotube monolayer was exposed to anti-myc antibody and then incubated with peroxidase conjugated donkey anti-mouse IgG. lmL of o-phenylenediamine dihydrochloride (OPD) reagent was added to each well and this reaction was stopped by adding 250 ⁇ 1 ⁇ 11 of 3 M HCL.
- PFA paraformaldehyde
- a measured aliquot of each condition was determined spectrophotometrically on a plate reader using absorbance at 492nm.
- the peptide or fragment is capable of increasing GLUT4 translocation compared with an untreated control by at least 50% (i.e a relative unit increase in GLUT4 translocation of 1% to 1.5%).
- Anti-inflammatory as applied to a peptide or fragment means a peptide or fragment that is capable of significantly reducing the secretion of TNFa by LPS -stimulated J774.2 macrophages (compared with untreated LPS-stimulated J774.2 macrophages) when the macrophages are treated with ⁇ of the peptide or fragment.
- J774.2 macrophages were treated with ⁇ of synthetic peptide for 24 hours and then stimulated with (A) LPS (lOng/ml) for five hours or (B) LPS (lOng/ml) for 5 hours followed by ATP (5mM) for one hour. Supernatant was collected and levels of TNFa were determined by ELISA.
- Cellular growth promoting or “cellular growth or proliferation promoting” as applied to a peptide or fragment means a peptide or fragment that is capable of increasing elastin production or cellular proliferation of human skin treated with a 20 ⁇ solution of peptide or fragment in the following assay.
- Skin explants were prepared from abdominal plastic surgery. Some explants were delipidated with alcohol to obtain a dehydrated skin. These explants were maintained in maintenance medium supplied by the provider Biopredic International for 5 days. Test items are applied twice per day with 5 ⁇ per explant. At the end of the test, viabilities controls are realized with the MTT on two explants, the third explant is fixed in the formaldehyde 4% for histology and cell staining.
- each skin explant in the maintenance medium is delipidated with 5 ⁇ alcohol during 3 hours. After 3 hours, all skin explants are treated two per day with test items, and they are incubated at 37°C +/- 2°C, 5% C02 for 1 day or 5 days. Integrity of the system is realized at day 1 and day 5 with a viability control with MTT. Histology is realized by the laboratory Gredeco and the immuno staining to elastin and Ki67 are realized by the same laboratory. Immunostaining to filaggrin is realized by the laboratory Intertek.
- elastin (rabbit monoclonal antibody, clone PI 5502, LSBio) is performed using an immunoperoxidase technique two layers (ABC kit, Vector Laboratories) and revealed by AEC (3-amino-9 -ethylcarbazole).
- the immunohistochemical staining intensity in the elastic fibers is evaluated using a semiquantitative histological score.
- Epithelial proliferation was analyzed by immunohistochemistry using anti-Ki67 antibody.
- Immunodetection was performed using an indirect immunoperoxidase technique three layers, amplified (DAKO kit) and revealed by AEC (3-Amino-9-ethylcarbazole).
- Counting the number of labeled cells is performed and provides the total number of basal cells to calculate the % of labeled cells.
- the specific staining of filaggrin is performed with an immunoperoxidase staining (ABC kit, Fisher).
- the intensity of immunohistochemical marker in the epidermis is evaluated relative to the negative control of the solvent (Water or DMSO 0.3%).
- Enriched in peptides having a molecular weight of less than 10 KD as applied to a composition of the invention means that the dry weight % of peptides in the composition having a molecular weight of less than 10 KD is greater than the dry weight % of polypeptide/protein in the composition having a molecular weight of 10 KD or greater.
- "Homolog" of a reference protein should be understood to mean a protein from a different species of plant having at least 60% sequence homology with the reference protein.
- homologs of pea protein P13918 include:
- a "variant" of an anti-inflammatory fragment shall be taken to mean a fragment having an amino acid sequence that is substantially identical to the anti-inflammatory fragment, and which has anti-inflammatory activity as defined above. Thus, for example, the term should be taken to include fragments that are altered in respect of one or more amino acid residues.
- Such alterations involve the insertion, addition, deletion and/or substitution of 5 or fewer amino acids, more preferably of 4 or fewer, even more preferably of 3 or fewer, most preferably of 1 or 2 amino acids only. Insertion, addition and substitution with natural and modified amino acids is envisaged.
- the variant may have conservative amino acid changes, wherein the amino acid being introduced is similar structurally, chemically, or functionally to that being substituted.
- the variant will have at least 70% amino acid sequence homology, preferably at least 80% sequence homology, more preferably at least 90% sequence homology, and ideally at least 95%, 96%, 97%, 98% or 99% sequence homology with the parent anti-inflammatory fragment.
- sequence identity should be understand to comprise both sequence identity and similarity, i.e. a variant (or homolog) that shares 70% sequence identity with a reference sequence is one in which any 70% of aligned residues of the variant (or homolog) are identical to or conservative substitutions of the corresponding residues in the reference sequence across the entire length of the sequence.
- Sequence identity is the amount of characters which match exactly between two different sequences. Hereby, gaps are not counted and the measurement is relational to the shorter of the two sequences.
- sequence homology the term should be understood to mean that a variant (or homolog) which shares a defined percent similarity or identity with a reference sequence when the percentage of aligned residues of the variant (or homolog) are either identical to, or conservative substitutions of, the corresponding residues in the reference sequence and where the variant (or homolog) shares the same function as the reference sequence.
- This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example, one alignment program is BLAST, using default parameters. Details of these programs can be found at the following Internet address: http://www.ncbi.nlm.nih.gov/blast/Blast.cgi.
- Variants of SEQUENCE ID NO: 109 including variants having 1,2 or 3 conservative amino acid substitutions, 1, 2 to 3 non-conservative amino acid substitutions, 1-2 amino acid additions, 1, 2 or 3 amino acid deletions, are provided below:
- RGPQQYAEWQINER RGPQQYAEWQINDK, RGPQQFAEWQINEK, KGPQQYAEWQINEK, RGPEQYAEWQINEK, RGPQEYAEWQINEK,
- RGPQQYADWQINEK RGPQQYAEYQINEK (SEQ ID NO'S 268 to 275)
- RGPQQYADWQINDK RGPQQFAEWQINER (SEQ ID NO'S 276 to 283)
- RGGQQYAEWQINED RGPQQYARWKINEK, RGGQQYAETQINEK, RGPLQYAEWQNNEK, EGPQQYAEWQINED, RGPQQYAEWQINLL, RGPQQGGEWQINEK (SEQ ID NO'S 299 to 305)
- RGPQSQYAEWQINEKPM RGPQQYAEWQINEKKK
- RRRRGPQQYAEWQINEK SEQ ID NO'S 314 to 319.
- fragments of the peptides of the invention typically encompasses fragments of the peptides of the invention.
- “Fragment of a peptide of the invention” or “peptide fragment” means a fragment of one of the peptides of the invention having at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 or 22 amino acids and that typically has a bioactivity, for example antiinflammatory activity, cellular growth or proliferation promotion activity, glucose transport promoting activity, or anti-bacterial activity.
- the fragment consists of at least 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the reference sequence. Examples of fragments of the invention are provided in SEQUENCE ID NO'S 320-330.
- Inflammatory disorder means an immune-mediated inflammatory condition that affects humans and is generally characterised by dysregulated expression of one or more cytokines. Examples of inflammatory disorders include skin inflammatory disorders, inflammatory disorders of the joints, inflammatory disorders of the cardiovascular system, certain autoimmune diseases, lung and airway inflammatory disorders, intestinal inflammatory disorders.
- Examples of skin inflammatory disorders include dermatitis, for example atopic dermatitis and contact dermatitis, acne vulgaris, and psoriasis.
- Examples of inflammatory disorders of the joints include rheumatoid arthritis.
- Examples of inflammatory disorders of the cardiovascular system are cardiovascular disease and atherosclerosis.
- Examples of autoimmune diseases include Type 1 diabetes, Graves disease, Guillain-Barre disease, Lupus, Psoriatic arthritis, and Ulcerative colitis.
- Examples of lung and airway inflammatory disorders include asthma, cystic fibrosis, COPD, emphysema, and acute respiratory distress syndrome.
- Examples of intestinal inflammatory disorders include colitis and inflammatory bowel disease.
- Other inflammatory disorders include cancer, hay fever, periodontitis, allergies, hypersensitivity, ischemia, depression, systemic diseases, post infection inflammation and bronchitis.
- Methodabolic disorder should be understood to include prediabetes, diabetes; Type-1 diabetes; Type-2 diabetes; metabolic syndrome; obesity; diabetic dyslipidemia; hyperlipidemia; hypertension; hypertriglyceridemia; hyperfattyacidemia; hypercholerterolemia; hyperinsulinemia, and MODY.
- Man-made as applied to comestible products should be understood to mean made by a human being and not existing in nature.
- "Maintaining or restoring gut health” means reducing and/or regulating the proinflammatory response in the gut and more specifically the epithelial cells.
- the healthy microbiome offers some protection against pathogenic viruses and bacteria, and their presence is needed to guide the development of our immune system. It has been shown that these bacteria can react to human signals of stress, sickness, or age which can be manifested by inflammation and as a consequence switch on their virulence genes and cause or contribute to disease. Having the ability to reduce and maintain at healthy levels the inflammatory response can help maintain the healthy bacteria.
- Digestive problems which comprise the number one health problem in North America, appear to be occurring with more frequency in recent years. One way to maintain digestive health is to maintain proper inflammation and intestinal flora.
- “Maintaining or restoring muscle health” means helping retain or restore mammalian muscle health resulting from damage incurred during exercise.
- the peptides promote recovery from injuries during exercise, and relieve muscle soreness/pain and injury connected with exercise. They can also be used to decrease and prevent muscle cramping, and to allow a faster recovery from muscle cramping. Cramping can result from physical stress, mental stress, and or Repetitive Strain Injury stress.
- the peptides help reduce Myopathy of the muscle, and help prevent Sarcopenia in mammals, promote recovery from injuries during exercise, and relieve muscle soreness/pain and injury connected with exercise. They can also be used to decrease and prevent muscle cramping, and to allow a faster recovery from muscle cramping.
- Cramping can result from physical stress, mental stress, and or Repetitive Strain Injury stress.
- By lowering inflammation the peptides help reduce Myopathy of the muscle, and help prevent Sarcopenia in mammals.
- composition should be understood to mean something made by the hand of man, and not excludes naturally occurring compositions.
- exemplary compositions include foods, beverages, nutritional supplements, personal care compositions, and pharmaceutical compositions.
- the term "substantially all” as applied to a list of peptides or fragments should be understood to mean at least 60%, 70%, 80%, 90% or 95% of the peptides or fragments.
- personal care composition should be understood to mean a composition formulated for use by humans in cleaning or treating the human body, particularly the skin, teeth, nails, feet and hair.
- Examples include shampoo, conditioner, skin creams and lotions, powders, dentrifice, shower gel or creams, body lotion, deodorant, and anti-perspirant.
- the term "nutritional supplement” should be understood to mean a product formulated for ingestion by a mammal and intended to confer a health benefit on the recipient.
- the supplement can take any form, for example a solid, liquid, or powder.
- Examples of supplements include powders, tablets, capsules, and drinks.
- Figures 1 to 18 The effect of eighteen synthetic peptides of the invention on TNF- secretion in THP1 cells. All experiments were prepared in dublicate on three plates (6 wells/conditions). Significance was calculated using Stsudents t-test (*p ⁇ 0.05 compared to control, **p ⁇ 0.01 compared to control, *** p ⁇ 0.001 compared to control)
- FIG 22 The effect of six peptides of the invention on TNFa and IL- ⁇ secretion from J774.2 macrophages.
- J774.2 macrophages were treated with ⁇ of synthetic peptide for 24 hours and then stimulated with (A) LPS (lOng/ml) for five hours or (B) LPS (lOng/ml) for 5 hours followed by ATP (5mM) for one hour.
- Supernatant was collected and levels of (A) TNFa and (B) IL- ⁇ were determined by ELISA.
- FIG. 23 The effect a peptide composition of the invention on TNFa and IL- ⁇ secretion.
- J774.2 macrophages were treated with 0.5mg/ml of peptide composition for 24 hours and then stimulated with (A) LPS (lOng/ml) for five hours or (B) LPS (lOng/ml) for 5 hours followed by ATP (5mM) for one hour.
- Supernatant was collected and levels of (A) TNFa and (B) IL- ⁇ were determined by ELISA.
- (***p ⁇ 0.001 w.r.t untreated+LPS, ###p ⁇ 0.001 w.r.t. untreated+LPS/ATP). Data are presented as an average of n 3 +/- SEM.
- FIG. 24 The effects of synthetic peptides with DMSO vehicle on TNFa J774.2 macrophages were treated with ⁇ of synthetic peptide for 24 hours and then LPS (lOng/ml) for five hours. Supernatant was collected and levels of TNFa were determined by ELISA. ###p ⁇ 0.001 w.r.t 0.3% DMSO+LPS, ##p ⁇ 0.01 w.r.t. 0.3% DMSO+LPS,+++p ⁇ 0.001 w.r.t 1% DMSO+LPS, ++p ⁇ 0.01 w.r.t 1% DMSO+LPS/ATP).
- Final concentration of DMSO in well positive control - 0% , SP1 - 0.3%, SP2 - 0%, SP3 - 0.3%, SP4 - 1%, SP5 - 1%, SP6 - 0.3%.
- FIG. 25 THP-1 differentiated macrophages treated with a composition of rice peptides of the invention (I_2_HR) for 24 hrs. prior to LPS stimulation were compared to untreated cells. TNF-a secretion in I_2_HR treated cells is reduced by 92% vs. untreated cells. Significant results are observed at lOOug/ml and 500ug/ml concentrations of I_2_HR, indicating the potency of I_2_HR.
- I_2_HR composition of rice peptides of the invention
- FIG. 26 to 28 The effect of three synthetic peptides of the invention on TNF- secretion in THP1 cells. All experiments were prepared in dublicate on three plates (6 wells/conditions). Significance was calculated using Stsudents t-test (*p ⁇ 0.05 compared to control, **p ⁇ 0.01 compared to control, *** p ⁇ 0.001 compared to control)
- TNF-a is secreted by macrophages in response to stimulation by endotoxins such as lipopolysaccharides (LPS). TNF-a is thought to be involved in systemic inflammation and dysregulation of TNF-a production is thought to be involved in many diseases.
- the Biolegend assay is a sandwich ELISA kit that is designed for the accurate quantitation of human TNF-a from cell culture supernatant, serum or plasma.
- THP-1 monocytes were seeded in a 96 well plate at 10,000 cells per well in RPMI containing 10% fetal calf serum (FCS), 1% Pen/strep, 1% L-glutamine, ⁇ PMA and allowed to differentiated for 72h prior to experimentation.
- FCS fetal calf serum
- Pen/strep 1% Pen/strep
- L-glutamine 1% L-glutamine
- the cells were incubated with 100 ng/ml, 10 ng/ml or 1 ng/ml synthetic peptide for 24h respectively.
- the cells were stimulated with 10 ng/ml LPS for 5h and the quantity of TNF-a in the supernatant determined using the Biolegend assay ELISA kit.
- Results were calculated as a percentage of the untreated control. An increase in optical density reading indicates greater quantity of TNF-a release into cell culture supernatant.
- Peptide composition I_1_HR contained the followings peptides (identified by SEQ ID): 116, 197, 207, 112, 211, 158, 201, 203, 114, 183, 130, 113, 182, 167, 166, 152, 220, 213, 215, 154, 219, 218, 165, 123, 185, 190, 209, 181, 198, 200, 147, 172, 184, 124, 153, 205, 115, 196, 151, 161, 160, 216, 210, 208, 146, 133, 204, 212, 206.
- Peptide composition I_2_HR contained the followings peptides (identified by SEQ ID): 189, 177, 174, 129, 176, 202, 193, 195, 194, 192, 182, 128, 220, 127, 134, 136, 135, 180, 179, 178, 219, 218, 145, 120, 175, 190, 149, 126, 187, 191, 121, 122, 159, 132, 162, 137, 150, 186, 188, 164, 118, 125, 163, 157, 156, 117.
- Peptide composition E_1_HR contained the followings peptides (identified by SEQ ID):74, 76, 106, 102, 101, 100, 92, 96, 83, 89, 90, 104, 82, 75, 79, 78, 77, 99, 103, 72, 86, 105, 94, 93, 81, 97, 80, 88, 85, 87, 71, 107, 73, 84, 98, 95.
- Peptide composition E_2_HR contained homologs of the peptides of the invention.
- a J774.2 mouse macrophage cell line was treated with ⁇ of each synthetic peptide (SP) and 0.5 mg/ml of each peptide composition and the effect on two pro-inflammatory markers - tumour necrosis factor a (TNF ) and interleukin- ⁇ (IL- ⁇ ) was determined after inflammation was induced using lipopolysaccharide (LPS) as an inflammatory stimulus.
- SP synthetic peptide
- IL- ⁇ interleukin- ⁇
- Synthetic peptides were first diluted in a suitable solvent.
- Dimethyl sulfoxide (DMSO) was the solvent of choice for peptides with poor predicted water solubility.
- Final concentration of DMSO in each well SP1 (1_155_HR) - 0.3%, SP2 (1_374_HR) - 0%, SP3 (E_155_HR) - 0.3%, SP4 (E_54_HR) - 1%, SP5 (E_41_HR) - 1%, SP6 (E_788_HR) - 0.3%, positive Control - 0%.
- Cells were first treated with ⁇ of each SP for 24 hours before an alamar blue assay was performed. No viability issues were seen with any of the peptides.
- the peptide compositions were prepared by adjusting the pH to between 6-7 and sterile filtering. The effects of the peptide compositions on cell viability was determined. J774.2 macrophages were treated with lmg/ml and 0.5mg/ml of each peptide composition, hydrogen peroxide to induce cell death as a positive control, and a peptide known to be non-toxic as a negative control. An alamar blue assay was then performed and cell survival is shown in Fig. 19 as a percentage of untreated (100%). As cell survival was compromised with lmg/ml of peptide, 0.5mg/ml of peptide composition was used for further assays.
- DMSO significantly increased levels of TNFa (Fig. 3A. ***p ⁇ 0.001 w.r.t LPS) and this was taken into account when analysing the effect of the peptides on TNFa. No significant effect was seen with regards DMSO and IL- ⁇ secretion.
- THP-1 differentiated macrophages were treated with a composition of rice peptides of the invention (I_2_HR) for 24 hrs. prior to LPS stimulation were compared to untreated cells. TNF-a secretion in I_2_HR treated cells is reduced by 92% vs. untreated cells. Significant results are observed at lOOug/ml and 500ug/ml concentrations of I_2_HR, indicating the potency of I_2_HR.
- the invention is not limited to the embodiments hereinbefore described which may be varied in construction and detail without departing from the spirit of the invention.
- PEA PROTEIN 1 P13918 - 1 - MAATTMKASFPLLMLMGISFLASVCVSSRSDPQNPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYRLLEYKSKPHTIFLPQHTDA DYILVVLSGKAILTVLKPDDRNSFNLERGDTIKLPAGTIAYLVNRDDNEELRVLDLAIPVNRPGQLQSFLLSGNQNQQNYLSGFSKNILEASFN TDYEEIEKVLLEEHEKETQHRRSLKDKRQQSQEENVIVKLSRGQIEELSKNAKSTSKKSVSSESEPFNLRSRGPIYSNEFGKFFEITPEKNPQLQ DLDIFVNSVEIKEGSLLLPHYNSRAIVIVTVNEGKGDFELVGQRNENQQEQRKEDDEEEEQGEEEINKQVQNYKAKLSSGDVFVIPAGHPVA VKASSNLDLLGFGINAENNQRNFLAGDEDNVISQIQ
- PEPTIDE SRGPIYSNEFGK [SEQ ID 71]
- PEPTIDE NSFNLER [SEQ ID 72]
- PEPTIDE VLDLAIPVNR [SEQ ID 73]
- PEPTIDE DDNEELR [SEQ ID 74]
- PEPTIDE LSSGDVFVIPAGHPVAVK [SEQ ID 75]
- PEPTIDE EDDEEEEQGEEEINK [SEQ ID 76]
- PEPTIDE NILEASFNTDYEEIEKVLLEEHEKETQHR [SEQ ID 77]
- PEPTIDE NILEASFNTDYEEIEKVLLEEHEK [SEQ ID 78]
- PEPTIDE NILEASFNTDYEEIEK [SEQ ID 79]
- PEPTIDE RQQSQEENVIVK [SEQ ID 80]
- PEPTIDE QQSQEENVIVK [SEQ ID 81]
- PEPTIDE LSRGQIEELSK [SEQ ID 82]
- PEPTIDE GQIEELSK [SEQ ID 83]
- PEPTIDE VLLEEHEK [SEQ ID 84]
- PEPTIDE SKPHTIFLPQHTDADYILVVLSGK [SEQ ID 85]
- PEPTIDE PHTIFLPQHTDADYILVVLSGK [SEQ ID 86]
- PEPTIDE SNKFQTLFENENGHIR [SEQ ID 87]
- PEPTIDE SKIFENLQNYR [SEQ ID 88]
- PEPTIDE IFENLQNYR [SEQ ID 89]
- PEPTIDE I LE NQKQSH FADAQPQQR [SEQ ID 90]
- PEA PROTEIN 2 P02856 - 2 -
- PEPTIDE FFELTPEKNQQLQDLDLFVNSVDLK [SEQ ID 92]
- PEPTIDE QLEELSK [SEQ ID 93]
- PEA PROTEIN 3 P15838 - 3 -
- PEPTIDE QEEDEDEDEER [SEQ ID 94]
- PEPTIDE YQHQQGGKQEQENEGNNIFSGFK [SEQ ID 95]
- PEA PROTEIN 4 Q9M3X6 - 4 -
- PEPTIDE GDTIKLPAGTTSYLVNQDDEEDLR [SEQ ID 96]
- PEPTIDE RQQGEETDAIVK [SEQ ID 97]
- PEPTIDE VLLEEQEKDRK [SEQ ID 98]
- PEPTIDE NILEASYNTR [SEQ ID 99]
- PEPTIDE FEAFDLAK [SEQ ID 100]
- PEPTIDE EQIEELKK [SEQ ID 101]
- PEPTIDE EQIEELK [SEQ ID 102]
- PEPTIDE NKNQYLR [SEQ ID 103]
- PEPTIDE LSPGDVVIIPAGHPVAITASSNLNLLGFGINAENNER [SEQ ID 104]
- PEPTIDE PSYEKQEDEEEKQK [SEQ ID 105]
- PEPTIDE EEDEEEGQR [SEQ ID 106]
- PEA PROTEIN 5 D3VNE1 - 5 -
- PEPTIDE TLFLPQYTDADFILVVLSGK [SEQ ID 107]
- PEPTIDE GYVGLTFPGCPATHQQQFQLFEQR [SEQ ID 108]
- PEPTIDE RGPQQYAEWQINEK [SEQ ID 109]
- PEA PROTEIN 6 P13919
- PEPTIDE LVDLVIPVNGPGKFEAFDLAK [SEQ ID 110]
- PEPTIDE KNPQLQDLDIFVNYVEIK [SEQ ID 111]
- PEPTIDE DEHQKIHQFR [SEQ ID 112]
- PEPTIDE FRDEHQK [SEQ ID 113]
- PEPTIDE FPILNLIQMSATR [SEQ ID 114]
- PEPTIDE TNANAFVSHLAGK [SEQ ID 115]
- PEPTIDE ALPVDVVANAYR [SEQ ID 116]
- PEPTIDE YVYDVNNNANQLEPRQKEFL [SEQ ID 117]
- PEPTIDE VYVYDVNNNANQLEPRQKEFL [SEQ ID 118]
- PEPTIDE ADSYNPR [SEQ ID 119]
- PEPTIDE KPTLTQQQEQAQAQDQ [SEQ ID 120]
- PEPTIDE QAQAQDQYQQVQY [SEQ ID 121]
- PEPTIDE QAQDQYQQVQY [SEQ ID 122]
- PEPTIDE LQAFEPLR [SEQ ID 123]
- PEPTIDE SRVQVVSNFGK [SEQ ID 124]
- PEPTIDE WNVNAHSLVY [SEQ ID 125]
- PEPTIDE NVNAHSLVY [SEQ ID 126]
- PEPTIDE IQGRSRVQVVSNFGK [SEQ ID 127]
- PEPTIDE GKTVFDGVLRPGQL [SEQ ID 128]
- PEPTIDE FGKTVFDGVLRPGQL [SEQ ID 129]
- PEPTIDE FQQQYYPGLSNESESETSE [SEQ ID 130]
- PEPTIDE QQYYPGLSN [SEQ ID 131]
- PEPTIDE QQQYYPGLSN [SEQ ID 132]
- PEPTIDE VTN LNTQN FPI LSLVQMSAVK [SEQ ID 133]
- PEPTIDE ITQGRARVQVVNNNGKTVF [SEQ ID 134]
- PEPTIDE ITQGRARVQVVNNNGKTVFNGE [SEQ ID 135]
- PEPTIDE ITQGRARVQVVNNNGKTVFNG [SEQ ID 136]
- PEPTIDE RVQVVNNNGKTVF [SEQ ID 137]
- PEPTIDE RALPNDVLANAYRISREE [SEQ ID 138]
- PEPTIDE SIFRALPNDVLANAYR [SEQ ID 139]
- PEPTIDE SIFRALPNDVLANAY [SEQ ID 140]
- PEPTIDE SIFRALPNDVLAN [SEQ ID 141]
- PEPTIDE SSIFRALPNDVLANAYR [SEQ ID 142]
- PEPTIDE SIFRALPNDVLANAYRISREE [SEQ ID 143]
- PEPTIDE SIFRALPND [SEQ ID 144]
- PEPTIDE IYVTDLNNGANQLDPRQRD [SEQ ID 145]
- PEPTIDE VTNLNSQNFPILNLVQMSAVK [SEQ ID 146]
- PEPTIDE QNIDNPNR [SEQ ID 147]
- PEPTIDE ADTYNPR [SEQ ID 148]
- PEPTIDE NIDNPNRADTYNPRAGRVTNL [SEQ ID 149]
- PEPTIDE RVRQN IDNPN RADTYN PRAG RVTN L [SEQ ID 150]
- PEPTIDE TNPNSMVSHIAGKSSIFR [SEQ ID 151]
- PEPTIDE HNRGDEFGAFTPLQYK [SEQ ID 152]
- PEPTIDE SYQDVYNVAESS [SEQ ID 153]
- PEPTIDE ISREEAQR [SEQ ID 154]
- PEPTIDE SIFRALPTDVLANAYRISREE [SEQ ID 155]
- PEPTIDE YRISREEAQRLKHNRGDEF [SEQ ID 156]
- PEPTIDE YRISREEAQRLKHNRGDE [SEQ ID 157]
- PEPTIDE FKDEHQKIHR [SEQ ID 158]
- PEPTIDE QGDVIALPAGVAHW [SEQ ID 159]
- PEPTIDE TVFNGELRR [SEQ ID 160]
- PEPTIDE YIIQGRGITGPTF [SEQ ID 163]
- PEPTIDE VYIIQGRGITGPTF [SEQ ID 164]
- PEPTIDE LQAFEPIRSVR [SEQ ID 165]
- PEPTIDE GLSLLQPYASLQEQEQGQMQSR [SEQ ID 166]
- PEPTIDE GEIVRVER [SEQ ID 167]
- PEPTIDE RGLSLLQPYASLQ [SEQ ID 168]
- PEPTIDE RGLSLLQPYASLQEQ [SEQ ID 169]
- PEPTIDE RGLSLLQPYASLQEQE [SEQ ID 170]
- PEPTIDE RGLSLLQPYASLQE [SEQ ID 171]
- PEPTIDE RNPQAYR [SEQ ID 172]
- PEPTIDE FLLAGNKRNPQAY [SEQ ID 173]
- PEPTIDE EVEEWSQNIF [SEQ ID 174]
- PEPTIDE LAGNKRNPQAYR [SEQ ID 175]
- PEPTIDE FLLAGNKRNPQA [SEQ ID 176]
- RICE PROTEIN 4 Q0D7S0 - 3 - MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAV DDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY [SEQ ID 13]
- PEPTIDE ELGAPDVGHPMSE [SEQ ID 177]
- PEPTIDE IVQGHARVQVVSNLGK [SEQ ID 178]
- PEPTIDE IVQGHARVQVVSNL [SEQ ID 179]
- PEPTIDE IVQGHARVQVVSN [SEQ ID 180]
- PEPTIDE NNRGEELGAFTPR [SEQ ID 181]
- PEPTIDE GEELGAFTPR [SEQ ID 182]
- PEPTIDE FPILNLVQLSATR [SEQ ID 183]
- PEPTIDE SIEQHSGQNIFSGFNNELLSEALGVNALVAK [SEQ ID 184]
- PEPTIDE LQGQNDQR [SEQ ID 185]
- PEPTIDE SGFNNELLSEALGVNALVAK [SEQ ID 186]
- PEPTIDE PAFAQQQEQAQQQEQAQAQY [SEQ ID 187]
- PEPTIDE VAKRLQGQNDQRGEI [SEQ ID 188]
- PEPTIDE ALVAKRLQGQNDQRGEI [SEQ ID 189]
- PEPTIDE LQGQNDQRGEIIR [SEQ ID 190]
- PEPTIDE PNVNPWHNPRQGGF [SEQ ID 191]
- PEPTIDE FYNEGDAPVVALY [SEQ ID 192]
- PEPTIDE FYNEGDAPVV [SEQ ID 193]
- PEPTIDE FYNEGDAPVVAL [SEQ ID 194]
- PEPTIDE FYNEGDAPVVA [SEQ ID 195]
- PEPTIDE TNANSMVSHLAGK [SEQ ID 196]
- PEPTIDE AMPVDVIANAYR [SEQ ID 197]
- PEPTIDE NWENVLLGLGVAGSAPGIEGDEIAPLAK [SEQ ID 198]
- PEPTIDE NVLLGLGVAGSAPGIEGDE [SEQ ID 199]
- PEPTIDE NWENVLLGLGVAGSAPGIEGDEIAPLAK [SEQ ID 200]
- REGION 458 to 488 - RAVVKFNAPLAHLIMAGADVLAVPSRFEPCG [SEQ ID 64]
- PEPTIDE FNAPLAHLIMAGADVLAVPSR [SEQ ID 201]
- PEPTIDE FNAPLAHLIM [SEQ ID 202]
- PEPTIDE FNAPLAHLIMAGADVLAVPSR [SEQ ID 203]
- PEPTIDE VVGTPAYEEMVR [SEQ ID 204]
- PEPTIDE TGGLGDVLGGLPPAMAANGHR [SEQ ID 205]
- PEPTIDE YDQYKDAWDTSVVAEIK [SEQ ID 206]
- PEPTIDE DAWDTSVVAEIK [SEQ ID 207]
- PEPTIDE VMVISPR [SEQ ID 208]
- PEPTIDE LTGITGIVNGMDVSEWDPSKDK [SEQ ID 209]
- PEPTIDE VLTVSPYYAEELISGIAR [SEQ ID 210]
- PEPTIDE EALQAEAGLPVDRK [SEQ ID 211]
- PEPTIDE YDATTAIEAK [SEQ ID 212]
- PEPTIDE AGILEADR [SEQ ID 214]
- PEPTIDE VFIDHPSFLEK [SEQ ID 216]
- PEPTIDE GPDTGVDYKDNQM [SEQ ID 217]
- PEPTIDE IYGPDTGVDYKDNQMR [SEQ ID 218]
- PEPTIDE IYGPDTGVDYK [SEQ ID 219]
- PEPTIDE ILNLNNNPYFK [SEQ ID 220]
- PEPTIDE KNPQLQDLDI [SEQ ID 356]
- PEPTIDE GQSTSQWQSSR [SEQ ID 357]
- PEPTIDE QSTSQWQSSR [SEQ ID 358]
- PEPTIDE QSTSQWQSSR (also in P07730) [SEQ ID 359]
- PEPTIDE EEEEQGEEEINK [SEQ ID 360]
- PEPTIDE PSTNPWHSPR [SEQ ID 361]
- PEPTIDE AQAQDQYQQVQYSE [SEQ ID 362]
- PEPTIDE SEAGVTEYFDEKNELFQCTGTFVIRR [SEQ ID 363]
- PEPTIDE QAQAQDQYQQVQYSE [SEQ ID 363]
- PEPTIDE GSMGLTFPGCPAT (also in P14614) [SEQ ID 365]
- PEPTIDE GSMGLTFPGCPATY (also in P14614) [SEQ ID 366]
- PEPTIDE LGAFTPRY [SEQ ID 367]
- PEPTIDE LGAFTPRYQQ [SEQ ID 368]
- PEPTIDE ALGVNALVAKRLQGQN [SEQ ID 369]
- PEPTIDE LGAFTPRYQ [SEQ ID 370]
- PEPTIDE GSMGLTFPGCPAT (also in P14323) [SEQ ID 371]
- PEPTIDE GSMGLTFPGCPATY (also in P14323) [SEQ ID 372]
- PEPTIDE SNNPFKFLVPARQS [SEQ ID 373]
- PEPTIDE CAGVFVIRR [SEQ ID 374] PROTEIN Q6K7K6
- PEPTIDE GSPLQSPRGF [SEQ ID 375]
- PEPTIDE YLPTKQLQPTW [SEQ ID 378]
- PEPTIDE FGGSPLQSPRG [SEQ ID 380]
- PEPTIDE LNLLGFGINAENNE [SEQ ID 381]
- GYYGEQQQQPGMTR [SEQ ID 423] PROTEIN : P29835 - 5 - RICE
- SEEGYYGEQQQQPGMTR [SEQ ID 424] PROTEIN : P29835 - 5 - RICE
- PROTEIN P29835 - 5 - RICE
- PROTEIN P09918 - 14 - Pisum sativum
- PEPTIDE APTGTFIASGVVVGKD [SEQ ID 221]
- Vicia faba >gi 11375841 sp
- P08438.11 VCL_VICFA RecName: Full Vicilin; Flags: Precursor [Vicia faba] >gi 1220571 emb
- PPREQSQRRASA [SEQ ID 230] Homologs of Pea protein 4 (SEQ ID 4)
- LAFGINAENNQRNFLAGSDDN [SEQ ID 233] Homologs of Pea protein 5 (SEQ ID 5)
- Os02g0248800 [Oryza sativa Japonica Group] >gi 1379937381 gb
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Dermatology (AREA)
- Physiology (AREA)
- Nutrition Science (AREA)
- Birds (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Immunology (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
- Medicines Containing Plant Substances (AREA)
- Cosmetics (AREA)
Priority Applications (21)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020237030244A KR20230132623A (ko) | 2015-07-16 | 2016-07-18 | 항염증 펩티드, 및 그의 용도 |
| JP2018521713A JP2018523703A (ja) | 2015-07-16 | 2016-07-18 | 抗炎症性ペプチドおよびその使用 |
| US15/744,304 US10463591B2 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
| AU2016293129A AU2016293129B2 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
| DK16751491.8T DK3322430T3 (da) | 2015-07-16 | 2016-07-18 | Antiinflammatoriske peptider, og anvendelser deraf |
| EP16751491.8A EP3322430B1 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
| CA2992378A CA2992378A1 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides derived from rice proteins, and uses thereof |
| BR112018000660-2A BR112018000660A2 (pt) | 2015-07-16 | 2016-07-18 | peptídeos anti-inflamatórios e seu uso |
| CN202111590603.8A CN114835784B (zh) | 2015-07-16 | 2016-07-18 | 抗炎肽及其用途 |
| KR1020187004160A KR102307260B1 (ko) | 2015-07-16 | 2016-07-18 | 항염증 펩티드, 및 그의 용도 |
| EP21178569.6A EP3954700A1 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides derived from rice proteins (oryza sativa) and uses thereof |
| MX2018000697A MX377692B (es) | 2015-07-16 | 2016-07-18 | Peptidos anti-inflamatorios y usos de los mismos. |
| ES16751491T ES2806989T3 (es) | 2015-07-16 | 2016-07-18 | Péptidos antiinflamatorios, y usos de los mismos |
| EP20165063.7A EP3747425A1 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
| CN201680051932.6A CN108348568B (zh) | 2015-07-16 | 2016-07-18 | 抗炎肽及其用途 |
| KR1020217030710A KR102576571B1 (ko) | 2015-07-16 | 2016-07-18 | 항염증 펩티드, 및 그의 용도 |
| US16/569,159 US11253456B2 (en) | 2015-07-16 | 2019-09-12 | Anti-inflammatory peptides, and uses thereof |
| AU2021202423A AU2021202423A1 (en) | 2015-07-16 | 2021-04-21 | Anti-inflammatory peptides, and uses thereof |
| JP2021173218A JP7288026B2 (ja) | 2015-07-16 | 2021-10-22 | 抗炎症性ペプチドおよびその使用 |
| US17/574,865 US11779531B2 (en) | 2015-07-16 | 2022-01-13 | Anti-inflammatory peptides, and uses thereof |
| US18/451,560 US20240238184A1 (en) | 2015-07-16 | 2023-08-17 | Anti-inflammatory peptides, and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15177017.9A EP3118216A1 (en) | 2015-07-16 | 2015-07-16 | Cellular growth and proliferation promoting peptides, and uses thereof |
| EP15177013.8A EP3118215A1 (en) | 2015-07-16 | 2015-07-16 | Anti-inflammatory peptides, and uses thereof |
| EP15177017.9 | 2015-07-16 | ||
| EP15177013.8 | 2015-07-16 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/744,304 A-371-Of-International US10463591B2 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
| US16/569,159 Division US11253456B2 (en) | 2015-07-16 | 2019-09-12 | Anti-inflammatory peptides, and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017009484A1 true WO2017009484A1 (en) | 2017-01-19 |
Family
ID=56686757
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/067090 Ceased WO2017009484A1 (en) | 2015-07-16 | 2016-07-18 | Anti-inflammatory peptides, and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (4) | US10463591B2 (enExample) |
| EP (3) | EP3747425A1 (enExample) |
| JP (3) | JP2018523703A (enExample) |
| KR (3) | KR20230132623A (enExample) |
| CN (2) | CN114835784B (enExample) |
| AU (2) | AU2016293129B2 (enExample) |
| BR (1) | BR112018000660A2 (enExample) |
| CA (1) | CA2992378A1 (enExample) |
| DK (1) | DK3322430T3 (enExample) |
| ES (1) | ES2806989T3 (enExample) |
| MX (2) | MX377692B (enExample) |
| WO (1) | WO2017009484A1 (enExample) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2017373651B2 (en) * | 2016-12-05 | 2022-03-10 | Nuritas Limited | Compositions comprising peptide wkdeagkplvk |
| WO2022069844A1 (fr) | 2020-10-02 | 2022-04-07 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d'un peptide pour améliorer le confort de la peau et/ou des muqueuses et/ou l'apparence des phanères |
| WO2022131820A1 (ko) * | 2020-12-16 | 2022-06-23 | 아주대학교산학협력단 | 아토피 피부염 예방 또는 치료용 항염증 펩타이드 |
| JP2023169167A (ja) * | 2020-01-15 | 2023-11-29 | Tdk株式会社 | 米に含まれるタンパク質の含有量を測定する方法 |
| FR3141066A1 (fr) | 2022-10-24 | 2024-04-26 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d’un peptide pour améliorer la matrice extracellulaire du derme de la peau et/ou des muqueuses |
| EP4666996A1 (en) * | 2024-06-21 | 2025-12-24 | Quiris Healthcare GmbH & Co. KG | Composition containing peptides of vegetable origin |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102354916B1 (ko) * | 2020-02-11 | 2022-01-26 | 주식회사 쓰리빅스 | 신규 펩타이드 3ps_i014 및 이의 용도 |
| CN114478702B (zh) * | 2022-04-06 | 2023-12-12 | 中南林业科技大学 | 一种米糠来源短肽及其在治疗皮肤损伤中的应用 |
| CN116375828B (zh) * | 2022-09-08 | 2024-06-04 | 浙江大学 | 一种具有抗菌活性的抗菌肽kta及其应用 |
| CN116253782B (zh) * | 2022-09-08 | 2024-06-04 | 浙江大学 | 一种广谱抗菌肽ktr及其应用 |
| CN116491631B (zh) * | 2023-05-26 | 2024-06-25 | 青岛农业大学 | 一种预制菜红烧肉及其制备方法 |
| WO2024259556A1 (en) * | 2023-06-19 | 2024-12-26 | Viage Therapeutics, Inc. | Uses of therapeutic peptides |
| CN118994314A (zh) * | 2023-06-29 | 2024-11-22 | 长沙理工大学 | 一种具有免疫抑制活性的米渣短肽及其应用 |
| WO2025133189A1 (en) * | 2023-12-20 | 2025-06-26 | Nuritas Limited | Sleep promoting peptides and the use thereof |
| CN117986337B (zh) * | 2024-02-02 | 2024-08-16 | 杭州御寿生物科技有限公司 | 一种提高免疫力的益生菌组合物以及在治疗疾病中的应用 |
| CN120590476A (zh) * | 2025-08-06 | 2025-09-05 | 浙江诺衍生物科技有限公司 | 一种有助于降血糖的七肽及其应用 |
| CN120574921A (zh) * | 2025-08-06 | 2025-09-02 | 浙江诺衍生物科技有限公司 | 一种有助于降血糖的大米肽及其应用 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009026622A1 (en) * | 2007-08-24 | 2009-03-05 | Mylexa Pty Limited | Modulators of hypersensitivity reactions |
Family Cites Families (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4217344A (en) | 1976-06-23 | 1980-08-12 | L'oreal | Compositions containing aqueous dispersions of lipid spheres |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4186183A (en) | 1978-03-29 | 1980-01-29 | The United States Of America As Represented By The Secretary Of The Army | Liposome carriers in chemotherapy of leishmaniasis |
| US4261975A (en) | 1979-09-19 | 1981-04-14 | Merck & Co., Inc. | Viral liposome particle |
| US4485054A (en) | 1982-10-04 | 1984-11-27 | Lipoderm Pharmaceuticals Limited | Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV) |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4946787A (en) | 1985-01-07 | 1990-08-07 | Syntex (U.S.A.) Inc. | N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4774085A (en) | 1985-07-09 | 1988-09-27 | 501 Board of Regents, Univ. of Texas | Pharmaceutical administration systems containing a mixture of immunomodulators |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| AU7979491A (en) | 1990-05-03 | 1991-11-27 | Vical, Inc. | Intracellular delivery of biologically active substances by means of self-assembling lipid complexes |
| ES2103366T3 (es) | 1991-03-07 | 1997-09-16 | Novo Nordisk As | Hidrolizado proteico de guisante, metodo para su produccion y su utilizacion. |
| US5516642A (en) | 1992-11-16 | 1996-05-14 | Bristol-Myers Squibb Company | Polypeptides derived from major histocompatibility complex Class I antigen |
| JP2673659B2 (ja) | 1994-02-11 | 1997-11-05 | 株式会社ホーネンコーポレーション | ペプチド |
| US5688489A (en) * | 1995-09-15 | 1997-11-18 | Resolution Pharmaceuticals, Inc. | Non-receptor mediated imaging agents |
| US20040031072A1 (en) * | 1999-05-06 | 2004-02-12 | La Rosa Thomas J. | Soy nucleic acid molecules and other molecules associated with transcription plants and uses thereof for plant improvement |
| IT1313572B1 (it) | 1999-07-27 | 2002-09-09 | Enichem Spa | Procedimento per la preparazione di epossidi. |
| US20110131679A2 (en) * | 2000-04-19 | 2011-06-02 | Thomas La Rosa | Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
| JP2001335596A (ja) | 2000-05-24 | 2001-12-04 | Kenji Sakamoto | 新規ペプチド及びその医薬用途 |
| WO2002084250A2 (en) | 2001-04-17 | 2002-10-24 | Femtolink Biotechnologies Llc | Methods for mass spectrometry detection and quantification of specific target proteins in complex biological samples |
| AU2003290582A1 (en) * | 2002-11-04 | 2004-06-07 | Florida State University Research Foundation | NUCLEIC ACID AND ALLERGENIC POLYPEPTIDES ENCODED THEREBY IN CASHEW NUTS (Anacardium occidentale) |
| SE0300795D0 (sv) | 2003-03-24 | 2003-03-24 | Isconova Ab | Composition comprising iscom particles and live micro-organisms |
| CN1832755A (zh) | 2003-05-23 | 2006-09-13 | 佩斯特卡生物医疗实验室公司 | 使用干扰素治疗严重急性呼吸综合征及其他病毒感染 |
| ES2381359T3 (es) | 2003-11-17 | 2012-05-25 | Sederma | Composiciones que contienen mezclas de tetrapéptidos y tripéptidos |
| US20070053845A1 (en) | 2004-03-02 | 2007-03-08 | Shiladitya Sengupta | Nanocell drug delivery system |
| EP1896496B1 (en) | 2005-06-29 | 2012-01-11 | Hadasit Medical Research Services & Development Ltd. | Protein kinase c inhibitors for prevention of insulin resistance and type 2 diabetes |
| US8105572B2 (en) | 2007-05-18 | 2012-01-31 | New York University | Method of treating tuberculosis with interferons |
| KR100759495B1 (ko) | 2006-02-17 | 2007-09-18 | 재단법인서울대학교산학협력재단 | 친수성 생리활성 펩타이드와 소수성 물질을 포함한자기조립 나노구조체 |
| US8343531B2 (en) | 2006-04-21 | 2013-01-01 | Meiji Co., Ltd. | Composition containing peptide as active ingredient |
| US9034402B2 (en) | 2007-04-16 | 2015-05-19 | Solae, Llc | Protein hydrolysate compositions having improved sensory characteristics and physical properties |
| EP2840142B1 (en) | 2007-06-06 | 2018-12-26 | Monsanto Technology LLC | Genes and uses for plant enhancement |
| EP2050437A1 (en) | 2007-10-15 | 2009-04-22 | Laboratoires SMB | Improved pharmaceutical dry powder compositions for inhalation. |
| US20120157395A1 (en) * | 2009-07-13 | 2012-06-21 | Masahisa Ibuki | Anti-inflammatory agent for oral application, and anti-inflammatory peptide for oral application |
| WO2011122937A1 (en) | 2010-03-29 | 2011-10-06 | N.V. Nutricia | Pea protein peptides with anti helicobacter pylori activity |
| ES2397890B1 (es) | 2011-03-25 | 2014-02-07 | Lipotec, S.A. | Péptidos útiles en el tratamiento y/o cuidado de la piel y/o mucosas y su uso en composiciones cosméticas o farmacéuticas. |
| EP2793605A1 (en) * | 2011-12-21 | 2014-10-29 | Laboratorios Ordesa, S.L | Process for obtaining rice protein hydrolysates useful in the prevention and/or treatment of obesity |
| EP2897631A4 (en) | 2012-08-31 | 2016-10-05 | Univ Virginia Patent Found | TARGET PEPTIDES FOR IMMUNOTHERAPY AND DIAGNOSTICS |
| BR112015019748A2 (pt) * | 2013-02-19 | 2017-08-22 | Danone Sa | Peptídeo tendo atividade inibitória da pl e/ou pla2, produto alimentício adequado para o tratamento da obesidade e/ou estresse oxidativo, e, uso de streptococcus thermophilus cncm i-2776 e/ou streptococcus thermophilus cncm i-1630 e/ou lactobacillus paracasei subsp paracasei cncm i-4270 |
| WO2016090252A1 (en) | 2014-12-04 | 2016-06-09 | Mary Kay Inc. | Topical skin care composition comprising trifluoroacetyl tripeptide-2 |
| US20170183386A1 (en) | 2015-07-16 | 2017-06-29 | Nuritas Limited | Peptides, and uses thereof |
-
2016
- 2016-07-18 WO PCT/EP2016/067090 patent/WO2017009484A1/en not_active Ceased
- 2016-07-18 KR KR1020237030244A patent/KR20230132623A/ko not_active Withdrawn
- 2016-07-18 EP EP20165063.7A patent/EP3747425A1/en not_active Withdrawn
- 2016-07-18 CA CA2992378A patent/CA2992378A1/en active Pending
- 2016-07-18 EP EP21178569.6A patent/EP3954700A1/en not_active Withdrawn
- 2016-07-18 AU AU2016293129A patent/AU2016293129B2/en active Active
- 2016-07-18 KR KR1020217030710A patent/KR102576571B1/ko active Active
- 2016-07-18 ES ES16751491T patent/ES2806989T3/es active Active
- 2016-07-18 JP JP2018521713A patent/JP2018523703A/ja active Pending
- 2016-07-18 EP EP16751491.8A patent/EP3322430B1/en active Active
- 2016-07-18 KR KR1020187004160A patent/KR102307260B1/ko active Active
- 2016-07-18 DK DK16751491.8T patent/DK3322430T3/da active
- 2016-07-18 US US15/744,304 patent/US10463591B2/en active Active
- 2016-07-18 BR BR112018000660-2A patent/BR112018000660A2/pt not_active Application Discontinuation
- 2016-07-18 CN CN202111590603.8A patent/CN114835784B/zh active Active
- 2016-07-18 MX MX2018000697A patent/MX377692B/es active IP Right Grant
- 2016-07-18 CN CN201680051932.6A patent/CN108348568B/zh active Active
-
2018
- 2018-01-16 MX MX2020010806A patent/MX2020010806A/es unknown
-
2019
- 2019-09-12 US US16/569,159 patent/US11253456B2/en active Active
-
2021
- 2021-04-21 AU AU2021202423A patent/AU2021202423A1/en not_active Abandoned
- 2021-10-22 JP JP2021173218A patent/JP7288026B2/ja active Active
-
2022
- 2022-01-13 US US17/574,865 patent/US11779531B2/en active Active
-
2023
- 2023-05-25 JP JP2023086030A patent/JP7739355B2/ja active Active
- 2023-08-17 US US18/451,560 patent/US20240238184A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009026622A1 (en) * | 2007-08-24 | 2009-03-05 | Mylexa Pty Limited | Modulators of hypersensitivity reactions |
Non-Patent Citations (4)
| Title |
|---|
| DATABASE Geneseq [online] 28 December 2007 (2007-12-28), "Oryza sativa amino acid sequence SEQ ID NO 187493.", XP002764455, retrieved from EBI accession no. GSP:ANM73492 Database accession no. ANM73492 * |
| DATABASE Geneseq [online] 30 April 2009 (2009-04-30), "Human PHLDA1 protein PH domain peptide, SEQ ID 414.", XP002764456, retrieved from EBI accession no. GSP:AWH80057 Database accession no. AWH80057 * |
| DATABASE UniProt [online] 1 April 1993 (1993-04-01), "19 kDa globulin; Alpha-globulin; Allergen=Ory s 19kD", XP002764457, retrieved from EBI accession no. UNIPROT:P29835 Database accession no. P29835 * |
| LI-TAO TONG ET AL: "Rice [alpha]-globulin decreases serum cholesterol concentrations in rats fed a hypercholesterolemic diet and ameliorates atherosclerotic lesions in apolipoprotein E-deficient mice", FOOD CHEMISTRY, vol. 132, no. 1, 25 October 2011 (2011-10-25), NL, pages 194 - 200, XP055321077, ISSN: 0308-8146, DOI: 10.1016/j.foodchem.2011.10.056 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2017373651B2 (en) * | 2016-12-05 | 2022-03-10 | Nuritas Limited | Compositions comprising peptide wkdeagkplvk |
| JP2023169167A (ja) * | 2020-01-15 | 2023-11-29 | Tdk株式会社 | 米に含まれるタンパク質の含有量を測定する方法 |
| JP7605922B2 (ja) | 2020-01-15 | 2024-12-24 | Tdk株式会社 | 米に含まれるタンパク質の含有量を測定する方法 |
| WO2022069844A1 (fr) | 2020-10-02 | 2022-04-07 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d'un peptide pour améliorer le confort de la peau et/ou des muqueuses et/ou l'apparence des phanères |
| FR3114744A1 (fr) | 2020-10-02 | 2022-04-08 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d’un peptide pour améliorer le confort de la peau et/ou des muqueuses et/ou l’apparence des phanères |
| WO2022131820A1 (ko) * | 2020-12-16 | 2022-06-23 | 아주대학교산학협력단 | 아토피 피부염 예방 또는 치료용 항염증 펩타이드 |
| FR3141066A1 (fr) | 2022-10-24 | 2024-04-26 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d’un peptide pour améliorer la matrice extracellulaire du derme de la peau et/ou des muqueuses |
| WO2024089346A1 (fr) | 2022-10-24 | 2024-05-02 | Basf Beauty Care Solutions France Sas | Nouvelle utilisation d'un peptide pour ameliorer la matrice extracellulaire du derme de la peau et/ou des muqueuses |
| EP4666996A1 (en) * | 2024-06-21 | 2025-12-24 | Quiris Healthcare GmbH & Co. KG | Composition containing peptides of vegetable origin |
| WO2025262267A1 (en) * | 2024-06-21 | 2025-12-26 | Quiris Healthcare Gmbh & Co. Kg | Composition containing peptides of vegetable origin |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11779531B2 (en) | Anti-inflammatory peptides, and uses thereof | |
| US11707500B2 (en) | Growth promoting peptides, and uses thereof | |
| HK40069687A (en) | Anti-inflammatory peptides derived from rice proteins (oryza sativa) and uses thereof | |
| HK40073114A (en) | Growth promoting peptides and uses thereof | |
| HK40065700A (en) | Peptides for use in promoting transport of glucose |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16751491 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2992378 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021001357 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018521713 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2018/000697 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016293129 Country of ref document: AU Date of ref document: 20160718 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187004160 Country of ref document: KR Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018000660 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112018000660 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180112 |