WO2016205703A1 - Crispr/cas9 complex for genomic editing - Google Patents
Crispr/cas9 complex for genomic editing Download PDFInfo
- Publication number
- WO2016205703A1 WO2016205703A1 PCT/US2016/038161 US2016038161W WO2016205703A1 WO 2016205703 A1 WO2016205703 A1 WO 2016205703A1 US 2016038161 W US2016038161 W US 2016038161W WO 2016205703 A1 WO2016205703 A1 WO 2016205703A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- cell
- complex
- site
- mutation
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/28—Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0647—Haematopoietic stem cells; Uncommitted or multipotent progenitors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/156—Polymorphic or mutational markers
Definitions
- CPJSPR-Cas9 systems Clustered regularly interspaced short palindromic repeats (CPJSPR)-associated (Cas) systems (CPJSPR-Cas9 systems) are used for gene editing at desired genomic sites in mammalian cells.
- CPJSPR-Cas9 systems a Cas9 nuclease is targeted to a genomic site by complexing with a guide RNA that hybridizes to a target site in the genome. This results in a double-strand break that initiates either non-homologous end-joining (NHEJ) or homology- directed repair (HDR) of genomic DNA via a double-strand or single-strand DNA repair template.
- NHEJ non-homologous end-joining
- HDR homology- directed repair
- the complex comprises a guide RNA (gRNA) comprising a first nucleotide sequence that hybridizes to a target DNA in the genome of the cell, wherein the target DNA comprises a mutation, and a second nucleotide sequence that interacts with a site- directed nuclease.
- gRNA guide RNA
- the complex further comprises a recombinant site-directed nuclease operably linked to a supercharged protein, wherein the site-directed nuclease comprises an RNA-binding portion that interacts with the second nucleotide sequence of the guide RNA and wherein the site-directed nuclease specifically binds and cleaves the target DNA to create a double stranded break.
- the complex also comprises a single-stranded donor
- ssODN oligonucleotide
- Methods of site-specific modification of a target DNA in a cell or a population of cells comprise introducing a complex for correcting a mutation in the genome of the cell, wherein the complex is introduced into the cells under conditions that allow homology-directed repair (HDR) and integration of the ssODN into the target DNA.
- the method further provides for a high rate of cell survival in corrected cells.
- a method of treating a disease associated with a mutation in the genomic sequence encoding hemoglobin in a subject are also provided.
- the method comprises introducing into a population of cells obtained from the subject a complex for correcting a mutation in the genomic sequence encoding hemoglobin under conditions that allow homology-directed repair (FIDR) to correct the mutation in the genomic sequence encoding hemoglobin and transplanting the corrected cells into the subject.
- FIDR homology-directed repair
- Figures 1 A-1C show that in vitro differentiation of JAK3 C1837T patient induced pluripotent stem cells (iPSCs) recapitulates SCID phenotypes.
- Figures 1 A and IB show flow cytometry of iPSC-derived T cells. JAK3 WT iPSCs (Control) and JAK3- deficient iPSCs (JAK3 C1837T) were differentiated into CD34+ cells on OP9 stromal cells and,
- FIG. 1 shows the results of RT-qPCR assays for transcripts of key genes that regulate early events during specification of the T cell lineage. RNA levels are shown relative to GAPDH expression.
- Figures 2A-2C show that BCL2 partially rescues T cell developmental defects in JAK3-deficient, in-vitro derived cells.
- Figure 2A shows apoptosis of JAK3 -deficient, iPSC- derived T cells compared to JAK3 WT controls.
- Annexin V-positive cells were analyzed at T cell induction day 10 (TD10) and 17 (TD17).
- TD10 T cell induction day 10
- TD17 T cell induction day 10
- TD17 T cell induction day 10
- Figure 2B shows the results of RT-qPCR assays for anti-apoptotic BCL2 and proapoptotic BAX expression in two lines (1 and 2) from JAK3 WT (Control) and JAK3 -deficient cells (JAK3 C1837T). D, not determined (due to insignificant JAK3 qPCR signal). RNA levels are shown relative to GAPDH expression.
- Figure 2C shows flow cytometry of J AK3 -deficient iPSCderived T cells transduced with BCL2-2A-GFP lentivirus to assess effects on NK (CD 16+56+) and T cell (CD3+) development and DP (CD4+CD8+) to SP (CD4+ or CD8+) T cell maturation.
- Figures 3A-3D show that CRISPR/Cas9 enhanced correction of the JAK3 C1837T mutation in patient-specific iPSCs.
- Figure 3 A depicts the strategy for genome modification using CRISPR/Cas9 to induce double-strand breaks in the JAK3 locus and a template for homology directed repair.
- Top line structure of the JAK3 gene. Open boxes, exons. Asterisk, C1837T mutation. Arrows, guide RNAs.
- Figure 3B, top shows PCR analysis demonstrating homologous recombination; primers for 5' and 3' analysis are indicated.
- FIG. 3C provides a summary of targeting efficiencies of guide RNAs.
- Figure 3D Sanger sequencing of the PCR amplicons from parental JAK3 iPSCs (Left), heterozygous corrected (Middle) and homozygous corrected iPSCs (Right). The two heterozygous clones were corrected with gRNA2 + wild type Cas9, and the homozygous clone was corrected with gRNAl + gRNA2 + nickase Cas9 (D10A).
- FIGS 4A-4C show in vitro differentiation of JAK3 corrected patient iPSCs produces T cells with phenotypic and functional characteristics of mature T cells.
- Figure 4B shows T cell receptor (TCR) Vp analysis of JAK3 -corrected T cells. A highly diverse repertoire of TCR ⁇ is represented in T cells derived from corrected SCID patient iPSCs.
- FIG. 4C shows flow cytometry demonstrating T cell activation in JAK3 -corrected T cells.
- T cells derived from JAK3 WT (Control) and JAK3 -corrected iPSCs were stimulated with anti-CD3/28 beads for 3 days before analysis of activation markers CD25 and CD69. The data were gated on CD3+ populations.
- Figures 5A-5C show in vitro generation of CD34+ HSCs from hiPSCs by co-culture with human bone marrow stromal cells (hMSC).
- Human iPSCs were cultured on hMSCs for 18 days before analysis for hematopoietic markers, CD34 and CD43 ( Figure A).
- CD34+ cells were purified on beads and differentiated into T cells ( Figure B), erythroid and myeloid cells ( Figure C).
- To generate T cells purified CD34+ cells were plated on OP9-DL4 cells for 3 to 4 weeks.
- purified CD34+ cells were plated in MethoCult H4434 Classic medium according to the manufacturer's protocol.
- FIG. 6A-6C show in vitro generation of T cells by culturing hiPSC derived CD34+ cells with hMSC-DL4. To generate CD7+ T progenitor cells, hiPSC derived CD34+ cells were co-cultured on hMSC-DL4 for 3 to 4 weeks ( Figure 6A). When CD7+ cells from Figure 6A were purified on magnetic beads and co-cultured on OP9-DL4, fully mature
- CD4+/CD8+/CD3+/TCR-ap+ cells were produced in 10 days or less ( Figures B and C). These data demonstrate that hiPSC can be efficiently differentiated into CD7+ lymphoid progenitors after co-culture on hMSC-DL4.
- FIG. 7 shows in vitro generation of ⁇ T cells from hiPSC.
- Human iPSC were transduced with a lentiviral vector carrying a pre-rearranged human V ⁇ cDNA linked with a 2A-GFP cDNA fragment.
- hiPSC derived CD34+ cells were purified on magnetic beads. These cells were subsequently plated on OP9-DL4 cells for T cell differentiation. Cells were harvested at Day 32 and T cell surface markers were analyzed by FACS.
- the GFP+ population represents V51-2A-GFP lentiviral transduced cells. A high percentage of these GFP positive cells expressed V51 (66%). A low percentage of GFP negative cells expressed V51 (1%).
- V5 T cells expressing recombinant T Cell Receptors can be efficiently produced from genetically modified iPSC.
- Production of V5 T cells expressing recombinant T Cell Receptors (TCR) specific for tumor antigens provides a powerful cellular therapy for many types of cancer.
- Figure 8 shows that a correction complex including guide RNA, a modified Cas9 and a single stranded oligonucleotide donor sequence (ssODN) can correct a sickle cell mutation.
- the complex was introduced into sickle iPSC by nucleoporation, and 2 days later genomic DNA was analyzed by digital PCR (ddPCR) and sequenced. Over 65% of the cells contained at least one corrected gene. The results were confirmed as follows. Two days after introduction of the correction complex, the cells were plated in culture dishes, and 43 individual iPSC colonies were isolated. Genomic DNA was isolated from these colonies and the beta-globin gene was sequenced. Sixty-five percent of the colonies contained at least one corrected beta-globin gene (S corrected to A).
- Figure 9 shows that introduction of a sickle cell correction complex (gRNA-modified recombinant Cas9-ssODN) into patient primary bone marrow CD34+ cells can correct a sickle cell mutation.
- a sickle cell correction complex gRNA-modified recombinant Cas9-ssODN
- DNA was analyzed by digital PCR (ddPCR) and sequenced. Approximately equal amounts of betaA and betaS mRNA were observed.
- Figure 10 is an isoelectric focusing (IEF) gel of in vitro differentiated red blood cells from the corrected sickle patient CD34+ cells of Figure 9, showing an Fib A (normal hemoglobin) to HbS (hemoglobin with sickle cell mutation) ratio of about 1 :3, which is sufficient to inhibit sickling and treat sickle cell anemia.
- IEF isoelectric focusing
- FIG 11 shows that engineered positively charged Cas9 RNPs/ssODN (EpcCas9 RNPs/ssODN) efficiently correct the sickle mutation in human patient iPSCs.
- Wild type Cas9 (Cas9WT) RNP and eight engineered positively charged (EpcCas9) RNPs were co- nucleoporated with correction ssODN into human sickle iPSCs.
- efficiencies in the pooled cells were determined by Sanger sequencing at two days post nucleofection.
- the arrow indicates the position of sickle correction (T->A) and the scissors indicate the Cas9WT-36GFP RNP cutting site on the sickle HBB DNA.
- Figure 12 shows the results of deep sequencing of on-target modifications in human sickle iPSC populations.
- On-target deep sequencing analysis of human sickle iPSCs nucleoporated with Cas9WT RNP/ssODN, Cas9WT-EGFP, or four EpcCas9 RNPs/ssODNs is shown. Black bars indicate the corrected base and the space below the black bars indicates the sickle cell mutation. The negative control and the ssODN alone both show only the sickle cell mutation. All iPSC samples also contain a SNP near the sickle mutation (column on right hand side).
- Figure 13 shows that TAT-CAs9WT-EGFP RNP suppresses on-target indels.
- Human sickle iPSCs were nucleoporated with Cas9WT and TAT-Cas9WT-EGFP RNPs with
- FIG 14 shows that EpcCas9 RNPs suppress on-target indels in human sickle iPSCs.
- Human sickle iPSCs were nucleoporated with Cas9WT and five EpcCas9 RNPs, with or without correction ssODN. Indel and correction efficiencies were analyzed by Sanger sequencing at two days post nucleoporation.
- the arrows indicate the position of sickle correction (T->A) and the scissors indicate the Cas9WT-36GFP RNP cutting site on the sickle HBB DNA.
- Figure 15 shows that EpcCas9 RNPs enhance cell survival after nucleoporation in human sickle iPSCs.
- Human sickle iPSCs were nucleoporated with Cas9WT RNP and seven EpcCas9 RNPs with or without correction ssODN. Cell survival was assessed by light microscopy at two days post nucleofection.
- Figures 16A and 16B show ssODN:Cas9 RNP ratios for sickle correction in human iPSCs.
- Correction ssODN and Cas9WT-36GFP/T2 RNP were nucleoporated into sickle patient iPSC at molar ratios of 0, 0.2, 0.5, 1.0, 1.15, 1.35, 1.5 and 2.0.
- a Cas9WT- 36GFP:T2 gRNA molar ratio of 1 : 1.35 was fixed for these experiments.
- ssODN 1.0 Cas9WT-36GFP: 1.35 T2 gRNA.
- ddPCR digital droplet PCR
- Fig. 16A Sanger sequencing
- Fig. 16B Sanger sequencing
- Figure 17 shows Cas9:sgRNA ratios for sickle correction in human iPSCs.
- 36GFP:sgRNA molar ratios of 1 : 1.15, 1 : 1.35 and 1 : 1.50 with ssODN molar ratios of 1.15 or 1.35 were tested to determine optimal correction efficiency of the sickle mutation in patient iPSC.
- the mixtures were nucleoporated into human sickle iPS cells and the Sanger sequencing results for the pooled cells were analyzed at two days post nucleofection. Arrows indicate the position of sickle correction (T->A) and scissors indicate the Cas9WT-36GFP RNP cutting site on sickle HBB DNA.
- Figure 18 shows correction of human sickle iPSCs by EpcCas9 RNP/ssODN.
- Sanger sequencing analysis of pooled human sickle iPS cells nucleofected with TAT-Cas9WT- 36GFP-INF7 RNP/ ssODN was performed.
- the arrow indicates the position of sickle correction (T->A) and the scissors indicate the position of EpcCas9 RNP induced DSB on the sickle HBB DNA.
- Figures 19A and 19B show correction of human iPSCs with EpcCas9 RNP and wobble ssODNs.
- Human sickle iPSC were nucleoporated with TAT-Cas9-36GFP-INF7 RNP and ssODNs containing wobble bases near the gRNA cleavage sites.
- the arrow on the left hand side of Figure 19A indicates the position of sickle mutation and the 3 arrows located downstream of the sickle mutation indicate positions of wobble bases.
- Scissors point to the Tl cleavage site.
- FIGS 20A and 20B show the results of whole genome sequencing (WGS) analysis of 4 iPSC clones corrected with TAT-Cas9WT-36GFP-INF7 RNP/ssODNs.
- WGS whole genome sequencing
- Figures 21 A-D show gene correction of sickle patient bone marrow CD34+ HSPCs.
- A Human sickle bone marrow CD34+ cells were nucleoporated by Cas9WT, Cas9WT- 36GFP and TAT-Cas9WT-3xTAT RNPs/ssODN. Gene correction efficiency for pooled populations cells was analyzed six days after nucleofection. The arrow indicates the position of sickle correction (T->A) and the scissor indicate the Cas9WT-36GFP RNP cutting site on the sickle HBB DNA.
- B mRNA correction by RT-PCR and Sanger sequencing in
- Cas9WT-36GFP nucleoporated sickle CD34+ cells that were harvested after 10-day culturing in erythroid differentiation media.
- C IEF Gel analysis of in vitro differentiated RBCs from Cas9WT-36GFP RNP/ssODN nucleofected sickle CD34+ cells. Human sickle child patient blood lysate (SS) and human normal adult blood lysate (AA) that represent HbF, HbS and HBA proteins were also loaded as controls.
- D Mass spectrometry analysis of in vitro differentiated RBCs derived from sickle CD34+ cells nucleofected with Cas9WT-36GFP RNP/ssODN. The peaks demonstrate signals from uncorrected HbS protein and corrected HbA protein.
- Figures 22A-C show correction of colonies derived from single CD34+ progenitors.
- A BFU-E and CFU-GEMM colonies derived from nucleoporated human sickle CD34+ cells.
- B Representative Sanger Sequencing results of colonies obtained from human sickle CD34+ cells after nucleoporation with TAT-Cas9WT-36GFP-INF7 RNP/ssODN.
- C C
- Figure 23 is a graphical summary of deep sequencing data from Table 6.
- Figure 24 shows non-specific modifications near Cas9WT RNP targeting site.
- BFU-E colonies from Cas9WT RNP/ssODN nucleoporated sickle CD34+ cells contain indels that do not appear to be initiated at the cutting site.
- the top sequence labeled 'Upstream' is representative of non-specific modifications upstream of the expected cleavage site.
- the bottom sequence labeled 'Downstream' represents non-specific modifications observed downstream of the expected cleavage site.
- Arrows indicate the position of the sickle mutation and scissors indicate the expected cleavage site of Cas9WT RNP.
- Figure 25 shows isoelectric focusing (IEF) gel analysis of blood six weeks after primary transplantation of sickle mouse fetal liver c-kit+ cells nucleoporated with Cas9 RNP/ssODN into irradiated C57BI/6 mice to correct a sickle cell mutation.
- Mouse fetal liver c-kit+ cells are equivalent to human cord-blood Cd34+ cells.
- Figure 26 shows ddPCR analysis of F ACS purified bone marrow cells at twelve weeks post-transplantation into irradiated C57BI6 mice. Twelve weeks after nucleoporation and transplantation, approximately 50% of erythroid cells (Terl 19+) and myeloid cells (CD1 lb+ and CD1 lb+/GRl+) are corrected.
- Erythroid and myeloid cells are relatively short lived; therefore, these cells are derived from transplanted HSCs. Correction levels in B and T cells can rise to approximately 50% after secondary transplantation at twelve weeks (twenty- four weeks total). After twenty-four weeks, most if not all hematopoietic cells will be derived from long-term HSCs.
- Figure 27 shows IEF gel analysis of blood from mice twelve weeks after primary transplantation and six weeks after secondary transplantation of cells nucleoporated with Cas9 R P/ssODN to correct a sickle cell mutation.
- Human HbA is produced in mice after transplantation of HSCs nucleoporated with Cas9 RNP/ssODN to correct a sickle cell mutation.
- CRISPR/Cas9 complexes for genomic modification of cells.
- a complex for correcting a mutation in the genome of a cell comprising (a) a guide RNA (gRNA) comprising a first nucleotide sequence that hybridizes to a target DNA in the genome of a cell, wherein the target DNA comprises a mutation, and a second nucleotide sequence that interacts with a site-directed nuclease; (b) a recombinant site-directed nuclease operably linked to a supercharged protein, wherein the site-directed nuclease comprises an RNA-binding portion that interacts with the second nucleotide sequence of the guide RNA and wherein the site-directed nuclease specifically binds and cleaves the target DNA to create a double stranded break; and (c) a single-stranded donor oligonucleotide (ssODN) that hybridizes to a genomic sequence flanking the double stranded break in the target DNA and integrates into the target DNA to correct
- gRNA
- the complex comprising a guide RNA (gRNA), a recombinant site-directed nuclease and a donor nucleotide described herein does not occur in nature.
- the complex provides the elements necessary with the required configuration and stoichiometry to efficiently and effectively modify cells.
- the gRNA molecule binds to the site-directed nuclease and targets the nuclease to a specific location within the target DNA.
- a gRNA comprises a first nucleotide sequence that hybridizes to a target DNA in the genome of a cell, wherein the target DNA comprises a mutation, and a second nucleotide sequence that interacts with a site-directed nuclease.
- the complexes described herein can comprise one or two separate gRNAs. Therefore, the term guide RNA includes both a single guide RNA and a double guide RNA.
- guide RNA includes both a single guide RNA and a double guide RNA.
- TAACGGCAGACTTCTCCAC SEQ ID NO: 1.
- An example of a guide sequence comprising a stem loop for Cas9 binding is provided herein as
- the recombinant site-directed nuclease can be an RNA-guided site-directed nuclease, for example, a Cas protein from any bacterial species or a functional fragment thereof.
- the Cas protein can be a Cas9 protein or a functional fragment thereof.
- the term "Cas9” means a Cas9 protein or a fragment thereof present in any bacterial species that encodes a Type II CRISPR/Cas9 system. See, for example, Makarova et al. Nature Reviews, Microbiology, 9: 467-477 (2011), including supplemental information, hereby incorporated by reference in its entirety.
- the Cas9 protein or a fragment thereof can be from Streptococcus pyogenes.
- Full- length Cas9 is an endonuclease that includes a recognition domain and two nuclease domains (UNH and RuvC, respectively).
- UNH is linearly continuous
- RuvC is separated into three regions, one left of the recognition domain, and the other two right of the recognition domain flanking the UNH domain.
- Streptococcus pyogenes is targeted to a genomic site in a cell by interacting with a guide RNA that hybridizes to a 20-nucleotide DNA sequence that immediately precedes an NGG motif recognized by Cas9. This results in a double-strand break that is repaired via HDR by a donor nucleotide, for example, a ssODN or a double stranded DNA construct that hybridizes to a genomic sequence flanking the double stranded break in the target DNA and integrates into the target DNA to correct a mutation in the target DNA.
- a donor nucleotide for example, a ssODN or a double stranded DNA construct that hybridizes to a genomic sequence flanking the double stranded break in the target DNA and integrates into the target DNA to correct a mutation in the target DNA.
- the molar ratio of gRNA to site-directed nuclease operably linked to a supercharged protein to ssODN can be from about 1 : 1 :0.2 to about 1.5: 1 :2.0.
- the molar ratio of gRNA to site-directed nuclease operably linked to a supercharged protein to ssODN can be about 1:1:1, 1.1:1:1, 1:1:1.15, 1:1:1.25, 1:1:1.30; 1:1:1.35; 1:1:1.40; 1:1:1.50, 1.2:1:1, 1.3:1:1.1.4:1:1, 1.5:1:1, 1.5:1:1.15, 1.5:1:1.25,
- a supercharged protein can be a superpositively charged protein that has an overall positive charge that is greater than its corresponding unmodified protein.
- the superpositively charged protein can be a superpositively charged green fluorescent protein (GFP) that has an overall positive charge from about +5 to about +40.
- GFP green fluorescent protein
- the overall positive charge can be about +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, +21, +22, +23, +24, +25, +26, +27, +28, +29, +30, +31, +32, +33, +34, +35, +36, +37, +38, +39 or +40.
- the supercharged protein can be operably linked to the amino-terminus or the carboxy-terminus of the nuclease. It is also contemplated that the supercharged protein can be associated with the nuclease, without necessarily being covalently linked to the nuclease.
- An example of a supercharged protein is a superpositively charged GFP, for example, +36 GFP.
- +36 GFP can be operably linked to the amino or carboxy- terminus of Cas9 or a functional fragment thereof. See, for example, McNaughton et al., "Mammalian cell penetration, siRNA transfection, and DNA transfection by supercharged proteins," PNAS 106(15): 6111-6116.
- An example of a polypeptide comprising +36 GFP operably linked to the carboxy-terminus of Cas9 is provided herein as SEQ ID NO: 3.
- the nuclease can also be operably linked to a supercharged protein and one or more positively charged peptides, for example, one or more transactivating transcriptional activator (TAT) peptide can be operably linked to the amino-terminus or the carboxy-terminus of the nuclease.
- TAT transcriptional activator
- a superpositively charged protein can be operably linked to the carboxy-terminus of the nuclease and one or more TAT peptides (for example, IX TAT, 2X TAT, 3X TAT, 4X TAT, etc.) can be operably linked to the amino- terminus of the nuclease.
- polypeptide comprising a TAT peptide operably linked to the amino-terminus of the nuclease and a superpositively charged GFP operably linked to the carboxy-terminus of the nuclease is provided herein as SEQ ID NO: 4.
- Polypeptide sequences that are at least about 75% identical to SEQ ID NO: 3 or SEQ ID NO: 4 are also provided.
- polypeptide sequences that are at least about 75%, 80%, 85%), 90%), 95%), 99% or any percentage in between are also provided.
- the nuclease can also be operably linked to a supercharged protein and one or more negatively charged peptides, for example, a negatively charged peptide of about 10 to about 25 amino acids in length, for example, SEQ ID NO: 50, can be operably linked to the carboxy-terminus of the site-directed nuclease.
- a superpositively charged protein can be operably linked to the carboxy-terminus of the nuclease and a negatively charged peptide can be operably linked to the carboxy-terminus of the superpositively charged protein.
- recombination is a process of exchange of genetic information between two polynucleotides.
- Homology-directed repair refers to DNA repair that takes place, for example, during repair of double-strand breaks in cells. This process requires nucleotide sequence homology and uses a donor molecule, for example, a single stranded or a double stranded nucleotide sequence as a template for repair of a target genomic sequence, i.e., the genomic sequence with the double-strand break, and leads to the transfer of genetic information from the donor to the target genomic sequence.
- Homology-directed repair can result in a modification of the sequence of the target genomic sequence.
- FIDR can result in an insertion, a deletion or a mutation in the target genomic sequence.
- Part or all of the sequence of the donor polynucleotide can be incorporated into the target DNA. It is also contemplated that the donor polynucleotide, a portion of the donor polynucleotide, a copy of the donor polynucleotide, or a portion of a copy of the donor polynucleotide integrates into the target DNA.
- NHEJ non-homologous end joining
- the complexes and methods provided herein can be used to correct any mutation in a target DNA by HDR.
- the complexes can be used to replace an incorrect nucleotide sequence with a correct nucleotide sequence (e.g., to restore function to a target polynucleotide sequence that is impaired due to a loss of function mutation, i.e., a SNP) at a specific site in the genome.
- a correct nucleotide sequence e.g., to restore function to a target polynucleotide sequence that is impaired due to a loss of function mutation, i.e., a SNP
- These mutations can be associated with an autoimmune disorder, a genetic disease, a blood disorder, a T cell disorder, a monogenic disorder, cancer, a neurodegenerative disease, a cardiovascular disease or an infectious disease, to name a few.
- the complexes and methods provided herein can be used to correct a mutation associated with sickle cell disease (i.e., a mutation in a hemoglobin gene, for example, a GAG to GTG mutation at codon 6 of the beta-globin gene that results in a glutamic acid to valine substitution), severe combined immunodeficiency (SCID) (for example, a mutation in JAK3), beta thalassemia or Wiskott- Aldrich Syndrome.
- a mutation associated with sickle cell disease i.e., a mutation in a hemoglobin gene, for example, a GAG to GTG mutation at codon 6 of the beta-globin gene that results in a glutamic acid to valine substitution
- SCID severe combined immunodeficiency
- JAK3 beta thalassemia
- Wiskott- Aldrich Syndrome for example, a mutation in JAK3
- correction of single mutations or multiple mutations can be performed with one or more complexes.
- the complexes and methods provided herein can also be used to insert sequences into a specific site in the genome to correct a deletion, as opposed to making a correction or a substitution.
- the complexes and methods provided herein can also be used to insert a nucleotide sequence that encodes an a functional polypeptide into a specific site in the genome of the cell, in order to express the functional polypeptide in the cell.
- the functional polypeptide can be a polypeptide that is endogenous (i.e., normally expressed by the cell) or exogenous to the cell (i.e. not normally expressed by the cell).
- chimeric antigen receptor (CAR) sequences can be inserted into the genome of a T cell precursor in order to generate cancer specific T cells for the treatment of cancer.
- the complexes and methods provided herein can be used to inhibit the activity of a gene at a specific site in the genome of the cell.
- the complexes and methods provided herein can be used to insert sequences into the CXCR4 or CCR5 receptor to treat or prevent HIV infection.
- the complexes provided herein can modify or alter target DNA with surprisingly high efficiency as compared to conventional CRISPR/Cas systems.
- the efficiency of alteration in a population of cells can be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80% or higher or any percentage in between these percentages.
- the efficiency of alteration can also be greater than or equal to about 80%. Therefore, also provided herein are populations of cells, wherein at least 5%, 10%, 15%,
- a mutation associated with sickle cell disease or another disorder has been corrected. If a population of cells comprising a mutation associated with sickle cell disease is contacted with a CRISPR/Cas complex described herein and the mutation is corrected in about 5% of the cells, the efficiency of modification or alteration is about 5%.
- a population of cells wherein the mutation associated with sickle cell disease is corrected in about 30% of the cells, including, for example, 27%, 28% and 29%) is sufficient to treat sickle cell disease, upon transplantation in a subject with sickle cell disease.
- a mutation associated with sickle cell disease is corrected in about 40%, 50%, 60%, 70%, 80%, 90% or higher or any percentage in between, of the cells in the population.
- the complexes provided herein can also increase the ratio of HDR to NHEJ in a population of cells contacted with the complex.
- the HDR/NHEJ ratio can be from about 10 to about 0.5.
- HDR/NHEJ ratio can be about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5 or less or any ratio in between these ratios.
- the cell survival rate for corrected cells can be at least about 50%, 60%, 70%, 80%, 90% or higher and any percentage in between.
- Any cell(s) can be modified or derived using the complexes described herein.
- Introduction of the complex into the cells can be cell cycle dependent or cell cycle independent.
- Methods of synchronizing cells to increase the proportion of cells in a particular phase for example, the S-phase , are known in the art. See, for example, Takahashi et al. "Efficient introduction of a gene into hematopoietic cells in S-phase by electroporation," Exp. Hematol. 19(5):343-346 (1991).
- a gene into hematopoietic cells in S-phase by electroporation Exp. Hematol. 19(5):343-346 (1991).
- one of skill in the art can readily determine if cell cycle synchronization is necessary.
- the cell(s) can be a eukaryotic cell, for example, a mammalian cell.
- the cell can also be prokaryotic or a plant cell.
- the cell can be a human cell.
- the cell can be a germ cell, a somatic cell, a stem cell, a precursor cell or a progenitor cell.
- the precursor cell can be, for example, a pluripotent stem cell or a multipotent stem cell, like a hematopoietic stem cell.
- pluripotent cells include induced pluripotent stem cells. Methods of making induced pluripotent stem cells and known in the art and described in the Examples.
- the cell can also be CD34+ cell, optionally derived from an induced pluripotent stem cell.
- the CD34+ cell can be selected from the group consisting of a primary CD34+ hematopoietic progenitor cell, a CD34+ peripheral blood cell, a CD34+ cord blood cell and a CD34+ bone marrow cell.
- the cell can also be a primary cell, for example, a primary CD34+
- the cells are cells that are not cancer cells, cells that are not tumor cells or cells that are not transformed cells. Cells can be screened before or after correction for evidence of undesirable genetic characteristics. Further provided is a cell comprising any of the complexes described herein. The cell can be in vitro, ex vivo or in vivo.
- a method of site-specific modification of a target DNA in a population of cells comprising introducing into the cells any of the complexes described herein, wherein the complex is introduced into the cells under conditions that allow homology-directed repair (HDR) and integration of a donor nucleotide, for example, a ssODN or double stranded nucleotide sequence into the target DNA.
- HDR homology-directed repair
- the complex can be introduced into the cell via nucleoporation. Methods for nucleoporation are known in the art. See, for example, Maasho et al.
- the donor nucleotide for example, a ssODN or a double stranded nucleotide sequence integrates into a target DNA and corrects a mutation in the target DNA.
- the ratio of HDR to NHEJ in a population of cells is increased relative to other CRISPR-Cas9 delivery methods.
- the HDR/NHEJ ratio can be from about 10 to about 0.5.
- the HDR/NHEJ ratio can be about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5 or less or any ratio in between these ratios.
- the efficiency of alteration by HDR can be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80% or greater or any percentage in between these percentages.
- the efficiency of alteration by HDR can also be greater than or equal to about 80%. For example, if a population of cells comprising a mutation associated with sickle cell anemia is contacted with a CRISPR/Cas complex described herein and the mutation is corrected in about 5% of the cells, the efficiency of alteration by HDR is about 5%.
- the population of cells can be obtained from the subject having a disorder such that at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%), 55%), 60%), 65%), 70%, 75% or 80% or greater or any percentage in between these percentages, of the cells undergo HDR to correct a mutation associated with the disorder. In some cases greater than 80% of the cells from the subject will undergo HDR to correct a mutation associated with the disorder. In the methods described herein, between about 50% and 99%) of the cells survive after introduction of the complex. For example, great than about 50%, 60%, 70%, 80%, 90%, 95%, 99% or any percentage in between these percentages, of corrected cells survive after introduction of the complex.
- a method of treating a disease associated with a mutation in the genomic sequence encoding hemoglobin in a subject comprising: (a) introducing into a population of cells obtained from the subject a complex comprising (1) a guide RNA (gRNA) comprising a first nucleotide sequence that hybridizes to a target DNA in the genome of a cell, wherein the target DNA is a hemoglobin gene that comprises a mutation, and a second nucleotide sequence that interacts with a site-directed nuclease; (2) a recombinant site- directed nuclease operably linked to a supercharged protein, wherein the site-directed nuclease comprises an RNA-binding portion that interacts with the second nucleotide sequence of the guide RNA and wherein the site-directed nuclease specifically binds and cleaves the target DNA to create a double stranded break; and (3) a single-stranded donor oligonucleotide (ssODN)
- the subject with sickle cell anemia can optionally be a transfusion dependent subject or a subject with at least one silent infarction.
- the subject can also be less than about twelve months, eleven months, ten months, nine months, eight months, seven months, six months, five months, four months, three months, two months, or one month in age.
- infants can be treated before symptoms of the disease manifest.
- the methods provided herein can further comprise diagnosing a subject with a disorder, for example, sickle cell disease.
- cells can be obtained from the subject with the disease or from a related donor.
- bone marrow cells can be obtained or harvested from the subject
- Bone marrow harvesting involves collecting stem cells with a needle placed into the soft center of the bone, the marrow.
- Bone marrow can be harvested for example, from the hip bones or sternum of the subject. From about 500 ml to about 1 liter of bone marrow can be obtained from the subject.
- the cell(s) can be a eukaryotic cell, for example, a human cell.
- the cell can be a germ cell, a stem cell, a precursor cell.
- the precursor cell can be, for example, a pluripotent stem cell or a hematopoietic stem cell.
- pluripotent cells include induced pluripotent stem cells. Methods of making induced pluripotent stem cells and known in the art and described in the Examples.
- the cell can also be CD34+ cell.
- the CD34+ cell can be selected from the group consisting of a primary CD34+ hematopoietic progenitor cell, a CD34+ peripheral blood cell, a CD34+ cord blood cell and a CD34+ bone marrow cell.
- the cell can also be a primary cell, for example, a primary CD34+ hematopoietic progenitor cell.
- the cells are that are not cancer cells, cells that are not tumor cells or cells that are not transformed cells.
- the cell can be in vitro or ex vivo.
- the cells can also be in a pharmaceutically acceptable composition.
- the methods provided herein can further comprise culturing the cells corrected with HDR.
- the cells can be cultured under conditions for expansion or under conditions that promote differentiation of the corrected cells into T-cells.
- the corrected cells can be co-cultured with human bone marrow stromal cells to generate CD34+ cells.
- the CD34+ cells can then be cultured under conditions that differentiate the CD34+ cells into T cells.
- the methods provided herein can further comprise screening the corrected cells for the proper correction, other mutations, or EJ prior to transplantation.
- cells can be screened to detect cells with one or more corrections.
- the cells can be transplanted into the subject after modification, for example, after correction of a mutation by HDR.
- the cells can be transplanted into the subject with or without differentiation.
- modified hematopoietic stem cells HSCs
- HSCs can be administered in a bone marrow transplant, wherein the HSCs are allowed to differentiate and mature in vivo in a subject
- the modified cells can be differentiated into a desired population of cells prior to transplantation.
- transplanting, introducing or administering cells to a subject refers to the placement of cells into a subject.
- the cells described herein comprising a target DNA sequence corrected or modified according to the methods described herein can be transplanted into a subject, by an appropriate route which results in at least partial localization of the transplanted cells at a desired site.
- the cells can be implanted directly to the desired site, or alternatively can be administered by any appropriate route which results in delivery to a desired location in the subject where at least a portion of the implanted cells remain viable.
- the cells can be administered systemically, via intravenous infusion.
- the period of viability of the cells after administration to a subject can be as short as a few hours, e. g. twenty -four hours, to a few days, to as long as several years.
- cells can be autologous cells, i.e., a cell or cells taken from a subject who is in need of modification of a target DNA in the cell or cells (i.e., the donor and recipient are the same individual).
- the modification can be, for example correction of a mutation, insertion of a sequence that inhibits activity of a protein or insertion of a sequence that increases expression of a protein, for example, insertion of a sequence encoding a chimeric antigen receptor that can be used to target cancer cells.
- Autologous cells can be used to avoid immunological reactions that can result in rejection of the cells. In other words, when using autologous cells, the donor and recipient are the same subject.
- the cells can be heterologous, e.g., taken from a donor, preferably a related donor.
- the second subject can be of the same or different species.
- the cells can also be obtained from a xenogeneic source, i.e., a non-human mammal that has been genetically engineered to be sufficiently immunologically compatible with the recipient, or the recipient's species. Any of the methods of treating a disorder described herein can further comprise administering one or more immunosuppressants to the subject.
- a subject In the methods involving transplantation, a subject optionally undergoes
- the myeloablative therapy can include administering one or more doses of chemotherapy, radiation therapy, or both, that results in severe or complete depletion of healthy bone marrow cells.
- the subject can undergo submyeloablative therapy that includes administering one or more doses of chemotherapy, radiation therapy, or both, that depletes a portion of the healthy bone marrow cells.
- the cells can also be transplanted into subjects that have undergone nonablative chemotherapy. For example, the cells can be transplanted into a subject that has been treated with Busulfan, Fludarabine and/or
- an effective dose or amount of corrected cells is administered to the subject.
- effective amount and effective dosage are used interchangeably.
- the term effective amount is defined as any amount necessary to produce a desired physiologic response. In some methods, about 1 X 10 6 to about 7 X 10 6 corrected cells/kg can be administered, but this amount can vary depending on the associated disorder. The percentage of corrected cells that Effective amounts and schedules for administering the cells may be determined empirically, and making such determinations is within the skill in the art.
- the dosage ranges for administration are those large enough to produce the desired effect (e.g., treatment of a disease, for example, sickle cell anemia).
- the dosage should not be so large as to cause substantial adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like.
- the dosage will vary with the age, condition, sex, type of disease, the extent of the disease or disorder, route of administration, or whether other drugs are included in the regimen, and can be determined by one of skill in the art.
- the dosage can be adjusted by the individual physician in the event of any contraindications. Dosages can vary, and the agent can be administered in one or more dose administrations daily, for one or multiple days as needed.
- a subject can be a vertebrate, more specifically a mammal (e.g., a human, horse, cat, dog, cow, pig, sheep, goat, mouse, rabbit, rat, and guinea pig).
- a mammal e.g., a human, horse, cat, dog, cow, pig, sheep, goat, mouse, rabbit, rat, and guinea pig.
- patient or subject may be used interchangeably and can refer to a subject with or at risk of developing a disorder.
- patient or subject includes human and veterinary subjects.
- treatment refers to a method of reducing one or more of the effects of the disorder or one or more symptoms of the disorder, for example, sickle cell disease, by eliciting an immune response in the subject.
- treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%), or 100%) reduction in the severity of sickle cell disease and other disorders.
- a method for treating sickle cell disease is considered to be a treatment if there is a 10%) reduction in one or more symptoms of the infection in a subject as compared to a control.
- the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%), or any percent reduction in between 10%> and 100% as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disorder or symptoms of the disorder.
- a method of correcting a mutation associated with a T-cell disorder comprising introducing into a population of cells obtained from a subject with the T-cell disorder a complex comprising: (a) a guide RNA (gRNA) comprising a first nucleotide sequence that hybridizes to a target DNA in the genome of a cell, wherein the target DNA comprises the mutation associated with the T-cell disorder, and a second nucleotide sequence that interacts with a site-directed nuclease; (b) a recombinant site-directed nuclease operably linked to a supercharged protein, wherein the site-directed nuclease comprises an RNA- binding portion that interacts with the second nucleotide sequence of the gRNA and wherein the site-directed nuclease specifically binds and cleaves the target DNA that comprises the mutation associated with the T-cell disorder to create a double stranded break in the target DNA; and (c) a single stranded donor oli
- the target DNA comprising a mutation associated with a T-cell disorder can be a target DNA that encodes a protein associated with T- lymphocyte development.
- the target DNA can encode JAK3.
- Such corrected cells can be used, for example, in the treatment of SCID.
- the complexes and methods provided herein can also be used to insert functional polypeptides at specific sites in the genome of a cell, such that the polypeptide is expressed by the cell.
- the polypeptide can be expressed in the cell or on the cell surface.
- a method of making tumor-specific T-cell precursor cells comprising introducing into a population of T-cell precursor cells a complex comprising: (a) a guide (gRNA) comprising a first nucleotide sequence that hybridizes to a target DNA in the genome of the T cell precursor cells and a second nucleotide sequence that interacts with a site-directed nuclease; (b) a recombinant site-directed nuclease operably linked to a supercharged protein, wherein the site-directed nuclease comprises an RNA-binding portion that interacts with the second nucleotide sequence of the gRNA and wherein the site-directed nuclease specifically binds and cleaves the target DNA to create a double stranded break; and (c) donor nucleotide sequence comprising a third nucleotide sequence that encodes a chimeric antigen receptor (CAR) and a fourth nucleotide sequence that hybridizes to a genomic sequence
- the T cell precursor cells can be obtained from a subject with cancer.
- the HDR/NHEJ ratio can be from about 10 to about 0.5.
- the HDR/NHEJ ratio can be about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5 or any ratio in between these ratios.
- the efficiency of alteration by HDR can be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80% or any percentage in between these percentages.
- the efficiency of alteration by HDR can also be greater than or equal to about 80%.
- a nucleotide sequence encoding an functional polypeptide for example, a nucleotide sequence that encodes a CAR
- the efficiency of alteration by HDR is about 5%.
- the population of cells can be obtained from the subject that has cancer such that at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%), 65%), 70%), 75%) or 80%> or any percentage in between these percentages, of the cells undergo HDR to insert a nucleotide sequence that encodes a chimeric antigen receptor (CAR) and form cells that express the CAR. In some cases greater than 80%> of the cells from the subject will undergo HDR to correct a mutation associated with the disorder.
- CAR chimeric antigen receptor
- the modified T-cell precursor cells that express the CAR can be transplanted into a subject with cancer.
- cancer is a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
- the modified T-cell precursor cells that express the CAR exhibit anti-tumor immunity when the antigen binding domain binds to its corresponding antigen.
- any subset or combination of these is also specifically contemplated and disclosed. This concept applies to all aspects of this disclosure including, but not limited to, steps in methods using the disclosed compositions. Thus, if there are a variety of additional steps that can be performed, it is understood that each of these additional steps can be performed with any specific method steps or combination of method steps of the disclosed methods, and that each such combination or subset of combinations is specifically
- SCID immunodeficiency
- JAK3 deficiency in humans is characterized by the absence of circulating T cells and natural killer (NK) cells with normal numbers of poorly functioning B cells (T-B+ K-).
- NK natural killer
- T-B+ K- poorly functioning B cells
- HSC hematopoietic stem cell
- iPSCs patient-specific induced pluripotent stem cells
- CRISPR-Cas9 complex CRISPR-Cas9 complex
- iPSCs patient-specific induced pluripotent stem cells
- These corrected iPSCs could optionally be differentiated into hematopoietic progenitors for transplantation into patients to treat the disease (Hanna et al., "Treatment of sickle cell anemia mouse model with iPS cells generated from autologous skin," Science 318: 1920-1923 (2007)).
- J AK3 -deficient human T cells is blocked at an early developmental stage.
- keratinocytes were seeded into one well of a 6- well plate.
- keratinocytes were transduced with 1 mL of virus supernatant and 1 mL of human keratinocyte medium containing polybrene at a final concentration of 4 ⁇ g/mL.
- the keratinocytes were spinfected at 800 x g for 45 minutes (day 1). The transduction procedure was repeated again the next day.
- cells were changed to fresh human keratinocyte medium and cultured for two more days.
- iPSCs were trypsinized and transferred to a 10 cm dish pre-seeded with mitomycin C- treated murine embryonic fibroblasts (MEFs) and cultured in human keratinocyte medium.
- MEFs mitomycin C- treated murine embryonic fibroblasts
- cells were changed to human ES medium and continuously cultured in the same dish for 3-4 weeks.
- ES medium was changed daily.
- Potential iPSC colonies were visible after 2-3 weeks. These colonies were individually picked and expanded on MEFs for analysis.
- iPSCs were infected with a Cre- expressing adenovirus (rAd-Cre-IE). Individual colonies were picked and Cre-mediated removal of floxed sequences was verified by PCR using the primers
- CD34+ cells were then purified on anti- CD34+ magnetic beads (MicroBead Kit; Miltenyi Biotec, Bergisch Gladbach, Germany).
- CD34+ cells were plated onto OP9-DL4 cells and cultured with a-MEM medium containing 20% FBS, 5 ng/mL hFlt3-L, 5 ng/mL hIL-7, and 10 ng/mL hSCF. The medium was changed every other day, and cells were transferred to new OP9-DL4 plates every 4 days.
- CD3 Percp-Cy5-5, clone UCHT1
- CD4 PE-Cy7, clone SK3
- CD7 APC, BV510, clone M-T701
- CD 8 APC-Cy7, clone SKI
- CD16 PE, clone B73.1
- CD25 FITC, clone 2A3
- CD34 PE-Cy7, clone WM59
- CD43 PE, clone 1G10
- CD56- PE clone MY31
- CD69 FITC, clone L78
- NKG2D-PE clone 1D11
- TCR- ⁇ FITC, PE, clone T10B9.1 A-31
- TCR-V51-FITC Fisher Scientific, Pittsburgh, PA, Clone TS8.2
- TCR-V52-PE clone B6
- the Lenti-hDL4- mCherry plasmid was constructed by cloning a PCR-amplified human DL4 cDNA (Open Biosystems, LaFayette, CO), an IRES fragment (Open Biosystems) and mCherry cDNA into a lentiviral vector (pDL171) which contains the EFla promoter. PCR reactions were performed using PrimeStar polymerase (Takara, Mountain View).
- gRNA oligos were designed and introduced into pX330 and pX335 plasmids following the Zhang lab protocol (Addgene, Cambridge, MA).
- Zhang lab protocol Additional protocol
- JAK3 repair plasmid wild type human genomic DNA was PCR amplified using JAK3 primer sets (5' arm:
- agccaccttaattaagccaccatggcgcacgctgggagaacggggtacgata (SEQ ID NO: 11) and reverse: taacagagagaagttcgtggctccggatcccttgtggcccagataggcacccagggtgat (SEQ ID NO: 12)) was used to amplify the human BCL2 cDNA (Open Biosystems) fragment.
- the product was linked with GFP through a 2 A sequence by PCR and cloned into the pDL171 vector.
- gRNA-Fl caccGTG AGA TAC AGA TAC AGA CA (SEQ ID NO: 13) gRNA-Rl aaacTGT CTG TAT CTG TAT CTC AC (SEQ ID NO: 14) gRNA-F2 caccgAAT GAT TTG CCT GGA ATG CC (SEQ ID NO: 14) gRNA-R2 aaacGGC ATT CCA GGC AAA TCA TTc (SEQ ID NO: 15) gRNA-F3 caccgCAG CCT AGG CAA AGG CCT GC (SEQ ID NO: 16) gRNA-R3 aaacGCA GGC CTT TGC CTA GGC TGc (SEQ ID NO: 17) gRNA-F4 caccgTGC CAA CAG AAC TGC CTG AT (SEQ ID NO: 18) gRNA-R4 aaacATC AGG CAG TTC TGT TGG Cac (SEQ ID NO
- IPSCs were cultured on mitomycin C-treated MEFs derived from E14.5 CF-1 embryos in ES cell media consisting of DMEM F-12 supplemented with IX non-essential amino acids, IX penicillin-streptomycin, IX L-glutamine (all from Mediatech, Corning, NY), 20% KnockOut Serum Replacement (Invitrogen), 2- ⁇ (Sigma) and 5-10 ng/mL bFGF (Invitrogen).
- Human primary keratinocytes were cultured in DermaLife K Medium Complete Kit (LifeLine Cell Technology, Frederick, MD).
- OP9 cells were purchased from ATCC and grown in a-MEM medium with 20% FBS and penicillin-streptomycin.
- OP9-DL4 cells were established by transducing OP9 cells with a lenti virus containing hDL4 and mCherry.
- lentivirus For preparation of lentivirus, 10 ⁇ g of the lentiviral vector, 2.5 ⁇ g of the envelope plasmid (pMDG), and 7.5 ⁇ g of the packaging plasmid (pCMBVdR8.9.1) were co-transfected into 5x106 293 T cells by Fugene 6 (Roche, Nutley, NJ or Promega, Madison, WI). Virus- containing supernatant was collected 2 days after transfection and passed through a 0.45 ⁇ filter.
- IPSCs were treated with 0.25% trypsin for 5 minutes to generate single cell suspensions. After washing twice with IX PBS, 1 to 2 million cells were mixed with 5 ⁇ g of JAK3 repair plasmid and 5 ⁇ g of pX330-JAK3 or pX335-JAK3 plasmids for Nucleofection (Human Stem Cell Nucleofector Kit, program A-023, Lonza, Alpharetta, GA) and plating onto MEFs. Two to four days later, hES medium containing 30 ⁇ g/mL of G418 was added to the plates to select for drug resistant colonies. The colonies were picked 3 to 4 weeks later and expanded for genomic DNA extraction. For PCR genotyping, a 5' primer set
- actcctccacctttgacgct (SEQ ID NO: 28), R: tcccctcttcaagggtctacatg (SEQ ID NO: 29)); PU.
- l (F: gtgcaaaatggaagggtttc (SEQ ID NO: 30), R: ggagctccgtgaagttgttc (SEQ ID NO: 31)); GATA3 (F: tgtttcctttcactggccaca (SEQ ID NO: 32), R: aacggcaactggtgaacggta (SEQ ID NO: 33)); BCL1 IB (F: ggcgatgccagaatagatgccg (SEQ ID NO: 34), R:
- RAG1 F: ccttactgttgagactgcaatatcc (SEQ ID NO: 36), R: ctgaagtcccagtatatacttcacac (SEQ ID NO: 37)
- RAG2 F:
- cccagaagcagtaataatcatcgag (SEQ ID NO: 38), R: atgtgggatgtagtagatcttgc (SEQ ID NO: 39)); pTa (F: gggtcttacctcagcagttac (SEQ ID NO: 40), R: cctcacagtgtgacgcag (SEQ ID NO: 41)); BCL2 (F: gactgagtacctgaaccggc (SEQ ID NO: 42), R: gggccaaactgagcagagtc (SEQ ID NO: 43)); BAX (F: aagaccagggtggttgggac (SEQ ID NO: 44), R: gtaagaaaatgcccacgtc (SEQ ID NO: 45)); and JAK3 (F: agtcagacgtctggagcttc (SEQ ID NO: 46), R::
- DNA from iPSCs was sheared using a Covaris S2 Focused-ultrasonicator: 130 uL samples in microTUBEs were subjected to two 40-second cycles of 10% Duty Cycle, Intensity of 4, and 200 Cycles per Burst in Frequency Sweeping Mode.
- DNA Chip (DNA 1000 Kit; Agilent Technologies, Santa Clara, CA) analysis using an Agilent 2100
- Bioanalyzer indicated an average fragment size of 400 bp.
- Library preparation was performed using an NEBNext Ultra DNA Library Prep Kit for Illumina (NEB #E7370), and the final library concentration was determined by qPCR using a KAPA Illumina Library
- Sequencing clusters were produced on the flow cell using an Illumina TruSeq PE Cluster Kit v3 - cBot - HS (PE-401- 3001) and an Illumina cBot. WGS was performed using an Illumina TruSeq SBS Kit v3 - HS - 200 cycles (FC-401-3001) and an Illumina HiSeq 2500 upgrade to generate 2x100 single- index paired-end reads for bioinformatic analysis.
- Probable off -target sites were identified by aligning the CRISPR/Cas9 guide sequences to the hgl9 reference genome using EMBOSS fuzznuc software (v6.6.0.0) (Rice et al., "EMBOSS: the European Molecular Biology Open Software Suite," Trends in Genetics : TIG 16: 276-277 (2000)) and allowing for a maximum of three mismatches; 1193 sites were predicted for the first guide sequence
- JAK3 C1837T (p.R613X) mutation was also not validated to associate with a disease, though the SNP (rsl49316157) is predicted to be significantly deleterius, with a GERP score of 3.85 and a CADD score (CADD phred-like score) of 38. Therefore, the JAK3 C1837T variant was associated for the first time with a clinical case of SCID.
- the WGS data can be accessed at the NCBI SRA database with the accession number SRP056149. JAK3-deficient human T cells express low levels of BCL2 and die at an early developmental stage
- IPSCs were generated from skin keratinocytes (Chang et al., 2009) of a SCID patient homozygous for a C>T nucleotide substitution in exon 14 of the JAK3 gene. This mutation replaces a CGA codon (arginine at 613) with a TGA stop codon (p.R613X). As described above, the four-month-old patient presented with a T-B+ K- clinical phenotype. To determine whether this SCID phenotype can be recapitulated in vitro, differentiation of patient-specific iPSCs to T lymphocytes using a two-step OP9 and OP9-DL4 system (Chang et al., 2014) was attempted.
- JAK3 -deficient iPSCs grew at a rate comparable to control iPSCs derived from healthy donors, and these iPSCs efficiently differentiated into CD34+ hematopoietic progenitors (HPs) on OP9 stromal cell monolayers.
- HPs hematopoietic progenitors
- iPSC-derived CD34+ HPs were plated on OP9-DL4 stromal monolayers, T- cell differentiation was absent compared to controls (Fig. 1).
- No CD3+ T cells or CD3- CD16+CD56+ NK cells were observed (Fig. lA), and no CD4+CD8+ double positive (DP), CD4+ single positive (SP), or CD8+ single positive (SP) T cells were detected (Fig. IB).
- Jak3 knockout mice have a small thymus due to a block in thymocyte differentiation at the CD4-CD8- double negative (DN) stage prior to productive TCR rearrangement.
- DN double negative
- T lineage commitment and maturation of J AK3 -deficient cells compared to normal JAK3 WT controls was assayed.
- IPSC-derived CD34+ cells were plated on OP9-DL4 monolayers, and cells were harvested and analyzed for lymphocyte markers at T-cell induction day (TD) 14, 21, 28 and 35 (Fig. 4A).
- the CD4-CD8- (DN) to CD4+CD8+ (DP) stages are directed by precise activation and repression of specific transcription factors.
- ETPs early T cell progenitors
- the silencing of PU.1 and induction of GATA3 and BCL1 IB suggest that these cells proceed to the onset of T lineage commitment (DN2 to DN3) followed by TCR rearrangement.
- DN2 to DN3 T lineage commitment
- JAK3 -deficient cells PU. l accumulates and GATA3 and BCL1 IB levels are reduced (Fig. 1C).
- JAK3 -deficient cells arrest before or at the DN2 stage, which is similar to the stage at which T cells die in Jak3 KO mice.
- human JAK3 -deficient cells may express sufficient RAG 1, RAG2 and PTCRA (Fig. 1C) to perform TCR rearrangement, but the cells do not survive long enough to proceed to this important developmental stage.
- RAG 1, RAG2 and PTCRA Fig. 1C
- IL-7/JAK3 signaling maintains thymocyte homeostasis by regulating the BCL2 family of apoptotic regulators.
- Thymocytes and peripheral T cells from Jak3 KO mice have a high apoptotic index in part through selectively elevating B AX, a pro-apoptotic factor, and by reducing expression of BCL2, an anti-apoptotic factor.
- BCL2 a pro-apoptotic factor
- CD34+ cells were plated on OP9-DL4 monolayers and assayed for NK and T cell markers at TD 28.
- No CD3-CD16+CD56+ NK cells were found in GFP- (JAK3-; BCL2 low) or GFP+ cells (JAK3-; BCL2+) (Fig 2C).
- BCL2 released the blockage at the DN stage in JAK3 -deficient cells.
- a second developmental arrest was evident at the DP stage; no further differentiation of CD8+CD4+ DP positive cells was observed in GFP+ cells (Fig 2C).
- the studies described above demonstrate that human SCID phenotypes can be recapitulated in vitro with patient-derived iPSCs.
- JAK3 deficiency results in proliferative defects in DN thymocytes. Forced expression of BCL2 enhances survival of DN cells, which further differentiate into DP thymocytes. Nevertheless, DP thymocytes fail to mature to SP T cells, and this defect may result from the absence of IL7/JAK3 signaling. Correction of the JAK3 deficiency in SCID hiPSCs by CRISPR/Cas9 enhanced gene replacement
- the JAK3 mutation was corrected in iPSCs by CRISPR/Cas9 enhanced gene replacement.
- Six guide RNAs within introns upstream and downstream of exon 14 were designed to target wtCas9 or nCas9 near the C1837T mutation, and a correction template was used for gene replacement (Fig. 3 A).
- IPSCs were nucleofected with two plasmids expressing the D10A Cas9 nickase and paired guide RNAs or a single plasmid expressing wild-type Cas9 and a single guide RNA. Cells were grown in medium containing G418 for 2 weeks post nucleofection.
- FIG. 3C Three clones from WT Cas9 + gRNA #1, 3 clones from WT Cas9 + gRNA #2 and 6 clones from Cas9 nickase + paired gRNAs #1 and #2 were further verified by Sanger sequencing. In 12 sequenced clones, 2 homozygous corrected clones (1 clone from Cas9 nickase + paired gRNA #1 and #2, and 1 clone from WT Cas9 + gRNA #1) and 10 heterozygous corrected clones were identified (Fig. 3D). Restoration of JAK3 gene expression was demonstrated by RT-PCR (JAK3 mRNA) (Fig. 3B; lower left panel) and western blot (JAK3 protein) (Fig. 3B; lower right).
- CRISPR/Cas9 directed genome modifications raises some concerns about the use of this approach for therapy in humans.
- cancer cell lines relatively high levels of off-target mutagenesis by Cas9-gRNAs have been described.
- CRISPR/Cas9 directed JAK3 correction in human SCID iPSCs Whole genome sequencing was performed before and after gene replacement. The genomes of two heterozygous and one homozygous corrected clones were sequenced. The two heterozygous clones were corrected with gRNA #2 + wild type Cas9, and the homozygous clone was corrected with gRNA #1 + gRNA #2 + nickase Cas9 (D10A).
- the 20-base CRISPR guide sequences were mapped to the human reference genome, allowing up to 3 mismatches in order to identify possible off-target sites. These sites were then analyzed for variations in the iPSC samples following CRISPR/Cas9 directed gene replacement. WGS analysis of one homozygous and two heterozygous corrected iPSC lines demonstrated that no mutations (SNVs nor indels) were introduced into the predicted off-target sites, suggesting a strong specificity for the CRISPR/Cas9 directed gene replacement. Restoration of T cell development after CRISPR/Cas9 directed JAK3 correction
- T cell lineage commitment and maturation were assayed. T cell differentiation sequentially passes through intermediates observed in vivo: CD34+CD7+ T/NK committed stage;
- Mature T cells are polyclonal, proliferate, and secrete cytokines in response to mitogens. Therefore, JAK3 corrected hiPSCs were differentiated into
- hematopoietic progenitors on OP9 monolayers were positively selected on anti-CD34 magnetic beads. These cells were plated on OP9-DL4 monolayers, and nonadherent cells were analyzed for lymphocyte markers at TD14, 21, 28 and 35 (Fig. 4). Similar to control cells, 1-2 X 106 CD34+ JAK3 corrected cells differentiated into 4.7 X 106 CD7+ cells (91% of cells counted in lymphoid gate) at TD14. After further, 1-2 X 106 CD34+ JAK3 corrected cells differentiated into 4.7 X 106 CD7+ cells (91% of cells counted in lymphoid gate) at TD14.
- T cell maturation markers CD3, CD4, CD8 and TCR ⁇ were abundantly observed (Fig. 4A).
- TCR ⁇ typing was performed by flow cytometry and summarized in Figure 4B. JAK3 -corrected T cells expressed all the ⁇ segments that we tested (19 of 25); therefore, a broad TCR repertoire was restored.
- the integrity of the TCR signaling pathway, a surrogate of T cell function, in JAK3 -corrected T cells was examined by measuring cell surface activation markers following anti-CD3/CD28 stimulation.
- Corrected progenitors are capable of producing NK cells and mature T cell populations expressing a broad TCR repertoire.
- CD34+ HSCs can be generated from hiPSCs by co- culturing with human bone marrow stromal stem (hMSC) cells (See Figure 5).
- the HSCs produced by this method from patient-specific iPSC after gene correction/modification could be transplanted back into the patient to treat diseases such as sickle cell disease (SCD), SCID or cancer.
- T cells can be generated by culturing hiPSC derived CD34+ cells by co-culturing the hiPSC derived CD34+ cells with hMSC-DL4 (See Figure 6). HSCs produced by this method from patient-specific iPSC after
- the T cells can comprise ⁇ T cells.
- ⁇ T cells expressing recombinant T cell receptor (TCR) can be efficiently produced from genetically modified iPSC. Production of ⁇ T cells expressing TCR specific for tumor antigens provide a cellular therapy for cancer.
- hemagglutinin HA-2 variant peptide INF7 (GLFEAIEGFIENGWEGMIDGWYG)(SEQ ID NO: 50) was codon optimized for E. coli and synthesized (IDT DNA) and cloned to fuse with the C-terminus of the nls-Cas9-nls.
- An HIV-TAT peptide (YGRKKRRQRRRPPQ) )(SEQ ID NO: 51) coding sequence was also synthesized (IDT DNA) and cloned to fuse with the N- terminus of the nls-Cas9-nls.
- the pET-SUMO-scCas9 plasmid was transformed into E. coli strain RosettaTM
- 2(DE3) cells EMD Millipore, Billerica, MA
- the cells were grown at 37°C until the optical density reached 0.6 at 600nm.
- Induction of protein overexpression was achieved by adding 0.5 mM isopropyl-l-thio-B-D-galactopyranoside (IPTG) and culturing overnight at 18°C in a shaker.
- IPTG isopropyl-l-thio-B-D-galactopyranoside
- the harvested cells were re-suspended in Ni -binding buffer (20mM Tris-HCl pH 8.0, 1.5 M NaCl, 25 mM imidazole and 0.2 mM TCEP) and lysed by Emulsiflex C3 high pressure homogenizer (Avestin).
- Polyethyleneimine (PEI) with final concentration of 0.4% was added into the cleared lysate to precipitate the nucleic acids.
- the proteins in the supernatant after centrifugation was then precipitated by ammonium sulfate to remove the PEI and re-dissolved in the Ni-binding buffer.
- the proteins were first purified by a HisTrap nickel affinity column (GE Healthcare) followed by overnight digestion with SUMO protease Ulpl at 4°C. The cleaved His-SUMO tag was then removed via a second HisTrap column.
- the flow though containing the scCas9 protein was diluted to reach the final NaCl concentration of 0.5 M and purified on a Hi Trap Heparin column (GE Healthcare) by gradient elution with buffer containing 20mM Tris-HCl pH 8.0, 2.0 M NaCl, and 0.2 mM TCEP.
- the eluted scCas9 protein was further purified by a size exclusion column Superdex 200 16/600 (GE Healthcare) in gel filtration buffer (20mM Tris-HCl pH 8.0, 0.5 M NaCl, and 0.2 mM TCEP), sterilized by passing through a 0.22 ⁇ filter and concentrated by an Amicon Centrifugal Unit (EMD Millipore) with 100 kDa cutoff.
- the concentrated protein was quantified by UV spectrophotometer and flash frozen in liquid nitrogen.
- Template DNA for sgRNA transcription was generated by PCR with primer set adding a T7 promoter and a polyA sequences.
- sgRNA was in vitro transcribed by T7 RNA polymerase using T7 Ribomax Express System (Promega, Madison, WI) according to the manufacturer's manual.
- the transcribed RNA was purified by phenol: chloroform extraction, ethanol precipitation and followed by column purification with MEGAclearTM Transcription Clean-Up Kit (Ambion, Austin, TX).
- the purified gRNA was quantified by UV
- Single-stranded DNA (ssODN) donors were synthesized by IDT DNA.
- Single-stranded Donor DNAs for HBB sickle correction were synthesized by IDT DNA.
- HBB-T2-ssODN ATCCACGTTCACCTTGCCCCACAGGGCAGTAACGGCAGACTTCT
- HBB-T2-SSODN- CTTCATCCACGTTCACCTTGCCCCACAGGGCAGTAACGGCAGAtT wobble TtTCCtCAGGAGTCAGGTGCACCATGGTGTCTGTTTGAGGTTGCT
- Human sickle patient iPSC were derived from skin fibroblasts and were maintained on Matrigel (BD) in mTeSRTMl medium (Stem Cell Technologies, Vancouver, CA) with penicillin/streptomycin.
- scCas9 protein was added into the sgRNA with a 1 : 1.5 protein-to- RNA molar ratio and mixed quickly by tapping the tube until all the transient precipitation was gone. The mixture was incubated in room temperature for 10 minutes in dark. Then, 1 molar ratio amount of ssODN was added into the mixture and incubated for additional 10 minutes in dark to form the scCas9-sgRNA-ssODN complex.
- the cells nucleofected with the scCas9-sgRNA-ssODN complex were lysed by
- the program for PCR was : Step 1 : 95°C 10 min; Step 2: 95°C 30s; Step 3 : 55°C 1 min; repeat steps 2-3 for 39 times; Step 4: 98°C 10 min; Step 5: 8°C hold. After PCR was done, the plate was then analyzed by QX200 Droplet Reader (Bio-rad).
- a complex that includes a guide RNA (gRNA), modified recombinant Cas9 protein (mrCas9) and a single-stranded oligodeoxyribonucleotide
- ssODN can be introduced into human stem cells or derivatives thereof to correct a single base mutation that causes disease.
- Table 1 and Figure 8 illustrate results from the introduction of a sickle cell correction complex (gRNA-mrCas9-ssODN) into induced Pluripotent Stem Cells (iPSC) derived from skin cells of a sickle cell patient.
- IPSCs were derived as described in Example 1.
- the correction complex was introduced into sickle iPSC by nucleoporation and 2 days later genomic DNA was analyzed by digital PCR, using the primers set forth above, and sequenced. Over 65% of the cells contained at least one corrected gene. One corrected gene is sufficient to cure the disease. The results were confirmed as follows.
- iPSCs have the potential to generate all cell types including HSPCs (human stem/progenitor cells); therefore, iPSC based gene therapy could provide a curative therapy for sickle cell disease.
- Correction of sickle iPSCs can provide an unlimited number of cells from which to generate corrected HSPCs, and these corrected HSPCs can be used for autologous transplantation.
- corrected iPSCs and the HSPCs derived from them can be fully characterized and evaluated for safety before transplantation. Described below is CRISPR/Cas9 enhanced gene correction of iPSCs derived from fibroblasts of a sickle patient.
- Human sickle iPSCs were derived from fibroblasts of a skin biopsy obtained from a consented sickle patient at the UAB Kirklin Clinic. The cells were maintained on Matrigel (BD) in mTeSRTMl medium (Stem Cell Technologies) with penicillin/streptomycin. Human sickle iPSCs were passaged every 3-4 days by incubating colonies with Accutase (Stem Cell Technologies), and single cells were seeded on Matrigel coated plates with 10 ⁇ Rock inhibitor (Y-27632) (EMD Millipore). After one day, the media was changed with no rock inhibitor.
- Bone marrow from a consented sickle patient was aspirated in the adult sickle clinic at UAB.
- the CD34+ cells were purified on anti-Cd34+ beads, aliquoted and stored in liquid nitrogen.
- the S. pyogenes Cas9WT coding sequence with both N-terminal and C-terminal fused nuclear localization sequences were PCR cloned from the px330 vector (Addgene ID: 42230) into a modified pET-28b (EMD Biosciences) vector with a His 6 -SUMO tag at the N-terminus, resulting in a pSUMO-Cas9WT plasmid.
- a synthesized gene block (IDT DNA) containing the E. coli codon optimized coding sequence of supercharged GFP with a net positive charge of +36 (Lawrence et al.
- the coding sequence of a HIV-TAT peptide (YGRKKRRQRRRPPQ)(SEQ ID NO: 51) was synthesized, ligated with the C-terminus of Cas9WT-36GFP and cloned, resulting in the pSUMO-TAT-Cas9WT-36GFP vector.
- the coding sequence of a HIV-TAT peptide was (YGRKKRRQRRRPPQ)(SEQ ID NO: 51) synthesized, ligated with the N-terminus of nls-Cas9WT-3xTAT and cloned, resulting in a pSUMO-TAT-Cas9WT-3xTAT plasmid.
- the Cas9WT or Engineered positively charged Cas9 (EpcCas9) expression plasmid was transformed into the E. coli strain RosettaTM 2(DE3) cells (EMD Millipore) in LB medium. The cells were grown at 37°C until the optical density reached 0.6 at 600nm.
- IPTG isopropyl-l-thio-B-D- galactopyranoside
- IPTG isopropyl-l-thio-B-D- galactopyranoside
- the harvested cells were re-suspended in Ni-binding buffer (20mM Tris-HCl pH 8.0, 1.5 M NaCl, 25 mM imidazole and 0.2 mM TCEP) and lysed with a Emulsiflex C3 high pressure homogenizer (Avestin).
- PEI Polyethyleneimine
- the protein solution was first purified by a HisTrap nickel affinity column (GE Healthcare, Atlanta, GA) followed by overnight digestion with SUMO protease Ulpl at 4°C. The cleaved His-SUMO tag was then removed by passing through a second HisTrap column. The flow through containing the Cas9 protein was diluted to reach a final NaCl concentration of 0.5 M and purified on a HiTrap Heparin column (GE Healthcare) by gradient elution with buffer containing 20mM Tris-HCl pH 8.0, 2.0 M NaCl, and 0.2 mM TCEP.
- the eluted Cas9 protein was further purified by a size exclusion column Superdex 200 16/600 (GE Healthcare) in gel filtration buffer (20mM Tris- HC1 pH 8.0, 0.5 M NaCl, and 0.2 mM TCEP), sterilized by passing through a 0.22 ⁇ filter and concentrated by an Amicon Centrifugal Unit (EMD Millipore) with a 100 kDa cutoff.
- the concentrated protein was quantified by UV spectrophotometer, flash frozen in liquid nitrogen and stored at -80°C.
- the DNA template for sgRNA in vitro transcription was generated by PCR with primers adding a T7 promoter at 5' end and a polyA sequence at the 3' end.
- the sgRNAs was in vitro transcribed by T7 RNA polymerase using a T7 Ribomax Express Kit (Promega) according to the manufacturer's manual.
- the transcribed RNA was then isolated by phenol: chloroform extraction, ethanol precipitation and column purification with the MEGAclearTM Transcription Clean-Up Kit (Ambion).
- the sgRNA was eluted in nuclease free water, and the concentration was measured by UV spectrophotometer.
- the stock sgRNA was then aliquoted and stored in a -80°C freezer.
- sgRNA Before complexing with Cas9 protein, 1 Ox PBS was added into the stock sgRNA solution to reach lx PBS final salt concentration. The sgRNA was annealed on a thermo- cycler by slowly decreasing the temperature from 95°C to 4°C. To form Cas9 RNP, stock Cas9 protein was added to the annealed sgRNA at a 1 : 1.5 protein:RNA molar ratio and mixed thoroughly by quickly tapping the tube until all the transient precipitation was gone. The mixture was incubated at room temperature for 10 minutes in the dark. Subsequently, ssODN was added at a 1 : 1 molar ratio with Cas9 RNP for nucleoporation.
- Cas9 RNP/ssODN nucleoporated cells were lysed by prepGEM Tissue DNA extraction reagent (ZyGEM) following the manufacturer's manual and the cell lysate was diluted 1 :3 with water.
- ZyGEM prepGEM Tissue DNA extraction reagent
- 11 ⁇ 2 x ddPCR mix Bio-Rad
- lul each of 5 ⁇ allele-specific FAM or VIC Taqman probes 0.2 ⁇ each of a 100 ⁇ forward and reverse primer, and 8.6 ⁇ diluted cell lysate.
- Droplets were generated by a QX200 Droplet Generator (Bio-Rad) according to the manufacturer's instructions.
- the reaction mix was then transferred into a 96-well PCR plate, and PCR was performed on a standard thermal cycler (Bio-Rad).
- the program for PCR was: Step 1 : 95°C 10 min; Step 2: 95°C 30s; Step 3 : 55°C lmin; repeat steps 2-3 for 39 times; Step 4: 98°C lOmin; Step 5: 8°C hold.
- the plate was analyzed on a QX200 Droplet Reader (Bio-Rad).
- Cas9 RNP/ssODN nucleoporated sickle iPSCs were seeded in BD matrix gel coated 96-well plates after serial dilution to a density of 20, 10 and 5 cells/well.
- Fresh mTesRl media with 10 ⁇ rock inhibitor was changed every 2 days during the first 6 days of culture.
- mTesRl media without rock inhibitor was changed every day after day 6.
- nucleoporation On the day of nucleoporation, 5xl0 5 live CD34+ cells were rinsed with lxPBS and harvested by centrifugation at 150g for 15 mins. The cell pellet was resuspended in 100 ⁇ P4 primary cell nucleofection solution (Lonza) and 15 ⁇ of Cas9 R P/ssODN complex was mixed with the cell suspension in the nucleoporation cuvette. The cells were nucleoporated with program DN-100 using a 4D-Nucleofector (Lonza) and transferred into pre-warmed media immediately. The efficiency of gene correction was analyzed 6 days after nucleoporation.
- CFU Erythroid Colony forming Unit
- CD34+ cells were seeded into
- Methocult media Stem Cell Technologies
- a density of 500-1000 cells/mL in 35mm tissue culture plates Cells were grown in a 37°C incubator with 5% C0 2 for 12-15 days until the colonies were large enough to pick individually for analysis.
- InM ⁇ -Estradiol 20ng /mL human SCF, and 5ng /mL human IL-3.
- the media was changed every 2 days. After the first 7 days of expansion and differentiation, the media were supplemented with a higher concentration of EPO (2 u/raL) until differentiated RBCs are harvested at day 15-18.
- T7-T2F TAATACGACTCACTATAGGGTAACGGCAGACTTCTCCAC (SEQ ID NO: 54)
- T7-R A A A AGC AC CGAC TC GGTGC C (SEQ ID NO: 55)
- T7-T1F TAATACGACTCACTATAGGGTCTGCCGTTACTGCCCTG (SEQ ID NO: 65)
- T7-R A A A A AGC AC CGAC TC GGTGC C (SEQ ID NO: 55)
- R158 AGTAGCAATTTGTACTGATGGTATG (SEQ ID NO: 67)
- EpcCas9 RNPs/ssODN Engineered positively charged Cas9 RNPs/ssODN (EpcCas9 RNPs/ssODN) efficiently correct the sickle mutation in human patient iPSC (induced Pluripotent Stem Cells)
- Cas9WT/T2 RNP Cas9WT-EGFP/T2 or 8 different EpcCas9/T2 RNPs (Engineered positively-charged Cas9/T2 RNPs) together with a 91-nt ssODN correction template (SEQ ID NO: 51).
- Cas9/T2 RNPs induce a double strand break near (2 bp downstream) the sickle mutation. The proximity of the cut site to the mutation enhances HDR of the sickle mutation (T->A) using the 91-nt ssODN correction template.
- On-target Sanger sequencing data for the population of iPSCs demonstrate correction of the sickle mutation at high efficiency in Cas9WT RNP/ssODN nucleoporated cells (Fig 11).
- the addition of an EGFP (Enhanced Green Fluorescent Protein) domain at the C-terminus of Cas9WT did not affect the level of correction.
- EpcCas9s with both N-terminal and C-terminal positively charged modifications produce significantly less indels.
- TAT-Cas9WT-36GFP -INF7 a negatively charged INF7 peptide to the C-terminus of TAT-Cas9WT-36GFP.
- TAT-Cas9WT-36GFP -INF7 a negatively charged INF7 peptide to the C-terminus of TAT-Cas9WT-36GFP.
- Sanger sequencing results were verified by deep sequencing analysis of on-target correction and indels for iPSC populations after nucleoporation with Cas9WT and selected EpcCas9 RNPs (Fig. 12).
- EpcCas9 RNPs suppress on-target indels in human sickle iPSC
- RNPs/+ssODN vary with different positively charged modifications (Fig. 14), indel formation is suppressed by all positively charged Cas9 modifications.
- EpcCas9 RNPs enhance cell survival after nucleoporation in human sickle iPSC
- ssODN Cas9 RNP ratios for sickle correction in human iPSC
- the ratio of ssODN correction template to Cas9 RNP is critical important for FIDR and cell survival.
- Single stranded ODN is toxic to cells; therefore, high ssODN:Cas9 RNP ratios may result in poor cell survival after nucleoporation.
- low ssODN:Cas9 RNP ratios may result in inefficient HDR.
- ssODN:Cas9 RNP ratios were optimized. The efficiency of sickle mutation correction with increasing doses of ssODN in sickle patient iPSC was determined.
- ddPCR digital droplet PCR
- the optimal Cas9:sgRNA molar ratio is 1 : 1.
- Saturation of the Cas9 protein with sgRNA ensures maximal Cas9 enzymatic activity and reduces the possibility of free Cas9 interactions with other small RNAs that may produce unpredictable off -target genome modifications.
- Small RNAs are sensitive to nucleases; therefore, molar ratios of Cas9: sgRNA greater than 1 : 1 may be necessary to saturate Cas9.
- Cas9-36GFP sgRNA molar ratios of 1 : 1.15, 1 : 1.35 and 1 : 1.5 were tested with ssODN molar ratios of 1.15 or 1.35 to determine optimal correction efficiency of the sickle mutation in patient iPSC. Sanger sequencing results and cell survival analyses demonstrated that optimal correction
- sgRNA ssODN molar ratio of 1 : 1 :35: 1.15 (Fig. 17).
- Human sickle iPSC were nucleoporated with TAT-Cas9WT-36GFP-INF7:T2 sgRNA: ssODN at a molar ratio of 1.0: 1.35: 1.0 to investigate the correction efficiency in cell populations (Fig. 18) and, subsequently, at a single cell level (Table 3).
- nucleoporated iPSCs were plated in a 96-well plate after serial dilution. Two weeks later, single iPSC colonies were picked, genomic DNA isolated, and Sanger sequencing performed. Forty-three single iPSC colonies were analyzed for on-target modifications. Table 3 summarizes the Sanger sequencing results for these iPSC clones.
- iPSC containing at least one corrected allele will produce red blood cells that do not sickle.
- Genome-editing events were also assessed at the allele level for these iPSC clones. Forty-two of 86 alleles (48.8%) were corrected, 28 of 86 alleles (32.6%) contained indels and 16 of 86 alleles (18.6%) were unmodified. This high rate of genome modification (81.4% of alleles and 93% of cells) demonstrates highly efficient gene targeting with the biochemical complex is possible.
- FIDR based gene correction Compared to plasmid or viral delivery, the risk of retargeting for Cas9 RNP is low due to the RNPs short half-life; however, retargeting is difficult to avoid completely.
- the sickle mutation is located within the T2 sgRNA targeting sequence and is only 2 base pairs from the PAM. After correction with the ssODN, the corrected DNA contains a 1 base mismatch with the sgRNA target sequence. This difference reduces but does not eliminate retargeting.
- One strategy to prevent retargeting is to introduce wobble base changes into the correction template.
- CD34+ HSPCs were obtained from bone marrow of a consenting sickle cell patient.
- Sickle CD34+ cells were purified on anti-CD34 beads, and the cell cycle was activated by culture for 2 days in media with specific cytokines (SCF, TPO and FLT-3). Subsequently, the cells were nucleoporated with Cas9WT, Cas9-36GFP or TAT-Cas9-3xTAT plus T2 sgRNA and ssODN.
- the efficiency of sickle correction was determined 6 days after nucleoporation by the Sanger sequencing (Fig 21 A). The highest correction efficiency was obtained with Cas9WT; however, indel frequency was high. Although the correction efficiency with the 2 EpcCas9 RNPs was lower than with Cas9WT, the frequency of indels was dramatically lower.
- EpcCas9 RNPs enhance the correction/indel ratio in sickle patient bone marrow CD34+ HSPCs
- CD34+ progenitors In addition to examining correction of the sickle mutation in populations of patient bone marrow CD34+ cells, we analyzed colonies derived from single CD34+ progenitors. After nucleoporation with TAT-Cas9WT-36GFP-INF7, CD34+ cells were mixed with semisolid MethoCult media and plated into dishes. Two weeks after plating, colonies derived from single cells were isolated, DNA was extracted and Sanger sequence performed. The colonies that we examined were BFU-E (Burst Forming Units-Erythroid), CFU-E (Colony Forming Units-Erythroid) and CFU-GEMM (Colony Forming Units-Granulocyte,
- Figure 11 illustrates typical BFU-E and CFU- GEMM colonies (A) and representative Sanger Sequencing results of the six genotypes that were obtained (B).
- Table 5 summarizes of the Sanger sequencing results from 95, 96, and 96 colonies (BFU-E, CFU-E and CFU-GEMM) obtained after nucleoporation of Cas9WT, Cas9WT-36GFP, and TAT-Cas9WT-3xTAT RNPs and ssODNs, respectively.
- the highest correction efficiency was obtained with Cas9WT (51.6%); however, indel/indel frequency in cells treated with Cas9WT was also very high (40.0%).
- Cas9WT-36GFP that has a correction/indel ratio of 3.39 is our preferred EpcCas9.
- Table 5 Summary of the Sanger sequencing results from 95, 96, and 96 colonies (BFU-E, CFU-E and CFU-GEMM) obtained after nucleoporation of human sickle patient bone marrow CD34+ HSPC with Cas9WT, Cas9WT-36GFP, and TAT-Cas9WT-3xTAT RNPs and ssODNs, respectively.
- Cas9WT RNP Cas9WT-36GFP RNP TAT-Cas9WT-3xTAT RNP
- RNP/ssODN complex (28.1% of total CFU; 25% of CFU-GEMM) is high enough to cure the disease. This level of correction in the bone marrow after transplantation would result in 60- 70%) corrected RBC in peripheral blood. In addition, only 8.3%> of colonies are homozygous indels (indel/indel); therefore, thalassemia is unlikely to result after transplantation.
- EpcCas9 RNPs enhance cell survival after nucleoporation in sickle patient bone marrow CD34+ HSPCs
- Fig. 22C demonstrate that EpcCas9 RNPs enhance cell survival after nucleoporation in sickle patient bone marrow CD34+ HSPCs.
- the number of erythroid colonies (BFU-E and CFU-E) obtained after nucleoporation of sickle patient bone marrow CD34+ HSPCs was compared with Cas9WT, Cas9WT-36GFP, and TAT-Cas9WT-3xTAT RNPs plus ssODNs.
- the number of colonies obtained with Cas9WT RPN/ssODN was normalized to 1.
- ssODNs oligodeoxynucleotides
- CD34+ HPSCs are critical for bone marrow reconstitution after transplantation.
- two million CD34+ cells/kg are transplanted into human recipients. Cell doses below this level result in poor long-term reconstitution.
- a 75kg patient requires a dose of approximately 150 million cells.
- One liter of bone marrow can be harvested from a 75kg patient under anesthesia and approximately 200 million CD34+ cells can be isolated for transplantation.
- 2.5-fold fewer cells are obtained after nucleoporation of CD34+ cells with Cas9WT RNP/ssODN compared to Cas9-36GFP RNP/ssODN. Therefore, our preferred complex for correction is Cas9WT-36GFP RNP/ssODN.
- EpcCas9 results in higher genome editing specificity
- Indel reads 6 33 37 7 240
- Non-indel reads 189683 777630 615613 482843 207613
- Non-indel reads 193690 843834 685044 458625 199515
- RNPs nucleoporated cells contain non-specific modifications.
- Figure 25 shows an isoelectric focusing (IEF) gel analysis of blood six weeks after primary transplantation of Sickle Mouse Fetal Liver c-Kit+ cells nucleoporated with Cas9
- FIG. 26 shows ddPCR analysis of F ACS purified bone marrow cells at twelve weeks post-transplantation into irradiated C57B16 mice. Twelve
- HSCs Correction levels in B and T cells should rise to approximately 50% after secondary transplantation at twelve weeks (twenty-four weeks total). After twenty-four weeks, most if not all hematopoietic cells will be derived from long-term HSCs.
- Figure 27 shows IEF gel analysis of the blood in mice twelve weeks after primary transplantation and six weeks after secondary transplantation of cells nucleoporated with Cas9 RNP/ssODN to correct a sickle cell mutation.
- Human HbA is produced in mice after transplantation of HSCs nucleoporated with Cas9 RNP/ssODN to correct a sickle cell mutation. The mouse hemoglobin band will disappear in six more weeks.
- Cas9-supercharged GFP construct mdykdhdgdykdhdidykddddkmapkkkrkvgihgvpaadkkysigldigtnsvgwavitdeykvpskkfkvlgntdrh sikknligallfdsgetaeatrlkrtamytrrknricylqeifsnemakvddsffhrleesflveedkkherhpifgnivdevayhek yptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdnsdvdklfiqlvqtynqlfeenpinasgvdakailsarlsksrrl enliaqlpgekknglfgnlialslgltpnfksnfdlaedaklqlsk
- TAT-Cas9-supercharged GFP construct ygrkkI ⁇ qrr pqaggsmdykdhdgdykdhdidykddddkmapkkkrkvgihgvpaadkkysigldigtnsvgwavitd eykvpskkfkvlgntdrhsikknligallfdsgetaeatrlkrtaiTiytrrknricylqeifsnemakvddsffhrleesfl erhpifgnivdevayhekyptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdnsdvdklfiqlvqtynqlfeenpin asgvdakailsarlsksrrlenliaqlpgekknglfgnlialslgl
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Developmental Biology & Embryology (AREA)
- Mycology (AREA)
- Analytical Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Diabetes (AREA)
- Crystallography & Structural Chemistry (AREA)
- Pathology (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16812552.4A EP3310932B1 (en) | 2015-06-17 | 2016-06-17 | Crispr/cas9 complex for genomic editing |
| CA2989831A CA2989831A1 (en) | 2015-06-17 | 2016-06-17 | Crispr/cas9 complex for genomic editing |
| AU2016278982A AU2016278982A1 (en) | 2015-06-17 | 2016-06-17 | CRISPR/Cas9 complex for genomic editing |
| JP2017565277A JP2018518182A (ja) | 2015-06-17 | 2016-06-17 | ゲノム編集のためのcrispr/cas9複合体 |
| CN201680048445.4A CN107949641A (zh) | 2015-06-17 | 2016-06-17 | 用于基因组编辑的crispr/cas9复合物 |
| US15/737,132 US11643668B2 (en) | 2015-06-17 | 2016-06-17 | CRISPR/Cas9 complex for genomic editing |
| ZA2018/00026A ZA201800026B (en) | 2015-06-17 | 2018-01-03 | Crispr/cas9 complex for genomic editing |
| US18/295,387 US20240117380A1 (en) | 2015-06-17 | 2023-04-04 | Crispr/cas9 complex for genomic editing |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562181138P | 2015-06-17 | 2015-06-17 | |
| US62/181,138 | 2015-06-17 | ||
| US201562266316P | 2015-12-11 | 2015-12-11 | |
| US62/266,316 | 2015-12-11 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/737,132 A-371-Of-International US11643668B2 (en) | 2015-06-17 | 2016-06-17 | CRISPR/Cas9 complex for genomic editing |
| US18/295,387 Continuation US20240117380A1 (en) | 2015-06-17 | 2023-04-04 | Crispr/cas9 complex for genomic editing |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016205703A1 true WO2016205703A1 (en) | 2016-12-22 |
Family
ID=57546388
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/038161 Ceased WO2016205703A1 (en) | 2015-06-17 | 2016-06-17 | Crispr/cas9 complex for genomic editing |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US11643668B2 (https=) |
| EP (1) | EP3310932B1 (https=) |
| JP (1) | JP2018518182A (https=) |
| CN (1) | CN107949641A (https=) |
| AU (1) | AU2016278982A1 (https=) |
| CA (1) | CA2989831A1 (https=) |
| WO (1) | WO2016205703A1 (https=) |
| ZA (1) | ZA201800026B (https=) |
Cited By (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| WO2018182361A1 (ko) * | 2017-03-31 | 2018-10-04 | 한국과학기술원 | CRISPR/Cas 시스템과 재조합 효소 및 단일가닥 올리고디옥시리보핵산을 이용한 코리네박테리움 변이균주 제조방법 |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| WO2019231924A1 (en) * | 2018-05-29 | 2019-12-05 | Monsanto Technology Llc | Transgenic plants with enhanced traits |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| WO2020092608A1 (en) * | 2018-10-31 | 2020-05-07 | Novozymes A/S | Genome editing by guided endonuclease and single-stranded oligonucleotide |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| WO2020197436A1 (ru) | 2019-03-28 | 2020-10-01 | Федеральное Бюджетное Учреждение Науки "Центральный Научно-Исследовательский Институт Эпидемиологии" Федеральной Службы По Надзору В Сфере Защиты Прав Потребителей И Благополучия Человека | Метод получения препарата высокоочищенной рекомбинантной cas нуклеазы |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US11033584B2 (en) | 2017-10-27 | 2021-06-15 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11814624B2 (en) | 2017-06-15 | 2023-11-14 | The Regents Of The University Of California | Targeted non-viral DNA insertions |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017053729A1 (en) | 2015-09-25 | 2017-03-30 | The Board Of Trustees Of The Leland Stanford Junior University | Nuclease-mediated genome editing of primary cells and enrichment thereof |
| CN108753778B (zh) * | 2018-06-01 | 2021-11-02 | 上海科技大学 | 利用碱基编辑修复fbn1t7498c突变的试剂和方法 |
| EP3958909A4 (en) * | 2019-04-24 | 2024-01-10 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY DRUG CONJUGATES AND USES THEREOF |
| CN110283838B (zh) * | 2019-06-27 | 2022-03-25 | 安徽省农业科学院水稻研究所 | 一种高剪切效率ScCas9基因及其应用 |
| CN114222816A (zh) * | 2019-08-29 | 2022-03-22 | 广州辑因医疗科技有限公司 | 一种高效修复环状铁粒幼细胞性贫血基因突变的方法 |
| CN112442516A (zh) * | 2019-08-29 | 2021-03-05 | 广州辑因医疗科技有限公司 | 一种高效修复环状铁粒幼细胞性贫血基因突变的方法 |
| KR102421847B1 (ko) * | 2020-11-03 | 2022-07-18 | 한국생명공학연구원 | Jak3 유전자 돌연변이 중증복합면역결핍 동물모델 및 이의 제조방법 |
| EP4551696A2 (en) * | 2022-07-08 | 2025-05-14 | The Regents of the University of California | Modified crispr-cas effector polypeptides and methods of use thereof |
| CN116497003A (zh) * | 2023-06-29 | 2023-07-28 | 北京百普赛斯生物科技股份有限公司 | 一种从溶液中纯化目标蛋白的方法 |
Family Cites Families (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2012525146A (ja) | 2009-04-28 | 2012-10-22 | プレジデント アンド フェロウズ オブ ハーバード カレッジ | 細胞透過のための過剰に荷電されたタンパク質 |
| RU2650811C2 (ru) | 2012-02-24 | 2018-04-17 | Фред Хатчинсон Кэнсер Рисерч Сентер | Композиции и способы лечения гемоглобинопатии |
| EP3241902B1 (en) | 2012-05-25 | 2018-02-28 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| EP2906684B8 (en) | 2012-10-10 | 2020-09-02 | Sangamo Therapeutics, Inc. | T cell modifying compounds and uses thereof |
| WO2014093694A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| CN105121648B (zh) | 2012-12-12 | 2021-05-07 | 布罗德研究所有限公司 | 用于序列操纵的系统、方法和优化的指导组合物的工程化 |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| AU2013359262C1 (en) | 2012-12-12 | 2021-05-13 | Massachusetts Institute Of Technology | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| CA2894684A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Engineering and optimization of improved crispr-cas systems, methods and enzyme compositions for sequence manipulation in eukaryotes |
| DK2931898T3 (en) | 2012-12-12 | 2016-06-20 | Massachusetts Inst Technology | CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS |
| AU2014248119B2 (en) | 2013-04-03 | 2019-06-20 | Memorial Sloan-Kettering Cancer Center | Effective generation of tumor-targeted T-cells derived from pluripotent stem cells |
| JP2016522679A (ja) | 2013-04-04 | 2016-08-04 | プレジデント アンド フェローズ オブ ハーバード カレッジ | CRISPR/Cas系を用いたゲノム編集の治療的使用 |
| WO2014191128A1 (en) | 2013-05-29 | 2014-12-04 | Cellectis | Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system |
| JP2016528890A (ja) | 2013-07-09 | 2016-09-23 | プレジデント アンド フェローズ オブ ハーバード カレッジ | CRISPR/Cas系を用いるゲノム編集の治療用の使用 |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| WO2016073955A2 (en) | 2014-11-06 | 2016-05-12 | President And Fellows Of Harvard College | Cells lacking b2m surface expression and methods for allogeneic administration of such cells |
| WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
| WO2016123578A1 (en) | 2015-01-30 | 2016-08-04 | The Regents Of The University Of California | Protein delivery in primary hematopoietic cells |
| KR20260048600A (ko) * | 2015-03-27 | 2026-04-10 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 변형된 t 세포 및 이의 제조 및 사용 방법 |
| CN104894068A (zh) | 2015-05-04 | 2015-09-09 | 南京凯地生物科技有限公司 | 一种利用CRISPR/Cas9制备CAR-T细胞的方法 |
| CA2989858A1 (en) | 2015-06-17 | 2016-12-22 | The Uab Research Foundation | Crispr/cas9 complex for introducing a functional polypeptide into cells of blood cell lineage |
| US11377637B2 (en) | 2016-04-15 | 2022-07-05 | Memorial Sloan Kettering Cancer Center | Transgenic T cell and chimeric antigen receptor T cell compositions and related methods |
-
2016
- 2016-06-17 US US15/737,132 patent/US11643668B2/en active Active
- 2016-06-17 CN CN201680048445.4A patent/CN107949641A/zh active Pending
- 2016-06-17 JP JP2017565277A patent/JP2018518182A/ja active Pending
- 2016-06-17 AU AU2016278982A patent/AU2016278982A1/en not_active Abandoned
- 2016-06-17 EP EP16812552.4A patent/EP3310932B1/en active Active
- 2016-06-17 WO PCT/US2016/038161 patent/WO2016205703A1/en not_active Ceased
- 2016-06-17 CA CA2989831A patent/CA2989831A1/en not_active Abandoned
-
2018
- 2018-01-03 ZA ZA2018/00026A patent/ZA201800026B/en unknown
-
2023
- 2023-04-04 US US18/295,387 patent/US20240117380A1/en active Pending
Non-Patent Citations (3)
| Title |
|---|
| BIALK PAWEL ET AL.: "Regulation of Gene Editing Activity Directed by Single- Stranded Oligonucleotides and CRISPR/Cas9 Systems", PLOS ONE, vol. 10, no. 6, 8 June 2015 (2015-06-08), pages 1 - 19, XP055337921 * |
| CAIGNARD G. ET AL.: "Mouse ENU mutagenesis to understand immunity to infection methods, selected examples, and perspectives", GENES, vol. 5, no. 4, 2014, pages 887 - 925, XP055339278 * |
| ZOU J. ET AL.: "Site-specific gene correction of a point mutation in human iPS cells derived from an adult patient with sickle cell disease", BLOOD, vol. 118, no. 17, 2011, pages 4599 - 4608, XP055339273 * |
Cited By (83)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US12559748B2 (en) | 2017-02-06 | 2026-02-24 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| WO2018182361A1 (ko) * | 2017-03-31 | 2018-10-04 | 한국과학기술원 | CRISPR/Cas 시스템과 재조합 효소 및 단일가닥 올리고디옥시리보핵산을 이용한 코리네박테리움 변이균주 제조방법 |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US12234461B2 (en) | 2017-06-15 | 2025-02-25 | The Regents Of The University Of California, A California Corporation | Targeted non-viral DNA insertions |
| US11814624B2 (en) | 2017-06-15 | 2023-11-14 | The Regents Of The University Of California | Targeted non-viral DNA insertions |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11331346B2 (en) | 2017-10-27 | 2022-05-17 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11033584B2 (en) | 2017-10-27 | 2021-06-15 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11590171B2 (en) | 2017-10-27 | 2023-02-28 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11083753B1 (en) | 2017-10-27 | 2021-08-10 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US12398193B2 (en) | 2017-10-27 | 2025-08-26 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12421521B2 (en) | 2018-05-29 | 2025-09-23 | Monsanto Technology Llc | Transgenic plants with enhanced traits |
| WO2019231924A1 (en) * | 2018-05-29 | 2019-12-05 | Monsanto Technology Llc | Transgenic plants with enhanced traits |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| CN113039278A (zh) * | 2018-10-31 | 2021-06-25 | 诺维信公司 | 通过指导的内切核酸酶和单链寡核苷酸进行基因组编辑 |
| WO2020092608A1 (en) * | 2018-10-31 | 2020-05-07 | Novozymes A/S | Genome editing by guided endonuclease and single-stranded oligonucleotide |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2020197436A1 (ru) | 2019-03-28 | 2020-10-01 | Федеральное Бюджетное Учреждение Науки "Центральный Научно-Исследовательский Институт Эпидемиологии" Федеральной Службы По Надзору В Сфере Защиты Прав Потребителей И Благополучия Человека | Метод получения препарата высокоочищенной рекомбинантной cas нуклеазы |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107949641A (zh) | 2018-04-20 |
| ZA201800026B (en) | 2019-04-24 |
| AU2016278982A1 (en) | 2018-01-18 |
| US20190144888A1 (en) | 2019-05-16 |
| CA2989831A1 (en) | 2016-12-22 |
| EP3310932B1 (en) | 2023-08-30 |
| EP3310932A4 (en) | 2019-01-02 |
| US11643668B2 (en) | 2023-05-09 |
| JP2018518182A (ja) | 2018-07-12 |
| US20240117380A1 (en) | 2024-04-11 |
| EP3310932A1 (en) | 2018-04-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240117380A1 (en) | Crispr/cas9 complex for genomic editing | |
| EP3310931B1 (en) | Crispr/cas9 complex for introducing a functional polypeptide into cells of blood cell lineage | |
| JP7731579B2 (ja) | 細胞並びにその使用方法及び製造方法 | |
| Antoniou et al. | Base-editing-mediated dissection of a γ-globin cis-regulatory element for the therapeutic reactivation of fetal hemoglobin expression | |
| US20240002843A1 (en) | Compositions and methods for the treatment of hemoglobinopathies | |
| US10017782B2 (en) | Immune cells modified by transient transfection of RNA | |
| JP6933898B2 (ja) | 養子細胞治療製品を製造するための誘導多能性幹細胞の適用 | |
| KR102338993B1 (ko) | 인위적으로 조작된 조작면역세포 | |
| US20250000912A1 (en) | Hypoimmunogenic stem cells, hypoimmunogenic cells differentiated or derived from stem cells and method of preparing same | |
| CN119452076A (zh) | 免疫细胞的产生 | |
| US20250161492A1 (en) | Base editing approaches for the treatment of beta-thalassemia | |
| WO2025125443A1 (en) | Production of immune cells | |
| JP2020503335A (ja) | T細胞を得る方法及び使用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16812552 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2989831 Country of ref document: CA Ref document number: 2017565277 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016278982 Country of ref document: AU Date of ref document: 20160617 Kind code of ref document: A |