WO2016112270A1 - Lingo-1 antagonists and uses for treatment of demyelinating disorders - Google Patents
Lingo-1 antagonists and uses for treatment of demyelinating disorders Download PDFInfo
- Publication number
- WO2016112270A1 WO2016112270A1 PCT/US2016/012619 US2016012619W WO2016112270A1 WO 2016112270 A1 WO2016112270 A1 WO 2016112270A1 US 2016012619 W US2016012619 W US 2016012619W WO 2016112270 A1 WO2016112270 A1 WO 2016112270A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- lingo
- antibody molecule
- subject
- seq
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/215—IFN-beta
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- MS Multiple sclerosis
- the degree of demyelination is related to the degree of inflammation and the exposure of demyelinated axons to the inflammatory environment, as well as non-inflammatory mediators (Trapp et al. (1998) N Engl J Med 338: 278-285; Kornek et al. (2000) Am J Pathol 157: 267-276; Bitsch et al. (2000) Brain 123: 1174-1183). There is also destruction of oligodendrocytes and impaired remyelination in demyelinating lesions (Peterson et al. (2002) J Neuropathol Exp Neurol 61: 539-546; Chang et al. (2002) N Engl J Med 346: 165-173).
- a loss of oligodendrocytes leads to a reduction in the capacity to re- myelinate and may also result in the loss of trophic factors that support neurons and axons (Bjartmar et al. (1999) Neurocytol 28: 383-395).
- Optic neuritis e.g., acute optic neuritis (AON)
- AON acute optic neuritis
- MS is one the most common initial manifestations of the disease.
- AON causes structural and functional optic nerve damage (e.g., neuroaxonal injury and demyelination) that can result in permanent visual impairment for some patients (Cole, S.R. et al. Invest Ophtalmol Vis Sci (2000) 41(5): 1017- 1021 ; Mi, S. et al. CNS Drugs 2013: 27(7):493-503; Mangione CM et al. Arch Ophthalmol. (1988) 116(11): 1496- 1504).
- the current treatment for acute optic neuritis is high dose steroids which provides mostly symptomatic relief and fails to enhance CNS remyelination or provide neuroaxonal protection (Beck RW et al. N Engl J Med 1992 326:581-8).
- the present invention provides, at least in part, methods and compositions for treating or preventing CNS disorders, e.g., CNS demyelinating disorders, using a reparative agent (e.g., a LINGO- 1 antagonist).
- a reparative agent e.g., a LINGO- 1 antagonist
- the methods and compositions described herein include a reparative agent (e.g., a LINGO- 1 antagonist) as a monotherapy, or in combination with an immunomodulatory agent.
- the reparative agent is administered at a selected time interval such as to enhance one or more of:
- the reparative agent e.g., a LINGO- 1 antagonist
- MS multiple sclerosis
- optic neuritis e.g., acute optic neuritis (AON).
- methods, compositions and kits described herein can be useful for treating a CNS disorder, e.g., a CNS demyelinating disease.
- the invention features a method of treating a CNS disorder, e.g., a CNS demyelinating disease (e.g., MS or an inflammatory condition of the optic nerve, e.g., optic neuritis (e.g., AON), in a subject (e.g., a subject in need of treatment).
- a CNS demyelinating disease e.g., MS or an inflammatory condition of the optic nerve, e.g., optic neuritis (e.g., AON)
- the method includes administering to the subject a reparative agent (e.g., a LINGO- 1 antagonist), in an amount sufficient to reduce one or more symptoms associated with the disorder, thereby treating the disorder.
- a reparative agent e.g., a LINGO- 1 antagonist
- the CNS demyelinating disorder treated or prevented is MS. In another embodiment, the CNS demyelinating disorder treated or prevented is optic neuritis, e.g., AON.
- the reparative agent e.g., a LINGO- 1 antagonist
- a selected time interval chosen from one, two, or all of:
- administration of the anti-LINGO-1 antibody molecule results in one or more of:
- the one or more symptoms associated with the CNS demyelinating disease can be chosen from one, two, three, four, five, six, seven, eight, nine, ten or more (all) of visual loss, edema, inflammation, damage or demyelination of the myelin sheath covering the optic nerve and axons, loss of retinal fiber layer, loss of retinal ganglion cell layer, visual field defect, motion perception defect, color desaturation, decreased color vision, ocular pain, decreased visual acuity (e.g., as measured by low contract letter acuity or high contrast visual acuity), Uhthoff's symptom, swollen optic disc, or relative afferent papillary defect.
- visual loss, edema, inflammation, damage or demyelination of the myelin sheath covering the optic nerve and axons loss of retinal fiber layer, loss of retinal ganglion cell layer, visual field defect, motion perception defect, color desaturation, decreased color vision,
- administration of the anti-LINGO-1 antibody molecule results in one or more of: reducing one or more symptoms associated with the disease, e.g., MS; and/or reducing, retarding or preventing a relapse, or the worsening of a disability, in the subject.
- reducing one or more symptoms associated with the disease e.g., MS
- reducing, retarding or preventing a relapse, or the worsening of a disability in the subject.
- administration e.g., acute administration
- the reparative agent as a monotherapy or a combination therapy can reduce neuronal/axonal damage after an acute lesion, and/or more effectively reduces demyelination or increases remyelination.
- the method disclosed herein is used to treat or prevent an acute lesion of a CNS demyelinating disorder (e.g., an acute MS lesion, an MS relapse, or an optic nerve lesion (e.g., AON)).
- a CNS demyelinating disorder e.g., an acute MS lesion, an MS relapse, or an optic nerve lesion (e.g., AON)
- the reparative agent is an antibody molecule against LINGO- 1 and is administered acutely, as a monotherapy or a combination therapy, e.g., within 30, 28, 25, 24, 20, 18, 15, 12, 10, 5, 2, or 1 day after the onset or relapse of one or more symptoms of the CNS demyelinating disease (e.g., less than 4, 3, 2, 1 week after an acute lesion (e.g., any lesion in MS, an MS relapse or AON)).
- the acute administration is less than 2 weeks or 1 week after the acute lesion (e.g., less than 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 day, or hours after the acute lesion).
- the antibody molecule is administered, as a monotherapy or a combination therapy, at about 1, 3, 10, 30, 60, 100 or 150 mg/kg, e.g., once every one, two, three, four, five, eight, or 12 weeks by injection (e.g., intravenous (IV), subcutaneous (SC), or intramuscular administration (IM)).
- the anti-LINGO-1 antibody molecule is administered at about 3 mg/kg via IV infusion or SC injection once every 4 weeks.
- the anti-LINGO-1 antibody molecule is administered at about 10 mg/kg via IV infusion or SC injection once every 4 weeks.
- the anti-LINGO-1 antibody molecule is administered at about 30 mg/kg via IV infusion or SC injection once every 4 weeks.
- the anti-LINGO-1 antibody molecule is administered at about 100 mg/kg via IV infusion or SC injection once every 4 weeks.
- chronic or prophylactic administration of the reparative agent as a monotherapy or as a combination therapy can preserve neuronal function and/or neuronal tissue, and/or prevent or delay a disability in a subject, e.g., an MS or AON subject as described herein.
- chronic or prophylactic administration of the reparative agent may prevent the onset or delay the progressive form of the disease, e.g., MS, for example, by reducing one or more of axonal /neuronal degeneration and/or axonal loss.
- the method disclosed herein can include an administration of the anti-LINGO antibody molecule that is initiated before the onset or relapse of one or more symptoms of MS, or the inflammatory condition of the optic nerve, e.g., optic neuritis, e.g., AON, in one or both eyes of the subject.
- the method disclosed herein includes administration of the anti-LINGO antibody molecule during primary progressive MS, e.g., when progression of MS begins without a preceeding relapse.
- administration of the antibody molecule against LINGO- 1 is chronic and/or prophylactic.
- the anti-LINGO- 1 antibody molecule is administered prophylactically and/or administration continues for a prolonged period of time, e.g., administration continues until the incremental beneficial effects of the treatment are reduced or not detectable (e.g., as detected by one or more of: remyelination, reduction in neuronal damage, reduction of disability, or increased neurological function).
- the antibody molecule is administered, as a monotherapy or a combination therapy, at about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg, e.g., once every one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or fifteen weeks by injection (e.g., intravenous, subcutaneous, or intramuscular administration).
- the anti-LINGO-1 antibody molecule is administered by intravenous or subcutaneous injection at about 1 to 100 mg/kg (typically, at about 3 mg/kg, about 10 mg/kg, about 30 mg/kg, about 50mg/kg or about 100 mg/kg), once every one, two, three, four or five weeks.
- the method disclosed herein is used to treat or prevent disease initiation or disease progression in a subject, e.g., a subject with AON or MS, e.g., a subject with a relapsing form of MS (RRMS) or a subject with primary progressive MS (PPMS), or secondary progressive MS (SPMS)).
- a subject with AON or MS e.g., a subject with a relapsing form of MS (RRMS) or a subject with primary progressive MS (PPMS), or secondary progressive MS (SPMS)
- the reparative agent is an antibody molecule against LINGO- 1 and is administered chronically or prophylactically, as a monotherapy or a combination therapy.
- administration e.g., chronic or prophylactic administration
- the agent occurs after a lesion (e.g., an MS or AON lesion), in an area that has not suffered detectable neuronal damage.
- the treatment occurs in an area prior to irreversible neuronal damage.
- the subject can have an AON diseased eye and does not show a detectable symptom in the other eye (referred to herein as the "fellow eye” or "normal eye”).
- the subject can be treated with the reparative agent (e.g., a LINGO- 1 antagonist), as a monotherapy or in combination, as a way of preventing or delaying the onset of the nerve disorder or condition in the normal eye or elsewhere in the brain or spinal cord (anywhere in the central nervous system or CNS).
- the reparative agent e.g., a LINGO- 1 antagonist
- treatment of a normal fellow eye after diagnosis of acute optic neuritis in a first eye may delay or prevent one or more symptoms of neuritis in the normal fellow eye or subsequent lesions or damage and/or loss of axons in the visual pathway and elsewhere in the CNS.
- administering prevents or delays the onset of the optic nerve disorder, e.g., acute optic neuritis, in either or both eyes.
- the reparative agent e.g., a LINGO- 1 antagonist, e.g., anti-LINGO antibody molecule
- administering delays or prevents the onset or relapse of an MS symptom.
- the reparative agent e.g., a LINGO- 1 antagonist, e.g., anti-LINGO antibody molecule
- administering delays one or more symptoms of MS or the optic nerve disorder by at least a day, a week, a month, a year or longer.
- the reparative agent e.g., a LINGO-1 antagonist, e.g., anti-LINGO antibody molecule
- the subject is identified as having (e.g., diagnosed with) the optic nerve disorder or condition, e.g., acute optic neuritis, in one or both eyes, but does not show an MS symptom (e.g., is a subject not diagnosed with MS or a subject that has MS but does not suffer from a relapse or is not showing disease progression).
- prophylactic or chronic treatment of said subject with the optic nerve disorder or condition, e.g., acute optic neuritis delays or prevents the onset or relapse of an MS symptom.
- administering e.g., a LINGO-1 antagonist, e.g., anti- LINGO antibody molecule
- administration of the reparative agent e.g., a LINGO-1 antagonist, e.g., anti- LINGO antibody molecule
- the optic nerve disorder or condition e.g., acute optic neuritis, delays or prevents the onset and/or relapse of PPMS or SPMS.
- the methods described herein further include identifying a subject to be treated with the anti-LINGO- 1 antibody molecule, by detecting one or both of optic nerve damage or optic nerve function for one or both eyes.
- detection of at least a minimal level of optic nerve damage in one eye or both eyes, and/or a delay in optic nerve conductance in said one eye or both eyes identifies the subject as a subject to be treated.
- the step of measuring optic nerve damage can include a measure of visual evoked potential (VEP) amplitude, e.g., full field VEP (FF-VEP) amplitude and/or multi-field VEP (mfVEP) amplitude.
- administration of an anti- LINGO antibody as described herein improves recovery of latency by mfVEP, and/or prevents an mfVEP amplitude loss in the non-AON visual path:
- one or more of the following is indicative of the minimal level of optic nerve damage in the eye, e.g., as determined by mfVEP amplitude changes.
- control amplitude is the average VEP amplitude, e.g., FF- VEP amplitude and/or mfVEP amplitude, of a normal eye, e.g., an eye of a subject not having an optic nerve disorder, e.g., AON.
- the step of measuring optic nerve conductance comprises a measure of VEP latency, e.g., FF-VEP latency or mfVEP latency measured in miliseconds.
- VEP latency e.g., FF-VEP latency or mfVEP latency measured in miliseconds.
- one or more of the following is indicative of a delay in optic nerve conductance in the eye as determined by FF-VEP:
- VEP latency that is at least 3 milliseconds higher than a reference value, e.g., a control latency
- VEP latency that is at least 3% higher (e.g., 3%, 5%, 8%, 10%, 12% or higher) than a reference value, e.g., a control latency, or
- control latency is the average VEP latency, e.g., FF-VEP latency or mfVEP latency, of a normal eye, e.g., an eye of a subject not having an optic nerve disorder, e.g., AON, or the non-affected or fellow eye from within the same subject if only one eye is affected.
- VEP latency e.g., FF-VEP latency or mfVEP latency
- compositions and kits disclosed herein include one or more of the following:
- the CNS disorder ⁇ e.g., the CNS demyelinating disease
- the CNS disorder can be any condition, disease, disorder or injury associated with one or more of: demyelination, dysmyelination, axonal injury, loss of axonal area or axial diffusivity, or loss of neuronal synapsis/connectivity, and/or dysfunction or death of an oligodendrocyte or a neuronal cell.
- the CNS demyelinating disease can be any condition, disease, disorder or injury associated with one or more of: demyelination, dysmyelination, axonal injury, loss
- the CNS disorder affects the nervous system by causing damage to the myelin sheath of axons.
- the CNS disorder includes Nogo receptor- 1 (NgRl-) mediated inhibition of axonal extension or neurite extension, e.g., in the brain and spinal cord.
- the CNS disorder has one or more inflammatory components.
- Exemplary CNS disorders include, but are not limited to, CNS demyelinating diseases, CNS injury,
- ALS Amyotrophic lateral sclerosis
- MS multiple sclerosis
- optic neuritis ⁇ e.g., acute optic neuritis
- transverse myelitis neuromyelitis optica (NMO)
- PML progressive multifocal leukoencephalopathy
- EPL encephalomyelitis
- ADAM acute disseminated encephalomyelitis
- CPM central pontine myelolysis
- Wallerian Degeneration adrenoleukodystrophy, Alexander's disease, Pelizaeus Merzbacher disease (PMZ), leukodystrophies, traumatic glaucoma, periventricular leukomalatia (PVL), essential tremor, white matter stroke, stroke, or radiation or toxic induced white matter injury.
- a CNS demyelinating disease can be chosen from one or more of the aforesaid disorders.
- the CNS demyelinating disease is multiple sclerosis.
- the CNS demyelinating disease is optic neuritis, e.g., acute optic neuritis.
- a method of treating or preventing an inflammatory condition or disorder of the optic nerve e.g., optic neuritis ⁇ e.g., acute optic neuritis (AON)
- a subject e.g., a subject in need of treatment
- the method includes administering to the subject a reparative agent (e.g., a LINGO- 1 antagonist), as a monotherapy or in combination with a second agent (e.g., an immunomodulatory agent as described herein) in an amount sufficient to reduce one or more manifestations associated with the optic nerve condition or disorder, thereby treating or preventing the optic nerve condition or disorder.
- a reparative agent e.g., a LINGO- 1 antagonist
- a second agent e.g., an immunomodulatory agent as described herein
- said treatment includes: reducing one or more symptoms associated with the optic nerve condition or disorder; reducing, retarding or preventing a relapse, or the worsening of the optic nerve condition or disorder; and/or inhibiting or retarding the development of a new lesion in the subject.
- said prevention includes delaying or ameliorating one or more symptoms or severity of the optic nerve disorder or condition.
- one or more symptoms associated with the optic nerve disorder or condition includes one, two, three, four, five or more of visual loss, VEP latency delay (e.g., time for a signal to travel from the retina to the visual cortex), edema, inflammation, damage or demyelination of the myelin sheath covering the optic nerve and axons, loss of retinal fiber layer, or loss of retinal ganglion cell layer.
- the treatment or prevention results in a recovery of VEP latency delay.
- the recovery of the visual evoked potential (VEP) latency e.g., full-field VEP (FF-VEP) or multifocal VEP (mfVEP)
- FF-VEP full-field VEP
- mfVEP multifocal VEP
- the recovery of the visual evoked potential (VEP) latency is partial or complete (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% that of the unaffected fellow eye or the reference normal control VEP latency).
- the treatment or prevention delays one or more symptoms of the optic nerve disorder or condition, e.g., acute optic neuritis, by at least a day, a week, a month, 3 months, 6 months, a year or longer.
- the optic nerve disorder or condition e.g., acute optic neuritis
- the treatment or prevention is initiated before the onset or relapse of one or more symptoms of the nerve disorder or condition, e.g., acute optic neuritis.
- the status of a subject with AON is measured by determining the visual evoked potential latency and amplitude.
- the subject treated is a subject ⁇ e.g., a human) having, or at risk of having, a CNS disorder or a CNS demyelinating disease, e.g., as described herein.
- the subject is a human, e.g., a human adult. In one embodiment, the subject is a human about 30 years old or older, e.g., at least 30, 35, 40, 45, 50, 55, 60 years old or older.
- the subject ⁇ e.g., the human
- the human subject has one or more symptoms associated with MS ("an MS symptom").
- the subject with MS can be at any stage of treatment.
- the subject with MS is chosen from a human having one or more of: Benign MS, RRMS ⁇ e.g., quiescent RRMS, active RRMS), primary progressive MS (PPMS), or secondary progressive MS (SPMS), active SPMS, clinically isolated syndrome (CIS), or clinically defined MS (CDMS).
- the subject has a relapsing form of MS.
- the subject has RRMS or SPMS.
- the subject with MS has SPMS.
- the subject with MS has RRMS .
- the subject has one or more MS-like symptoms, such as those having clinically isolated syndrome (CIS) or clinically defined MS (CDMS).
- the subject has one or more MS relapses ⁇ e.g. acute optic neuritis, transverse myelitis, brainstem syndrome, internuclear ophthalmoplegia).
- the subject does not yet have a symptom associated with MS, but is at risk for developing the disease.
- the subject is asymptomatic at the time of treatment, e.g., initial treatment.
- the subject is not diagnosed with MS, or is diagnosed with MS but does not suffer from a relapse.
- the subject has a relapsing form of MS ⁇ e.g., RRMS or relapsing
- the subject has RRMS and has one or more ongoing clinical exacerbations and/or subclinical activity, e.g., as shown by gadolinium (Gd) enhancement or development of new and/or enlarged T2/FLAIR lesions on magnetic resonance imaging ⁇ e.g., brain or spinal cord MRI).
- the subject has SPMS and has one or more ongoing clinical exacerbations and/or subclinical activity, e.g., as shown by gadolinium (Gd) enhancement or development of new and/or enlarged T2/FLAIR lesions on magnetic resonance imaging (e.g., brain or spinal cord MRI).
- the subject has an active form of MS, e.g., an active RRMS.
- the MS subject has at least one newly developed lesion. In other embodiment, the MS subject has at least one preexisting lesion. In one embodiment, the subject has RRMS, and has one or more newly developed or pre-existing lesions, or a combination thereof. In other embodiments, the subject has a baseline EDSS score of 1.5 to 7.
- the subject is an MS patient (e.g. , a patient with RRMS or SPMS) prior to administration of an MS therapy (a monotherapy or a combination therapy of the agents described herein).
- the subject is a newly diagnosed or an undiagnosed RRMS or SPMS patient.
- a subject has a radiologically isolated syndrome or clinically isolated syndrome.
- a subject has an asymptomatic finding (e.g., does not present with MS symptoms, but has an MS associated finding noted on testing).
- the subject is an MS patient (e.g., an RRMS patient) after administration of an MS therapy described herein (a monotherapy or a combination therapy of the agents described herein).
- the subject is an MS patient after administration of the MS therapy for one, two weeks, one month, two months, three months, four months, six months, one year or more.
- the subject does not have a symptom associated with AON in one or both eyes.
- the subject is not diagnosed with the optic nerve disorder or condition, e.g., acute optic neuritis, in one or both eyes (e.g., has normal eyes).
- the subject is diagnosed with the optic nerve disorder or condition, e.g., acute optic neuritis, in one or both eyes, referred to herein as the "diseased eye(s).”
- the subject has a diseased eye and does not show a detectable symptom in the other eye (referred to herein as the "fellow eye” or "normal eye”).
- the subject is diagnosed with the optic nerve disorder, e.g., AON, in one or both eyes, but does not show an MS symptom.
- the subject can be treated with the reparative agent (e.g., a LINGO- 1 antagonist), as a monotherapy or in combination, as a way of preventing or delaying the onset of the nerve disorder or condition in the normal eye.
- the reparative agent e.g., a LINGO- 1 antagonist
- treatment of a normal fellow eye after diagnosis of acute optic neuritis in a first eye may delay or prevent one or more symptoms of neuritis in the normal fellow eye or elsewhere in the brain.
- the treatment or prevention delays one or more symptoms of the optic nerve disorder or condition, e.g., acute optic neuritis, and/or MS by at least a day, a week, a month, a year or longer.
- administration of the anti-LINGO-1 antibody molecule to the subject treats the diseased eye.
- administration of the anti- LINGO- 1 antibody molecule delays or prevents the onset of MS or the optic nerve disorder, e.g., AON, in the normal fellow eye, or elsewhere in the CNS.
- the subject is diagnosed with the optic nerve disorder or condition, e.g., acute optic neuritis, in one or both eyes, but does not show other MS symptoms (e.g., is a subject not diagnosed with MS or a subject that has MS but does not suffer from a relapse or is not progressing).
- treatment of said subject with the optic nerve disorder or condition, e.g., acute optic neuritis delays or prevents the onset or relapse of an MS symptom.
- the treatment or prevention delays one or more MS symptoms by at least a day, a week, a month, a year or longer.
- the reparative agent administered is a LINGO- 1 antagonist (e.g., an anti-LINGO antibody as described herein), as a monotherapy.
- the reparative agent is an anti-LINGO- 1 antibody which is administered as a monotherapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg. For example, between about 3 to 100 mg/kg, 10 to 300 mg/kg, 20 to 250 mg/kg, 50 to 200 mg/kg, 75 to 150 mg/kg, 90 to 120 mg/kg, or about 100 mg/kg.
- the reparative agent administered is a LINGO- 1 antagonist
- the reparative agent is an anti-LINGO antibody which is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is administered as a combination therapy in an amount ranging from about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg.
- the immunomodulatory agent is
- administration of the LINGO-antagonist allows for administration of a reduced amount of the immunomodulatory agent.
- the reparative agent causes one or more of: enhances myelination or re- myelination, enhances neuroaxonal protection, increases axonal extension, increases neuronal sprouting, and/or increases differentiated oligodendrocyte numbers (e.g., by increasing one or more of: survival or differentiation of oligodendrocytes), e.g., in a subject (e.g., a subject in need thereof).
- the method includes administering to the subject a reparative agent (e.g., a LINGO- 1 antagonist), as a monotherapy or in combination with an immunomodulatory agent, in an amount sufficient to enhance one or more of: myelination, re-myelination, oligodendrocyte numbers, or neuroaxonal protection.
- a reparative agent e.g., a LINGO- 1 antagonist
- the reparative agent is an antagonist of LRR and Ig domain- containing, Nogo receptor-interacting protein ("LINGO,” e.g., LINGO-1).
- LINGO-1 previously called Sp35, is a cell surface glycoprotein that is selectively expressed in the adult CNS in neurons and oligodendrocytes, where it is believed to function as a negative regulator of oligodendrocyte differentiation, myelination, and remyelination.
- antagonism of LINGO-1 can enhance myelination or re-myelination of axons, e.g., by oligodendrocytes, and enhance neuroaxonal protection in the CNS.
- LINGO-1 has been described in International Applications PCT/US2006/026271, filed Jul. 7, 2006, PCT/US2004/008323, filed Mar. 17, 2004, PCT/US2005/022881, filed Jun. 24, 2005 and PCT/US2008/000316, filed Jan. 9, 2008, each of which is incorporated by reference in its entirety herein.
- the reparative agent e.g., the LINGO-1 antagonist, inhibits or reduces the expression or activity of LINGO- 1, e.g., human LINGO- 1.
- the reparative agent e.g., the LINGO-1 antagonist
- the reparative agent e.g., the LINGO-1 antagonist
- the reparative agent e.g., the antagonist of LINGO- 1
- the antibody molecule reduces the formation and/or activity of a complex (e.g., a functional signaling complex) of the NgRl, p75, and LINGO- 1 ; and/or NgRl, TAJ (TROY), and LINGO- 1.
- the antibody molecule binds to at least one of the components of the complex (e.g., at least one of NgRl, p75, and LINGO- 1 ; and/or NgRl, TAJ (TROY), and LINGO-1), and inhibits or reduces the functional signaling.
- the antibody molecule binds to LINGO, e.g., human LINGO. In another embodiment, the antibody molecule binds to LINGO- 1, e.g., human LINGO- 1.
- the antibody molecule can be a monoclonal or single specificity antibody, or an antigen-binding fragment thereof (e.g., an Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent or bispecific antibody or fragment thereof, a single domain variant thereof) that binds to LINGO- 1, e.g., a mammalian (e.g., human LINGO- 1 (or a functional variant thereof)).
- a mammalian e.g., human LINGO- 1 (or a functional variant thereof
- the antibody molecule is a monoclonal antibody against LINGO-1, e.g., human LINGO- 1.
- the antibody molecule is a human, a humanized, a CDR-grafted, a chimeric, a camelid, or an in vitro generated antibody to human LINGO-1 (or functional fragment thereof, e.g., an antibody fragment as described herein).
- the antibody inhibits, reduces or neutralizes one or more activities of LINGO-1 (e.g., one or more biological activities of LINGO-1 as described herein).
- the antibody molecule can be full-length (e.g., can include at least one, and typically two, complete heavy chains, and at least one, and typically two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, an F(ab') 2 , an Fv, a single chain Fv fragment, or a single domain antibody or fragment thereof).
- an antigen-binding fragment e.g., a Fab, an F(ab') 2 , an Fv, a single chain Fv fragment, or a single domain antibody or fragment thereof.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant region of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the framework region or constant region of the antibody molecule can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the framework or constant region of the antibody molecule is altered, e.g., mutated, to decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function.
- the framework region of the antibody molecule is modified to reduce antibody glycosylation, effector cell and/or complement function.
- the antibody molecule includes an aglycosyl framework.
- the antibody molecule binds to LINGO- 1, e.g., human LINGO- 1, and is an immunoglobulin G subclass 1 (IgGl).
- the antibody molecule is modified to reduce effector cell and complement function compared to wild-type IgGl .
- the antibody molecule includes an aglycosyl (IgGl) framework.
- the antibody molecule specifically binds to the same, or substantially the same, LINGO- 1 epitope as the reference monoclonal antibody Li62 or Li81, described in U.S. Patent No. 8,058,406 and U.S. Patent No. 8,128,926, both of which are incorporated by reference in their entirety herein.
- the antibody molecule comprises, consists essentially of, or consists of, an immunoglobulin heavy chain variable region (VH) wherein the CDR1, CDR2 and CDR3 regions are selected from the amino acid sequences shown in Table 3, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to the amino acid sequences shown in Table 3; or at least 80%, 85%, 90, 95% or 100% identical to the VH CDR1, CDR2 and CDR3 regions of the immunoglobulin heavy chain of Li62 or Li81).
- VH immunoglobulin heavy chain variable region
- the antibody molecule includes a VH that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 4 or SEQ ID NO:8 or any one of SEQ ID NOs: 17 to 49, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDR1, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 6, 7, and 8, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDR1, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 2, 3, and 30, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes an immunoglobulin light chain variable region (VL) wherein the CDR1, CDR2 and CDR3 regions are selected from the polypeptide sequences shown in Table 4, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to the amino acid sequences shown in Table 4; or at least 80%, 85%, 90%, 95% or 100% identical to the VL CDRl, CDR2 and CDR3 regions of the immunoglobulin light chain of Li62 or Li81).
- VL immunoglobulin light chain variable region
- the antibody molecule includes a VL wherein the VL CDRl,
- CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 14, 15, and 16, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VL wherein the VL CDRl, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 10, 11, and 12, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDRl, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 6, 7, and 8, respectively; and a VL wherein the VL CDRl, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 14, 15, and 16, respectively; or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDRl, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 2, 3, and 30, respectively; and a VL wherein the VL CDRl, CDR2, and CDR3 comprise, consist essentially of, or consist of, the amino acids of SEQ ID NOs: 10, 11, and 12, respectively; or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH selected from the group consisting of SEQ ID NOs: 1, 5, and 53-85, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NOs: 1, 5 and 53-85).
- the antibody molecule includes a VH that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 5).
- the antibody molecule includes a VH that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO:66, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 66).
- the antibody molecule includes a VL selected from the group consisting of SEQ ID NOs: 9 and 13, as shown in Table 4, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NOs: 9 and 13, as shown in Table 4).
- the antibody molecule includes a VL that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 13).
- the antibody molecule includes a VL that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO:9, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 9).
- the antibody molecule includes a VH that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO:5, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 5); and a VL that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 13).
- the antibody molecule includes a VH that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO:66, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 66); and a VL that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 9).
- the antibody molecule includes a heavy chain as shown below, that comprises, consists essentially of, or consists of, the amino acid sequence of SEQ ID NO: 275, or a sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto), as follows:
- the antibody molecule comprises, consists essentially of, or consists of, a light chain as shown below, comprising the amino acid sequence of SEQ ID NO: 276, or a sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto), as follows:
- the antibody molecule is the anti-LINGO- 1 antibody, opicinumab (also referred to herein as "BIIB033").
- the anti-LINGO- 1 antibody molecule comprises (i) a heavy chain comprising, consisting essentially of, or consisting of, the amino acid sequence of SEQ ID NO: 275, and (ii) a light chain comprising, consisting essentially of, or consisting of, the amino acid sequence of SEQ ID NO: 276.
- the reparative agent e.g., the antagonist of LINGO- 1
- a soluble LINGO molecule e.g., a LINGO-1 molecule (e.g., a fragment of LINGO- 1)
- a soluble form of a component of the LINGO-1 complex e.g., a soluble form of NgRl, p75, or TAJ (TROY)
- a soluble form of LINGO or a complex component can be used alone or functionally linked (e.g., by chemical coupling, genetic or polypeptide fusion, non-covalent association or otherwise) to a second moiety, e.g., an immunoglobulin Fc domain, serum albumin, pegylation, a GST, Lex-A, an MBP polypeptide sequence, or an antibody (e.g., a bispecific or a multispecific antibody).
- the fusion proteins may additionally include a linker sequence joining the first moiety, e.g., the soluble form of LINGO- 1 or the complex component, to the second moiety.
- additional amino acid sequences can be added to the N- or C-terminus of the fusion protein to facilitate expression, steric flexibility, detection and/or isolation or purification.
- a soluble form of LINGO- 1 or a complex component can be fused to a heavy chain constant region of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE.
- the fusion protein can include the extracellular domain of LINGO or the complex component (or a sequence homologous thereto), and, e.g., fused to, a human immunoglobulin Fc chain, e.g., a human IgG (e.g., a human IgGl or a human IgG2, or a mutated form thereof).
- a human immunoglobulin Fc chain e.g., a human IgG (e.g., a human IgGl or a human IgG2, or a mutated form thereof).
- the Fc sequence can be mutated at one or more amino acids to reduce effector cell function, Fc receptor binding and/or complement activity.
- one or more reparative agents are added in combination.
- a LINGO- 1 antagonist can be added in combination with another remyelinating agent.
- kits and compositions described herein can include one or more immunomodulatory agents.
- the immunomodulatory agent is chosen from one or more of:
- glatiramer e.g., glatiramer
- Copaxone® an antibody or fragment thereof against alpha-4 integrin, e.g., natalizumab (e.g., Tysabri®);
- an anthracenedione molecule e.g., mitoxantrone (e.g., Novantrone®);
- a fingolimod e.g., FTY720 (e.g., Gilenya®);
- a dimethyl fumarate e.g., an oral dimethyl fumarate (e.g., Tecfidera®);
- an antibody to the alpha subunit of the IL-2 receptor of T cells e.g., daclizumab;
- alemtuzumab e.g., CAMPATH
- an inhibitor of a dihydroorotate dehydrogenase e.g., leflunomide or an active metabolite thereof, e.g., teriflunomide (e.g., AUBAGIO);
- an antibody to CD20 e.g. , rituximab, or ocrelizumab;
- S IP Sphingosine 1-phosphate
- the immunomodulatory agent is an IFN- ⁇ 1 molecule.
- the IFN- ⁇ 1 molecule can be chosen from one or more of an IFN- la or IFN- ⁇ lb polypeptide, a variant, a homologue, a fragment or a pegylated variant thereof.
- the IFN- ⁇ 1 molecule includes an IFN agent chosen from an IFN- la molecule, an IFN- lb molecule, or a pegylated variant of an IFN- la molecule or an IFN- ⁇ lb molecule.
- the IFNpi molecule is an IFN-pia agent (e.g., Avonex®, Rebif®). In another embodiment, the IFNpi molecule is an INF-p ib agent (e.g., Betaseron®, Betaferon® or Extavia®).
- IFN-pia agent e.g., Avonex®, Rebif®
- IFNpib agent e.g., Betaseron®, Betaferon® or Extavia®.
- the immunomodulatory agent is a polymer of glutamic acid, lysine, alanine and tyrosine, e.g., glatiramer (e.g., Copaxone®).
- the immunomodulatory agent is an antibody or fragment thereof against alpha-4 integrin (e.g., natalizumab (e.g., Tysabri®)).
- alpha-4 integrin e.g., natalizumab (e.g., Tysabri®)
- the immunomodulatory agent is an anthracenedione molecule (e.g., mitoxantrone (e.g., Novantrone®)).
- the immunomodulatory agent is a fingolimod (e.g.,
- the immunomodulatory agent is a dimethyl fumarate (e.g., an oral dimethyl fumarate (e.g., BG- 12)).
- the immunomodulatory agent is an antibody to the alpha subunit of the IL-2 receptor of T cells (CD25) (e.g., Daclizumab).
- the immunomodulatory agent is an antibody to CD20, e.g. , ocrelizumab.
- the immunomodulatory agent is a corticosteroid, e.g., methylprednisolone (e.g., high dose corticosteroid, e.g., methylprednisolone).
- a corticosteroid e.g., methylprednisolone (e.g., high dose corticosteroid, e.g., methylprednisolone).
- the method further includes the use of one or more symptom management therapies, such as antidepressants, analgesics, anti-tremor agents, among others.
- symptom management therapies such as antidepressants, analgesics, anti-tremor agents, among others.
- any combination of the reparative agent e.g., one or more reparative agents described herein, e.g., a LINGO-1 antagonist
- an immunomodulatory agent e.g., one or more immunomodulatory agents described herein
- the reparative agent can be combined with a polymer of glutamic acid, lysine, alanine and tyrosine, e.g., glatiramer.
- the reparative agent can be combined with an antibody or fragment thereof against alpha-4 integrin, e.g., natalizumab.
- the reparative agent can be combined with an anthracenedione molecule, e.g., mitoxantrone.
- the reparative agent can be combined with a fingolimod, e.g., FTY720.
- FTY720 fingolimod
- the reparative agent can be combined with a dimethyl fumarate, e.g., an oral dimethyl fumarate.
- the reparative agent can be combined with an antibody to the alpha subunit of the IL-2 receptor of T cells (CD25), e.g., daclizumab.
- the reparative agent can be combined with an antibody against CD52, e.g., alemtuzumab.
- the reparative agent can be combined with an inhibitor of a dihydroorotate dehydrogenase, e.g., teriflunomide.
- the reparative agent can be combined with an antibody to CD20, e.g. , ocrelizumab.
- the reparative agent can be combined with a corticosteroid, e.g.,
- the reparative agent can be combined with a S IP modulating agent.
- the reparative agent is combined with two, three, four or more immunomodulatory agents, e.g., two, three, four or more of the immunomodulatory agents described herein.
- a combination of a LINGO antagonist, an IFN- ⁇ 1 molecule and a corticosteroid is used.
- a combination of a LINGO antagonist, an IFN- ⁇ 1 molecule and a polymer of glutamic acid, lysine, alanine and tyrosine, e.g., glatiramer is used.
- a combination of a LINGO antagonist, an IFN- ⁇ 1 molecule and an antibody or fragment thereof against alpha-4 integrin, e.g., natalizumab is used.
- the reparative agent is an antibody molecule against LINGO- 1, e.g., an anti-LINGO antibody as described herein
- the immunosuppressive agent is an IFN- ⁇ 1 molecule, e.g., an IFN- ⁇ 1 molecule as described herein.
- the reparative agent can be administered as a monotherapy or a combination therapy.
- the combinations of reparative agent (e.g., LINGO- 1 antagonist) and the immunomodulatory agent described herein can be administered in any order, e.g., concurrently or sequentially as described herein.
- the reparative agent and the immunomodulatory agent are administered concurrently.
- the reparative agent and the immunomodulatory agent are administered sequentially.
- the administration of the reparative agent and the immunomodulatory agent can overlap, at least in part or completely, with each other.
- initiation of the administration of the immunomodulatory agent and the reparative agent occurs at the same time. In other embodiments, the
- immunomodulatory agent is administered before initiating treatment with the reparative agent.
- the reparative agent is administered before initiating treatment with the immunomodulatory agent.
- the administration of the immunomodulatory agent is administered before initiating treatment with the immunomodulatory agent.
- immunomodulatory agent continues after cessation of administration of the reparative agent. In other embodiments, administration of the reparative agent continues after cessation of administration of the immunomodulatory agent. In other embodiments, administration of the reparative agent continues intermittently (e.g., for 2 or 3 months every 3 or 6 or 12 months, or for 3-6 months every 1-2 years) while the immunomodulatory agent is given continuously. In other embodiments, administration of the immunomodulatory agent continues intermittently (e.g., for 2 or 3 months every 3 or 6 or 12 months, or for 3-6 months every 1-2 years), while the reparative agent is given continuously, e.g., as background therapy.
- the reparative agent is an antibody molecule against LINGO- 1 and is administered, as a monotherapy or a combination therapy, intravenously,
- the antibody molecule is a fragment of an antigen that binds to an antigen.
- the antibody molecule is administered, as a monotherapy or a combination therapy, at about 0.3, 1.0, 3.0, 10, 30, 60, or 100 mg/kg. For example, between about 1 to 150 mg/kg, e.g., 3 to 100 mg/kg (typically, at about 3 mg/kg, about 10 mg/kg, about 30 mg/kg, about 50mg/kg or about 100 mg/kg).
- the antibody molecule is administered once every one, two, three, four or five weeks by IV infusion.
- the anti-LINGO- 1 antibody molecule is administered at about 100 mg/kg via IV infusion or SC injection once every 4 weeks.
- the administration of the anti-LINGO-1 antibody molecule is acute, e.g., it is administered less than 2 weeks after an acute MS lesion (e.g., any lesion in MS, a relapse or AON). In one embodiment, the acute administration is less than 2 weeks or 1 week after the acute MS lesion (e.g., less than 13, 12, 11 , 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 day, or hours after the acute MS lesion).
- an acute MS lesion e.g., any lesion in MS, a relapse or AON.
- the acute administration is less than 2 weeks or 1 week after the acute MS lesion (e.g., less than 13, 12, 11 , 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 day, or hours after the acute MS lesion).
- administration is chronic, e.g., is administered prophylactically and/or administration continues for a prolonged period of time, e.g., administration continues until the beneficial effects of the treatment (e.g., as detected by remyelination or reduction in neuronal damage) are reduces or not detectable.
- the immunomodulatory agent is an IFN- ⁇ 1 molecule is administered intravenously, subcutaneously or intramuscularly.
- the IFN- ⁇ 1 molecule can be administered at one or more of:
- microgram e.g., 22 microgram
- 40-50 micrograms e.g., 44 micrograms
- the IFN- ⁇ 1 molecule is an interferon ⁇ -lb (Betaseron®/Betaferon®, or Extavia®).
- the reparative agent is an antibody molecule against LINGO- 1 and is administered once every four weeks by IV infusion or SC injection dosed at about 3 mg/kg, about 10 mg/kg, about 30 mg/kg, 50mg/kg or about 100 mg/kg; and
- the immunomodulatory agent the IFN- ⁇ 1 is administered at one or more of:
- microgram e.g., 22 microgram
- 40-50 micrograms e.g., 44 micrograms
- a method of evaluating, diagnosing, and/or monitoring the progression of, a CNS disorder or a CNS demyelinating disease includes evaluating a subject (e.g., a patient, a patient group or a patient population), having the CNS disorder or CNS demyelinating disease, or at risk of developing the disorder.
- the subject is evaluated using (i) a neurological examination (e.g., EDSS); and/or (ii) an assessment of physical function.
- a neurological examination e.g., EDSS
- an assessment of physical function can include an assessment of ambulatory function (e.g., short distance and/or longer distance ambulatory function), alone or in combination with an assessment of upper and/or lower extremity function.
- the subject is evaluated by one or more of:
- EDSS Expanded Disability Status Scale
- MSFC Multiple Sclerosis Functional Composite
- detecting the subject' s lesion status e.g., as assessed using an MRI
- acquiring a measure of upper and/or lower extremity function acquiring a measure of upper and/or lower extremity function; acquiring a measure of ambulatory function (e.g., short distance ambulatory function) (e.g., Timed Walk of 25 Feet (T25FW)); or long distance ambulatory function (e.g. the 6 minute walk test (6MW);
- a measure of ambulatory function e.g., short distance ambulatory function
- T25FW Timed Walk of 25 Feet
- 6MW 6 minute walk test
- a measure of cognitive function e.g., an MS-COG or BICAMS or SDMT.
- the measure of upper extremity function is acquired using a 9 Hole Peg Test (9HP).
- the measure of short distance ambulatory function is acquired using a Timed Walk of 25 Feet (T25FW).
- the measure of long distance ambulatory function is acquired using a 6 minute walk test (6MW).
- an increase by at least 10%, 15%, 20%, 25% or higher in a measure of extremity and/or ambulatory function is indicative of disease progression, e.g., a steady worsening of symptoms and/or disability, in the subject; and a decrease of at least 10%, 15%, 20%, 25% or more in a measure of extremity and/or ambulatory function as described above is indicative of an improved outcome (e.g., a decrease in disease progression or an improved condition) in the subject.
- the subject is evaluated using a neurological examination, e.g., EDSS.
- the EDSS includes an assessment of neurological function, an assessment of ambulatory function, or both.
- an EDSS score is calculated based on a combination of one or more scores for the EDSS functional systems (FS) (e.g., one, two, three, four, five, six, or all seven individual scores for the EDSS FS chosen from visual, brainstem, cerebellar, motor, sensory, bladder/bowel or cognitive systems).
- FS EDSS functional systems
- the EDSS includes a score for ambulation.
- the EDSS includes a determination of a subject's ambulation that includes an assessment of one or more (or all) of: Unrestricted ambulation, e.g., without aid or rest for a predetermined distance (e.g., a distance greater or equal to 500, 300, 200, or 100 meters, or less than 200 or 100 meters); unilateral assistance; bilateral assistance; essentially or fully restricted to a wheelchair; or essentially or fully restricted to a bed.
- Unrestricted ambulation e.g., without aid or rest for a predetermined distance (e.g., a distance greater or equal to 500, 300, 200, or 100 meters, or less than 200 or 100 meters); unilateral assistance; bilateral assistance; essentially or fully restricted to a wheelchair; or essentially or fully restricted to a bed.
- the assessment of visual function is acquired by one or more of: e.g., visual acuity (e.g., low-contrast letter acuity (LCLA) or high contrast visual acuity), Visual Function Questionnaire (VFQ), a 10-Item Neuro-Ophthalmic Supplement (NOS- 10), Functional Acuity Contrast Testing (FACT), VEPs, such as FF-VEP or mfVEP (described e.g., in MacKay, AM (2008) Invest Ophthalmol Vis Sci. 49(1):438-41), optical coherence tomography (OCT), some of which are described in, e.g., Balcer et al. (2010) Neurology 74 Suppl 3:S 16-23; Bock, M. et al. (2012) Br J Ophthalmol. 96(l):62-7).
- visual acuity e.g., low-contrast letter acuity (LCLA) or high contrast visual acuity
- VFQ Visual Function
- the measure of cognitive function comprises an evaluation of a learning test, a memory test and/or an attention/processing speed test.
- the measure of cognitive function can include an evaluation of one or more of auditory memory, verbal learning and/or remembering visual information (e.g., Selective Reminding Test (SRT)); tests for evaluating auditory/verbal memory (e.g., California Verbal Learning Test Second Edition (CVLT2)), the Rey Auditory Verbal Learning Test (RAVLT); tests for evaluating visual/spatial memory (e.g., Brief Visuospatial Memory Test Revised (BVMTR)); processing speed cognitive tests, e.g., Paced Auditory Serial Addition Test (PASAT), Symbol Digit Modalities Test (SDMT); MSNQ-information, MSNQ-subject, and/or SF-36.
- SRT Selective Reminding Test
- CVLT2 California Verbal Learning Test Second Edition
- RAVLT Rey Auditory Verbal Learning Test
- BVMTR Brief Visuospati
- the measure of cognitive function is performed using a composite of MS cognitive endpoint that comprises SDMT, PASAT-3 and -3, SRT-Total Learned (SRT-TL), SRT Delayed Recall (SRT-DR), and BVMTR Delayed Recall (BVMTR-DR) (e.g., MS-COG as described in Cadavid et al confuse 29 th Congress European Committee for Treatment and
- the subject's lesion status is evaluated using magnetic resonance imaging.
- the magnetic resonance imaging comprises magnetization transfer ration and/or diffusion tensor imaging.
- an improvement in the subject is defined by one or more of: a. >1.0 point decrease in EDSS from a baseline score of ⁇ 6.0;
- the method further includes one or more of the following: (i) identifying the subject as being in need of a therapy, e.g., a therapy as described herein;
- administration step e.g., administration of the reparative agent and immunomodulatory agent
- subject monitoring and/or evaluating step can be performed in any order.
- the administration step occurs prior to the evaluating step.
- the evaluating step occurs prior to the administration step.
- the invention features a method of evaluating, e.g., diagnosing, a subject at risk of developing, a CNS demyelinating disorder (e.g., multiple sclerosis or optic neuritis, or both).
- the method includes acquiring a measure (e.g., detecting or measuring), one or both of optic nerve damage or optic nerve conductance for one or both eyes of the subject, wherein the presence of optic nerve damage and/or a delay in optic nerve conductance in one or both eyes indicates that the subject is at risk for developing the CNS demyelinating disorder.
- the subject has not been diagnosed with multiple sclerosis according to one or more of:
- EDSS Expanded Disability Status Scale
- MSFC Multiple Sclerosis Functional Composite
- the step of acquiring the measure of optic nerve damage comprises measuring visual evoked potential (VEP) amplitude, e.g., full field VEP (FF-VEP) amplitude and/or multi-field VEP (mfVEP) amplitude.
- VEP visual evoked potential
- FF-VEP full field VEP
- mfVEP multi-field VEP
- an mfVEP amplitude that is (i) at least 40 nanovolts lower than a control amplitude, (ii) at least 20% lower than a control amplitude, or (iii) less than or equal to 180 nanovolts indicates the presence of optic nerve damage in the eye(s) of the subject.
- the control amplitude can be the average VEP amplitude, e.g., FF-VEP amplitude and/or mfVEP amplitude, of a normal eye, e.g., an eye of a subject not having an optic nerve disorder or condition, e.g., acute optic neuritis.
- the step of of acquiring the measure of optic nerve conductance comprises measuring VEP latency, e.g., FF-VEP latency or mfVEP latency.
- VEP latency e.g., FF-VEP latency or mfVEP latency.
- a VEP latency (i) that is at least 3 milliseconds higher than a control latency, or (ii) that is at least 3% higher than a control latency; or (iii) an FF-VEP latency that is 110 milliseconds or higher, or (iv) an mfVEP latency that is 155 milliseconds or higher, indicates a delay in optic nerve conductance in the eye.
- control latency is the average VEP latency, e.g., FF-VEP latency or mfVEP latency, of a normal eye, e.g., an eye of a subject not having an optic nerve disorder or condition, e.g., acute optic neuritis. Kits and Compositions
- the invention features a kit that includes a reparative agent ⁇ e.g., a LINGO-1 antagonist, e.g., an anti-LINGO-1 antibody molecule as described herein).
- a reparative agent e.g., a LINGO-1 antagonist, e.g., an anti-LINGO-1 antibody molecule as described herein.
- the kit is labeled and/or contains instructions for use in treating or preventing a CNS disorder, e.g., a CNS demyelinating disease as described herein.
- a CNS disorder e.g., a CNS demyelinating disease as described herein.
- the LINGO-1 antagonist is instructed to be administered at one, two or all of the following:
- the kit further comprises a second agent, e.g., a second agent as described herein (e.g., an IFN- ⁇ 1 molecule) to be administered in combination with the LINGO- 1 antagonist.
- a composition e.g., a packaged composition
- a reparative agent e.g., a LINGO- 1 antagonist, e.g., an anti- LINGO-1 antibody molecule as described herein.
- composition is labeled and/or contains instructions for use of the reparative agent in treating or preventing a CNS disorder, e.g., a CNS demyelinating disease.
- a CNS disorder e.g., a CNS demyelinating disease.
- the LINGO- 1 antagonist is instructed to be administered at one, two or all of the following:
- the composition further comprises a second agent, e.g., a second agent as described herein (e.g., an IFN- ⁇ 1 molecule) to be administered in combination with the LINGO- 1 antagonist.
- a second agent e.g., a second agent as described herein (e.g., an IFN- ⁇ 1 molecule) to be administered in combination with the LINGO- 1 antagonist.
- the LINGO- 1 antagonist and/or the immunomodulatory agent of the compositions, kits and packaged compositions described herein can be in a form suitable for any route of administration, e.g. , peripheral administration (e.g. , intravenous, subcutaneous, intramuscular, intravitreal, intrathecal, or oral administration).
- the route of administration can be the same or different depending on the composition used.
- the packaged pharmaceutical composition includes a LINGO- 1 antagonist (e.g., an antibody against LINGO- 1) in a form or preparation suitable for intravenous administration.
- the packaged pharmaceutical composition includes an immunomodulatory agent (e.g., an interferon) in a form or preparation suitable for intramuscular administration.
- an immunomodulatory agent e.g., an interferon
- One or more agents can be included in the packaged pharmaceutical composition.
- FIG. 1 depicts the region of interest (ROI) selection for the quantification of optic nerve axonal density in the mouse model of experimental autoimmune encephalomyelitis (EAE).
- ROI region of interest
- FIG. 2A is a line graph showing the survival curve of EAE mice treated with vehicle or anti-LINGO-1 antibody.
- FIG. 2B is a line graph showing the development of complete paraplegia in EAE mice treated with vehicle or anti-LINGO-1 antagonist.
- FIGS. 3A-3F contain images of the coronal optic nerve diffusion imaging in mouse EAE. Diffusion direction is indicated by the small arrows. The right optic nerve location is indicated by the large arrows.
- FIG. 3A is an image of a T2 weighted localizer scan.
- FIG. 3B is an image of a diffusion weighted image perpendicular to the optic nerve.
- FIG. 3C is an image of a diffusion weighted scan parallel to the optic nerve.
- FIG. 3D is an image of a diffusion weighted image perpendicular to the optic nerve.
- FIG. 3E is an enlargement of the optic nerve image of FIG. 3B.
- FIG. 3F is an enlargement of the optic nerve image of FIG. 3D.
- FIG. 4 is a bar graph depicting the optic nerve integrity analyzed by diffusion tensor imaging (DTI) in mouse EAE.
- FIG. 5 depicts the histological analysis of the optic nerve in EAE mice treated with vehicle or anti-LINGO-1 antibody or healthy mice.
- FIG. 6 depicts the measurement of axonal loss in the optic nerve in EAE mice treated with vehicle or anti-LINGO-1 antibody or healthy mice.
- FIG. 6 includes measurements of optic nerve area 2 2
- peripheral axon count total central axo-plasmal area ( ⁇ ), and total peripheral axo-plasmal area ( ⁇ 2 ).
- FIG. 7 depicts histological analysis of sections of optic nerve detected by anti- ⁇ tubulin staining and DAPI, respectively, after the following treatments: treatment group (Veh + control Antibody), methylprednisolone (MP), anti-LINGO-1 antibody, and MP + anti- LINGO-1 antibody.
- FIG. 8 is a bar graph reflecting the axonal segment count/field in the treatment groups indicated.
- the anti-LINGO-1 monoclonal antibody treatment group (Veh + anti-LINGO-1 monoclonal antibody) showed 5-fold higher axonal numbers, suggesting that anti-LINGO-1 monoclonal antibody treatment prevented axonal loss (FIG. 8).
- the combination treatment group (MP + anti-LINGO-1 monoclonal antibody) showed an 8-fold increase in axonal numbers compared with the control treatment group (Veh + control Antibody.
- FIG. 9 is a schematic showing a clinical trial design (RENEW trial ClinicalTrials.gov Identifier: NCT01721161).
- FIG. 10 is a diagram depticting the nine sectors (corresponding to the early treatment diabetic retinopathy grid) used to calculate average retinal ganglion cell layer thickness.
- FIG. 11 is a chart showing rates of withdrawal and treatment discontinuation in the clinical trial.
- FIG. 12 is a bar graph showing the adjusted mean change in optic nerve conduction latency (measured by FF-VEP) in the affected eye compared with the unaffected fellow eye at baseline in the PP and ITT populations at week 32 (by MMRM) in the RENEW trial.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- FIG. 13 is a bar graph showing the mean RGCL/IPL thickness at each visit (measured by SD-OCT) in the affected eye in the ITT population up to week 32 in the RENEW trial.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- FIG. 14 is a bar graph showing the mean RGCL/IPL thickness at each visit (measured by SD-OCT) in the affected eye in the PP population up to week 32 in the RENEW trial.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- FIGS. 15A and 15B are bar graphs showing the adjusted mean change in RGCL/IPL thickness in the affected eye in the PP population at 4 weeks (A) and 24 weeks (B).
- the left bar of each set of bars refers to the group with FF- VEP latency recovery, and the right bar of each set of bars refers to the group without FF- VEP latency recovery.
- FIGS. 16A and 16B are bar graphs showing the adjusted mean change in optic nerve conduction latency (measured by FF-VEP) in the affected eye compared with the unaffected fellow eye at baseline in the PP populations in the RENEW trial in subjects ⁇ 33 years old (A) and in subjects > 33 years old (B).
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- FIG. 17 is a diagram depicting exemplary individual segments assessed using multifocal visual evoked potentials (mfVEP).
- FIGS. 18A and 18B are bar graphs showing the adjusted mean change in mfVEP latency compared with FF-VEP latency at week 24 in the affected eye compared with the unaffected fellow eye at baseline (by ANCOVA).
- CI confidence interval
- FF-VEP full- field visual evoked potentials
- ITT intent-to-treat
- mfVEP multifocal visual evoked potentials
- PP per-protocol in the RENEW trial.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- mfVEP latency is shown in 18A and FF-VEP latency is shown in 18B.
- FIGS. 19A and 19B are bar graphs showing the adjusted mean differences in mfVEP latency and amplitude at week 24 in subjects classified as having latency recovery using the primary endpoint measure, FF-VEP*.
- CI confidence interval
- FF-VEP full-field visual evoked potentials
- mfVEP multifocal visual evoked potentials
- FF-VEP latency was the primary endpoint in the RENEW trial.
- the adjusted mean difference in mfVEP latency is shown in 19A and the adjusted mean difference in mfVEP amplitude is shown in 19B.
- FIG. 20 is a bar graph showing mfVEP data for the unaffected fellow eye (mfVEP fellow eye average amplitude by treatment group-ITT analysis), demonstrating preservation of amplitude with anti-LINGO-1 treatment.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO- 1 group.
- FIG 21 is a series of heatmaps depicting the mean change in MF-VEP amplitude (nV) in the affected eye from baseline of the affected eye during treatment with anti-LINGO-1 antibody over 32 weeks.
- FIG 22 is a series of heatmaps depicting the mean change in MF-VEP amplitude (nV) in the unaffected eye from baseline of the unaffected eye during treatment with anti-LINGO-1 antibody over 32 weeks.
- FIGs. 23A, 23B, and 23C are graphs showing the change from baseline in mean (A) NEI VFQ-25 composite; (B) NOS-10; and (C) combined NEI VFQ-25 and NOS-10 composite scores to week 24 as analyzed by MMRM in the RENEW trial.
- FIG. 24 is a bar graph showing the percentage of patients with change in NEI VFQ-25 composite score who declined by > 4 points, sustained ⁇ 4 points, or improved > 4 points from baseline at week 24 in the RENEW trial.
- the left bar of each set of bars refers to the placebo group, and the right bar of each set of bars refers to the anti-LINGO-1 group.
- the invention is based, at least in part, on the discovery that a reparative agent (an anti-LINGO-1 antibody) is capable of increasing the remyelination of an optic nerve in patients after an onset (e.g., a first attack) of acute optic neuritis (AON), as well as preventing (e.g., delaying) the onset of new disease in the visual pathways served by both the normal (unaffected) and the affected eye.
- VEP e.g., FF- VEP and mfVEP
- VEP e.g., FF-VEP and mfVEP, and in particular, mfVEP
- VEP provides a way to diagnose patients at risk of developing MS earlier than using previously described methods.
- Methods such as VEP also provide a way to diagnose/identify patients at risk of developing AON, e.g., one or both eyes, earlier than using previously described methods.
- methods such as VEP provide a way to identify subjects that would most likely respond positively (e.g., have improved neuronal function) to a reparative agent described herein, e.g., anti-LINGO- 1.
- the methods described herein provide an early intervention to treat and/or prevent AON as well as MS, e.g., by preserving myelination or causing remyelination of damaged areas early in the disease.
- the methods described herein treat and/or prevent AON and/or MS in a subject before neuronal (e.g., axonal) damage, e.g., optic nerve damage in the subject.
- the methods described herein treat and/or prevent AON and/or MS in a subject before neuronal (e.g., axonal) damage and after demyelination of one or more nerves (e.g., an optic nerve) in the subject.
- the methods described herein prevent AON and/or MS in a subject before neuronal (e.g., axonal damage and before demyelination of one or more nerves (e.g., an optic nerve) in the subject, e.g., the subject has one eye affected by AON (with demyelination of the optic nerve) and one fellow normal eye that is asymptomatic (without demyelination of the optic nerve).
- neuronal e.g., axonal damage and before demyelination of one or more nerves (e.g., an optic nerve) in the subject, e.g., the subject has one eye affected by AON (with demyelination of the optic nerve) and one fellow normal eye that is asymptomatic (without demyelination of the optic nerve).
- kits comprising chronic and/or prophylactic administration of the reparative agent as a monotherapy or a combination therapy that can preserve neuronal function and/or neuronal tissue and/or prevent (e.g., delay) a disability in a subject, e.g., an MS or AON subject as described herein.
- chronic or prophylactic administration of the reparative agent may prevent the onset or delay the progressive form of the disease, e.g., AON or MS, for example, by reducing axonal /neuronal degeneration and/or demyelination.
- Inflammatory demyelinating CNS diseases such as MS
- MS are a common cause of nontraumatic neurological disability in young adults.
- therapies for MS are primarily immunomodulatory, and do not have detectable direct effects on CNS repair.
- the current standard of care for patients with relapsing MS includes the use of immunomodulatory drugs to reduce the frequency and severity of relapses and the
- immunomodulatory drugs are currently available for relapsing MS, including, but not limited to, different preparations of interferon ⁇ (interferon ⁇ -la given intramuscularly [EVI] [Avonex] or subcutaneously [SC] [Rebif®], interferon ⁇ -lb [Betaseron/Betaferon®/Extavia®]), glatiramer acetate (Copaxone®), natalizumab (Tysabri®), and fingolimod (Gilenya®). Short courses of corticosteroids are occasionally given with mixed success.
- Chemotherapeutic agents such as mitoxantrone and cyclophosphamide, are occasionally used in cases of severe relapsing MS. Although some degree of axonal remyelination by oligodendrocytes takes place early during the course of MS, the ability to endogenously repair the CNS often fails, leading to irreversible tissue injury and an increase in disease-related disability.
- antagonizing LINGO- 1 with an anti-LINGO-1 antibody can enhance remyelination and neuroaxonal protection in the CNS.
- An anti-LINGO-1 antibody can reach the CNS in sufficient concentrations to block LINGO- 1 in both axons and oligodendroyctes after peripheral administration. This in turn, can enhance remyelination via differentiation of oligodendrocyte precursor cells (OPC) normally present in the brain of MS patients.
- OPC oligodendrocyte precursor cells
- Binding of an anti-LINGO-1 antibody to LINGO- 1 in axons and neurons can also provide neuroaxonal protection via blockade of signaling by myelin debris on the Nogo66 receptor- l(NgRl)/p75/LINGO-l receptor complex in the CNS. It has been proposed that the failure of axonal repair/neurite regeneration in MS can be due, at least in part, to signaling of myelin debris on the NgRl/p75/LINGO-l complex and the NgRl/TROY/LINGO-1 complex in damaged axons (Mi et al. (2004) Nat Neurosci, 7: 221-8).
- NgRl receptor complex Signaling on the NgRl receptor complex may interfere not only with axonal regeneration (Yamashita et al. (2005) Mol Neurobiol, 32: 105-11), but also with neuronal survival following neuroaxonal injury (Mi et al. (2004) Nat Neurosci, 7: 221-8; Fu et al. (2008) Invest Opthalmol Vis Sci, 49: 975-85; Zhao et al. (2008) Cell Mol Neurobiol, 28: 727-35).
- the efficacy of an anti-LINGO-1 antibody treatment in pre-existing lesions is supported by (1) the finding that OPCs are found in chronically demyelinated MS lesions, (2) animal studies that show the ability of chronically demyelinated brain lesions to be remyelinated, and (3) studies showing the enhancement of remyelination by LINGO- 1 blockade in established
- demyelinated lesions ⁇ e.g., in the Cuprizone model.
- antagonism of LINGO- 1 with an anti-LINGO-1 antibody can enhance remyelination and neuroaxonal protection (thus, preventing axonal degeneration) in CNS demyelinating diseases, such as MS and acute optic neuritis, leading to improved CNS repair with corresponding beneficial effects on neurological function and disability.
- an anti- LINGO-1 antibody does not have detectable immunomodulatory effects on the inflammatory component of MS pathogenesis, concurrent administration with an immunomodulatory agent is desirable. Therefore, combination treatments of an immunomodulatory agent, e.g., IFN- ⁇ agent, e.g., Avonex®; with a reparative agent, e.g., anti-LINGO-1 antibody, are disclosed.
- the present invention provides, at least in part, methods, composition and kits for enhancing one or more of: myelination, re-myelination, oligodendrocyte numbers, or neuroaxonal protection in a subject, e.g., a human ⁇ e.g., a human MS patient), while ameliorating an inflammatory condition in the subject.
- a subject e.g., a human ⁇ e.g., a human MS patient
- Such methods, compositions and kits described herein are useful for treating a CNS disorder, e.g., a CNS demyelinating disease.
- methods, composition and kits include a reparative agent ⁇ e.g., a LINGO-1 antagonist) and an immunomodulatory agent, in combination, as described herein.
- the reparative agent ⁇ e.g., a LINGO-1 antagonist
- the reparative agent can be used to treat an inflammatory condition of the optic nerve, e.g., optic neuritis ⁇ e.g., acute optic neuritis (AON).
- optic neuritis e.g., optic neuritis ⁇ e.g., acute optic neuritis (AON).
- AON acute optic neuritis
- the term "reparative agent" as used herein includes any agent that causes one or more of: enhances myelination, re- myelination, enhances neuroaxonal protection, increases axonal extension, increases neuronal sprouting, and/or promotes oligodendrocyte numbers (e.g., by increasing one or more of: survival or differentiation of oligodendrocytes), without having a substantial (e.g., a detectable) immunomodulatory effect.
- the reparative agent is a LINGO- 1 antagonist, e.g., a LINGO- 1 antagonist as described herein.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- proteins and “polypeptides” are used interchangeably herein.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- Acquire or “acquiring” as the terms are used herein, refer to obtaining possession of, determining, or evaluating, a desired result, e.g., a value, e.g., a numerical value, by “directly acquiring” or “indirectly acquiring” the result.
- Directly acquiring means performing a process (e.g., performing a test, e.g., a measure of upper and/or lower extremity function, and/or ambulatory function) to obtain the result, e.g., the value.
- Indirectly acquiring refers to receiving the result, e.g., the value, from another party or source (e.g., a third party clinician or health professional that directly acquired the value).
- a “CNS disorder” (e.g., a “CNS demyelinating disease”) can be any disease, disorder or injury associated with one or more of: demyelination, dysmyelination, axonal injury, and/or dysfunction or death of an oligodendrocyte or a neuronal cell, or loss of neuronal synapsis/connectivity.
- the CNS disorder affects the nervous system by causing damage to the myelin sheath of axons.
- the CNS disorder includes Nogo receptor-1 (NgRl-) mediated inhibition of axonal extension or neurite extension, e.g., in the brain and spinal cord.
- the CNS disorder has one or more inflammatory components.
- the CNS disorder e.g., the CNS demyelinating disease
- the CNS disorder is multiple sclerosis.
- the CNS disorder e.g., the CNS demyelinating disease
- the CNS disorder (e.g., the CNS demyelinating disease) is "treated,” “inhibited” or “reduced,” if at least one symptom of the disease or disorder is reduced, alleviated, terminated, slowed, or prevented. Treatment or prevention need not be 100%, and in some embodiments a reduction or delay in at least one symptom of the disease or disorder by at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% is sufficient to be considered within these terms.
- the CNS disorder is "prevented” if at least one symptom of the disease or disorder is delayed, e.g., by about 4 weeks, 8 weeks, 12 weeks, 24 weeks, 36 weeks, 48 weeks, 1 year, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, or more.
- the CNS disorder is prevented if initial onset (e.g., first occurrence of a symptom) of the disorder is delayed, e.g., by about 4 weeks, 8 weeks, 12 weeks, 24 weeks, 36 weeks, 48 weeks, 1 year, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, or more.
- an optic nerve condition or disorder e.g., optic neuritis, e.g., acute optic neuritis
- optic neuritis e.g., acute optic neuritis
- an optic nerve condition or disorder e.g., optic neuritis, e.g., acute optic neuritis
- optic neuritis e.g., acute optic neuritis
- initial onset e.g., first occurrence of a symptom
- initial onset e.g., first occurrence of a symptom
- initial onset e.g., first occurrence of a symptom
- initial onset e.g., first occurrence of a symptom
- the optic nerve condition or disorder is delayed in one or both eyes, e.g., by about 4 weeks, 8 weeks, 12 weeks, 24 weeks, 36 weeks, 48 weeks, 1 year, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, or more, i.e., if function is preserved for a period of time.
- optic neuritis is prevented in a normal fellow eye that does not show symptoms of optic neuritis if at least one symptom of the optic neuritis is delayed in the normal fellow eye, e.g., by about 4 weeks, 8 weeks, 12 weeks, 24 weeks, 36 weeks, 48 weeks, 1 year, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, or more.
- optic neuritis is prevented in a normal fellow eye that does not show symptoms of optic neuritis if initial onset (e.g., first occurrence of a symptom) of the optic neuritis is delayed in the normal fellow eye, e.g., by about 4 weeks, 8 weeks, 12 weeks, 24 weeks, 36 weeks, 48 weeks, 1 year, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, or more.
- an optic nerve condition or disorder e.g., optic neuritis, e.g., acute optic neuritis
- optic neuritis e.g., acute optic neuritis
- an optic nerve condition or disorder is "treated,” “inhibited,” or “reduced,” if recurrence or relapse of the disease is reduced, retarded, slowed, delayed, or prevented.
- Exemplary clinical symptoms of acute optic neuritis that can be used to aid in determining disease status in a subject can include, e.g., visual loss, edema, inflammation, damage or demyelination of the myelin sheath covering the optic nerve and axons, loss of retinal fiber layer, loss of retinal ganglion cell layer, visual field defect, color desaturation, decreased color vision, ocular pain, decreased visual acuity,
- clinical outcomes can be used to aid in determining disease status in a subject, e.g., optic nerve damage (e.g., as measured by full field visual evoked potential amplitude or multi-focal visual evoked potential), optic nerve latency (e.g., as measured by full field visual evoked potential or multi-focal visual evoked potential), thickness of retinal layers such as retinal nerve fiber layer or retinal ganglion cell layer (e.g., as measured by spectral domain optical coherence tomography), visual function (e.g., as measured by visual acuity, e.g., low contrast or high contrast letter acuity), or visual quality of life (e.g., as measured by a patient reported outcome test, e.g., a NIH-NEI visual functional questionnaire or a neuro-ophthalmic supplement, NOS - 10) .
- optic nerve damage
- normal eye e.g., a "normal fellow eye” is an eye in a subject that does not show one or more symptoms of an optic nerve condition or disorder, e.g., optic neuritis, e.g., acute optic neuritis.
- multiple sclerosis is "treated,” “inhibited,” or “reduced,” if recurrence or relapse of the disease is reduced, slowed, delayed, or prevented.
- Exemplary clinical symptoms of multiple sclerosis that can be used to aid in determining the disease status in a subject can include e.g., tingling, numbness, muscle weakness, loss of balance, blurred or double vision, slurred speech, sudden onset paralysis, lack of coordination, cognitive difficulties, fatigue, heat sensitivity, spasticity, dizziness, tremors, gait abnormalities, speech/swallowing difficulties, and extent of lesions assessed by imaging techniques, e.g., MRI.
- Clinical signs of MS are routinely classified and standardized, e.g., using an EDSS rating system based on neurological examination and long distance ambulation.
- a decrease of one full step indicates an effective MS treatment (Kurtzke, Ann. Neurol. 36:573-79, 1994), while an increase of one full step will indicate the progression or worsening of the disease (e.g., exacerbation).
- a half a point typically indicates improvement (a reduction) or worsening (an increase).
- EDSS Extended Disability Status Scale
- EDSS is a rating system that is frequently used for classifying and standardizing MS.
- the accepted scores range from 0 (normal) to 10 (death due to MS).
- patients having an EDSS score of about 4-6 will have moderate disability (e.g., limited ability to walk), whereas patients having an EDSS score of about 7 or 8 will have severe disability (e.g., will require a wheelchair).
- EDSS scores in the range of 1-3 refer to an MS patient who is fully ambulatory, but has some signs in one or more functional systems; EDSS scores in the range higher than 3 to 4.5 show moderate to relatively severe disability; an EDSS score of 5 to 5.5 refers to a disability impairing or precluding full daily activities; EDSS scores of 6 to 6.5 refer to an MS patient requiring intermittent to constant, or unilateral to bilateral constant assistance (cane, crutch or brace) to walk; EDSS scores of 7 to 7.5 means that the MS patient is unable to walk beyond five meters even with aid, and is essentially restricted to a wheelchair; EDSS scores of 8 to 8.5 refer to patients that are restricted to bed; and EDSS scores of 9 to 10 mean that the MS patient is confined to bed, and progressively is unable to communicate effectively or eat and swallow, until death due to MS.
- a "disease progression” includes a measure (e.g., one or more measures) of a worsening of one or more symptoms and/or disability in a subject.
- disease progression is evaluated as a steady worsening of one or more symptoms and/or disability over time, as opposed to a relapse, which is relatively short in duration.
- the disease progression is evaluated in a subject with a relapsing form of MS (e.g., RRMS) or a progressive form of MS (e.g., a subject with primary or secondary progressive multiple sclerosis (PPMS or SPMS, respectively), or a subject with progressive-relapsing MS (PRMS)).
- a relapsing form of MS e.g., RRMS
- PPMS or SPMS primary or secondary progressive multiple sclerosis
- PRMS progressive-relapsing MS
- the disease progression is evaluated in a subject with an optic nerve condition or disorder, e.g., optic neuritis, e.g., acute optic neuritis, e.g., in one or both eyes.
- an optic nerve condition or disorder e.g., optic neuritis, e.g., acute optic neuritis, e.g., in one or both eyes.
- the evaluation of disease progression includes a measure of a clinical symptom or outcome of acute optic neuritis described herein.
- the evaluation of disease progression includes a measure of upper extremity function (e.g., a 9HP assessment). Alternatively or in combination, disease progression includes a measure of lower extremity function. Alternatively or in combination, disease progression includes a measure of ambulatory function, e.g., short distance ambulatory function (e.g., T25FW). Alternatively or in combination, disease progression includes a measure of ambulatory function, e.g., longer distance ambulatory function (e.g., a 6-minute walk test). In one embodiment, the disease progression includes a measure of ambulatory function other than EDSS ambulatory function.
- disease progression includes a measure of upper extremity function (e.g., a 9HP assessment) and a measure of ambulatory function, e.g., short distance ambulatory function (e.g., T25FW).
- disease progression includes a measure of upper extremity function (e.g., a 9HP assessment) and a measure of lower extremity function.
- disease progression includes a measure of upper extremity function (e.g., a 9HP assessment), a measure of lower extremity function, and a measure of ambulatory function, e.g., short distance ambulatory function (e.g., T25FW) and/or longer distance ambulatory function (e.g., a timed (e.g., 6-minute) walk test (e.g., 6MWT)).
- a measure of upper extremity function e.g., a 9HP assessment
- a measure of lower extremity function e.g., a measure of ambulatory function
- a measure of ambulatory function e.g., short distance ambulatory function (e.g., T25FW) and/or longer distance ambulatory function (e.g., a timed (e.g., 6-minute) walk test (e.g., 6MWT)
- T25FW short distance ambulatory function
- 6MWT timed walk test
- the measure of ambulatory function e.g., short distance ambulatory function (e.g., T25FW) or longer distance ambulatory function (e.g., a timed (e.g., 6-minute) walk test (e.g., 6MWT)) and/or measure of upper extremity function (e.g., a 9HP assessment) can further be used in combination with the EDSS to evaluate MS, e.g., progressive forms of MS.
- a progressor is a subject who possesses a disease progression value reflecting at least one, two or all of the following criteria: a. confirmed progression in T25FW: Time taken for 25-foot walk increased by at least 15% or 20% of the baseline walk, confirmed at a second time point at least 3, 4, 5, or 6 months apart;
- a timed walk test e.g., 6MWT
- c. confirmed progression in 9HP Time taken for 9-hole peg increased by at least 15% or 20% of the time taken at baseline, confirmed at a second time point at least 3, 4, 5, or 6 months apart.
- the progression in 9HP can occur on either hand, but will have to be confirmed on the same hand; and/or
- EDSS total score increase from baseline by at least 1 point, if the change in EDSS total score is determined (or primarily determined) by evaluating a change in neurological function (e.g., one or more changes in neurological systems); and/or
- EDSS total score is determined (or primarily determined) by a change in ambulatory function, if either or both of (i) or (ii) is/are confirmed on a second examination at least 3, 4, 5 or 6 months apart (typically, at least 6 months apart).
- Baseline values for the aforementioned tests can be determined using the best baseline value or the average baseline value.
- Baseline refers to a value or measurement prior to administration of a therapy, e.g., a therapy described herein.
- baseline with respect to a “fellow eye” refers to a value or measurement of the eye of a subject other than the affected eye (e.g., affected by an optic nerve condition or disorder, e.g., optic neuritis), prior to administration of a therapy, e.g., a therapy described herein.
- Responsiveness to “respond” to a treatment, and other forms of this term, as used herein, refer to the reaction of a subject to treatment with a therapy as described.
- an MS subject responds to therapy if at least one symptom of multiple sclerosis (e.g., disease worsening) in the subject is reduced or retarded by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more.
- an MS subject responds to a therapy, if at least one symptom of multiple sclerosis in the subject is reduced by about 5%, 10%, 20%, 30%, 40%, 50% or more as determined by any appropriate measure, e.g., one or more of: a measure of upper or lower extremity function, a measure of ambulatory function, or an assessment of Expanded Disability Status Scale (EDSS).
- EDSS Expanded Disability Status Scale
- an MS subject responds to treatment with a therapy, if the subject has an increased time to
- an improvement in the subject is defined by one or more of: a. >1.0 point decrease in EDSS from a baseline score of ⁇ 6.0;
- a subject with optic neuritis responds to treatment with a therapy if at least one symptom of optic neuritis in the subject is reduced or retarded by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more.
- a subject with acute optic neuritis responds to a therapy if at least one symptom of acute optic neuritis in the subject is reduced by about 5%, 10%, 20%, 30%, 40%, 50% or more as determined by any appropriate measure, e.g., one or more of: a measure of optic nerve damage, a measure of optic nerve latency, a measure of thickness of retinal layer, a measure of visual function, or a measure of visual quality of life.
- a “non-responder” or “progressor” refers to a subject, e.g., an MS patient or optic neuritis (e.g., acute optic neuritis) patient, if in response to a therapy (e.g., a therapy described herein), at least one symptom or disability of e.g., multiple sclerosis or optic neuritis (e.g., acute optic neuritis), in the subject is reduced by less than about 5%, as determined by any appropriate measure, e.g., one or more of: a measure of upper or lower extremity function, a measure of ambulatory function, a measure of cognitive function, an assessment of Expanded Disability Status Scale (EDSS), a measure of optic nerve damage, a measure of optic nerve latency, a measure of thickness of retinal layer, a measure of visual function, or a measure of visual quality of life.
- a therapy e.g., a therapy described herein
- compositions and kits disclosed herein encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a sequence described herein are termed substantially identical.
- nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- nucleotide sequences having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a sequence described herein are termed substantially identical.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid "homology”).
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences.
- search can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25:3389-3402.
- XBLAST and NBLAST the default parameters of the respective programs. See http://www.ncbi.nlm.nih.gov.
- fragments, derivatives, analogs, or variants of the polypeptides are also included.
- fragment include any polypeptides which retain at least some of the properties of the corresponding native polypeptide. Fragments of polypeptides include proteolytic fragments, as well as deletion fragments.
- variants include proteolytic fragments, as well as deletion fragments.
- variants include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants may occur naturally or be non-naturally occurring. Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
- Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions.
- the term "functional variant” refers polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- compositions and kits described herein include a combination of a reparative agent (e.g., a LINGO- 1 antagonist) and an immunomodulatory agent.
- the reparative agent is an antagonist of LRR and Ig domain-containing, Nogo receptor- interacting protein ("LINGO,” e.g., LINGO- 1).
- LINGO LRR and Ig domain-containing, Nogo receptor- interacting protein
- the LINGO- 1 antagonist can inhibit or reduce the expression or activity of LINGO-1, e.g., human LINGO-1.
- the LINGO-1 antagonist inhibits or reduces the formation and/or activity of a complex (e.g., a functional signaling complex) of the NgRl, p75, and LINGO-1; and/or NgRl, TAJ (TROY), and LINGO-1.
- a complex e.g., a functional signaling complex
- the LINGO-1 antagonist inhibits or reduces LINGO-1 binding to NgRl.
- LINGO-1 previously called Sp35, is a cell surface glycoprotein that is selectively expressed in the adult CNS in neurons and oligodendrocytes.
- LINGO-1 is a member of a protein family comprising 3 other paralogs: LINGO-2 (GI: 12309630, 61% protein identity), LINGO-3 (GI: 23342615, 56% identity) and LINGO-4 (GI: 21211752, 44% identity).
- LINGO-1 is highly conserved evolutionarily with human and mouse orthologues sharing 99.5% identity.
- Northern blot analysis LINGO-1 was found to be highly expressed in human brain and was not detectable in non-neural tissues (Barrette et al. (2007) Mol Cell Neurosci, 34: 519-38; Carim-Todd et al. (2003) Eur Journal Neurosci, 18: 3167-82; Llorens et al. (2008) Dev Neurobiol, 68: 521-41; Mi et al. (2004) Nat Neurosci, 7: 221-8; Okafuji et al. (2005) Gene Expr Patterns, 6: 57-62; Park et al.
- LINGO-1 has also been described in detail in International Applications PCT/US2006/026271, filed Jul. 7, 2006, PCT/US2004/008323, filed Mar. 17, 2004, PCT/US2005/022881, filed Jun. 24, 2005 and PCT/US2008/000316, filed Jan. 9, 2008, each of which is incorporated by reference in its entirety herein.
- LINGO-1 is selectively expressed in both oligodendrocyte precursor cells (OPCs) and neurons.
- OPCs oligodendrocyte precursor cells
- LINGO-1 functions as a negative regulator of oligodendrocyte differentiation myelination, and remyelination; preventing myelination of axons by oligodendrocytes (Lee et al. (2007) JNeurosci, 27: 220-5; Mi et al. (2005) Nat Neurosci, 8: 745-51; Mi et al. (2008) Int Journal Biochem Cell Biol 40(10): 1971-8; Mi et al. (2009) Ann Neurology, 65: 304-15). Axonal and neuronal expression of LINGO- 1 increases after injury (Ji et al. (2006) Mol Cell Neurosci, 33: 311-20). LINGO-1 expression prevents myelination of axons by OPCs
- oligodendrocytes oligodendrocytes.
- LINGO-1 antagonism to enhance CNS remyelination and neuroaxonal protection in animal models of toxic (Cuprizone) (Mi et al. (2009) Ann Neurology, 65: 304-15), chemical injury
- LPC lysophosphatidylcholine
- MOG-EAE myelin oligodendrocyte glycoprotein- experimental autoimmune encephalomyelitis
- Remyelination and neuroaxonal protection can be provided via blockade of signaling by myelin debris and/or sulfated proteoglycans on the NgRl receptor complex in the CNS caused by the inhibition of LINGO-1 in axons and oligodendroyctes.
- oligodendrocyte precursor cells OPCs
- antagonism of LINGO-1 can enhance myelination or re-myelination of axons, e.g., by oligodendrocytes, and enhance neuroaxonal protection in the CNS, and for example, in CNS demyelinating diseases such as multiple sclerosis (MS) and acute optic neuritis, leading to improved CNS repair.
- MS multiple sclerosis
- acute optic neuritis leading to improved CNS repair.
- LINGO-1 is also known in the art by the names LRRN6, LRRN6A, FLJ 14594, LERN1, MGC17422 and UNQ201.
- the human, full-length wild-type LINGO-1 polypeptide contains an LRR domain consisting of 14 leucine-rich repeats (including N- and C-terminal caps), an Ig domain, a transmembrane region, and a cytoplasmic domain.
- the cytoplasmic domain contains a canonical tyrosine phosphorylation site.
- the naturally occurring LINGO-1 protein contains a signal sequence, a short basic region between the LRR-C- terminal domain (LRRCT) and Ig domain, and a transmembrane region between the Ig domain and the cytoplasmic domain.
- the human LINGO-1 gene (SEQ ID NO:52) contains alternative translation start codons, so that six additional amino acids, i.e., MQVSKR (SEQ ID NO:87) may or may not be present at the N-terminus of the LINGO-1 signal sequence.
- Table 2 lists the LINGO-1 domains and other regions, according to amino acid residue number, based on the LINGO- 1 amino acid sequence presented herein as SEQ ID NO: 51.
- the LINGO- 1 polypeptide is characterized in more detail in PCT Publication No. WO 2004/085648, which is incorporated herein by reference in its entirety.
- LINGO- 1 Tissue distribution and developmental expression of LINGO- 1 has been studied in humans and rats.
- LINGO- 1 biology has been studied in an experimental animal (rat) model. Expression of rat LINGO- 1 is localized to neurons and oligodendrocytes, as determined by northern blot and immuno-histochemical staining. Rat LINGO- 1 mRNA expression level is regulated developmentally, peaking shortly after birth, i.e., ca. postnatal day one. In a rat spinal cord transection injury model, LINGO- 1 is up-regulated at the injury site, as determined by RT-PCR. See Mi et al. Nature Neurosci. 7:221-228 (2004).
- amino acids comprising the various structural and functional domains of a LINGO- 1 polypeptide
- the term "about” includes the particularly recited value and values larger or smaller by several (e.g., 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1) amino acids. Since the location of these domains as listed in Table 2 have been predicted by computer graphics, one of ordinary skill would appreciate that the amino acid residues constituting the domains may vary slightly (e.g., by about 1 to 15 residues) depending on the criteria used to define the domain.
- LINGO- 1 Full-length, wild-type LINGO- 1 binds to NgRl . See PCT Publication No. WO 2004/085648. LINGO- 1 is expressed in oligodendrocytes and that the LINGO- 1 protein is involved in the regulation of oligodendrocyte-mediated myelination of axons. See U.S Patent Publication No. 2006/0009388 Al, which is incorporated herein by reference in its entirety.
- nucleotide sequence for the full-length LINGO- 1 molecule is as follows:
- the antibody molecule binds to LINGO, e.g., human LINGO. In another embodiment, the antibody molecule binds to LINGO- 1, e.g., human LINGO- 1.
- the antibody molecule is isolated, purified or recombinant.
- an "isolated" polypeptide or a fragment, variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required.
- an isolated polypeptide can be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- antibody molecule refers to a protein comprising at least one immunoglobulin variable domain sequence.
- the term antibody molecule includes, for example, full-length antibodies, mature antibodies, fragments, e.g., antigen-binding fragments of an antibody, derivatives, analogs, or variants of the antibodies disclosed herein, and any combination thereof.
- fragment when referring to LINGO- 1 antibody molecules or antibody polypeptides include any polypeptides which retain at least some of the antigen-binding properties of the corresponding native antibody or polypeptide. Fragments of polypeptides include proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein. Variants of LINGO- 1 antibody and antibody polypeptides include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants may occur naturally or be non-naturally occurring. Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
- Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions.
- Derivatives of LINGO- 1 antibody molecules and antibody polypeptides are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins.
- polypeptide refers to a subject polypeptide having one or more residues chemically derivatized by reaction of a functional side group. Also included as “derivatives" are those peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. For example, 4-hydroxyproline may be substituted for proline; 5- hydroxylysine may be substituted for lysine; 3-methylhistidine may be substituted for histidine; homoserine may be substituted for serine; and ornithine may be substituted for lysine.
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence
- an antibody molecule includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab') 2 , Fc, Fd, Fd', Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgGl, IgG2, IgG3, and IgG4) of antibodies.
- the antibody molecules can be monoclonal or polyclonal.
- the antibody can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody can be derived from a variable region of the immunoglobulin found in fish, such as, for example, that which is derived from the immunoglobulin isotype known as Novel Antigen Receptor (NAR) found in the serum of shark.
- NAR Novel Antigen Receptor
- Methods of producing single domain antibodies derivied from a variable region of NAR are described in WO 03/014161 and Streltsov (2005) Protein Sci. 14:2901- 2909.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
- variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- VH and VL regions can be subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- the extent of the framework region and CDRs has been precisely defined by a number of methods (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; and the AbM definition used by Oxford Molecular's AbM antibody modelling software. See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains.
- Each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- an "immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally- occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to LINGO- 1, or an epitope thereof. With respect to proteins (or protein mimetics), the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to LINGO- 1. Typically, the antigen-binding site of an antibody molecule includes at least one or two CDRs, or more typically at least three, four, five or six CDRs.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An "effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum ⁇ see, e.g., Saleh et al., Cancer Immunol. Immunother., 32: 180-190 (1990)) and also because of potential allergic reactions ⁇ see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- the antibody molecule can be a monoclonal or single specificity antibody, or an antigen-binding fragment thereof ⁇ e.g., an Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent or bispecific antibody or fragment thereof, a single domain variant thereof) that binds to LINGO-1, e.g., a mammalian (e.g., human LINGO-1 (or a functional variant thereof)).
- the antibody molecule is a monoclonal antibody against LINGO-1, e.g., human LINGO-1.
- the antibody molecule is a human, humanized, a CDR-grafted, chimeric, camelid, or in vitro generated antibody to human LINGO-1 (or functional fragment thereof, e.g., an antibody fragment as described herein).
- the antibody inhibits, reduces or neutralizes one or more activities of LINGO- 1 (e.g., one or more biological activities of LINGO-1 as described herein).
- the antibody molecule specifically binds to the same, or substantially the same, LINGO- 1 epitope as the reference monoclonal antibody Li62 or Li81, described in U.S. Patent No. 8,058,406, incorporated by reference in its entirety herein.
- antibody molecule includes at least the antigen-binding domains of Li62, Li81.
- antigen binding domain includes a site that specifically binds an epitope on an antigen (e.g., an epitope of LINGO- 1).
- the antigen binding domain of an antibody typically includes at least a portion of an immunoglobulin heavy chain variable region and at least a portion of an immunoglobulin light chain variable region. The binding site formed by these variable regions determines the specificity of the antibody.
- the anti- LINGO- 1 antibody molecule competitively inhibits Li62 or Li81 from binding to LINGO- 1.
- the anti- LINGO-1 antibody molecule specifically or preferentially binds to a particular LINGO- 1 polypeptide fragment or domain.
- LINGO- 1 polypeptide fragments include, but are not limited to, a LINGO-1 polypeptide comprising, consisting essentially of, or consisting of amino acids 34 to 532; 34 to 417; 34 to 425; 34 to 493; 66 to 532; 66 to 417; 66 to 426; 66 to 493; 66 to 532; 417 to 532; 417 to 425 (the
- LINGO-1 basic region 417 to 493; 417 to 532; 419 to 493 (the LINGO-1 1 g region); or 425 to 532 of SEQ ID NO:51 ; or a LINGO-1 variant polypeptide at least 70%, 75%, 80%, 85%, 90%, or 95% identical to amino acids 34 to 532; 34 to 417; 34 to 425; 34 to 493; 66 to 532; 66 to 417; 66 to 426; 66 to 493; 66 to 532; 417 to 532; 417 to 425 (the LINGO-1 basic region); 417 to 493; 417 to 532; 419 to 493 (the LINGO- 11 g region); or 425 to 532 of SEQ ID NO:51.
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a LINGO- 1 peptide fragment comprising, consisting essentially of, or consisting of one or more leucine-rich-repeats (LRR) of LINGO- 1.
- LRR leucine-rich-repeats
- Such fragments include, for example, fragments comprising, consisting essentially of, or consisting of amino acids 66 to 89; 66 to 113; 66 to 137; 90 to 113; 114 to 137; 138 to 161; 162 to 185; 186 to 209; 210 to 233; 234 to 257; 258 to 281; 282 to 305; 306 to 329; or 330 to 353 of SEQ ID NO:51.
- Corresponding fragments of a variant LINGO- 1 polypeptide at least 70%, 75%, 80%, 85%, 90%, or 95% identical to amino acids 66 to 89; 66 to 113; 90 to 113; 114 to 137; 138 to 161; 162 to 185; 186 to 209; 210 to 233; 234 to 257; 258 to 281; 282 to 305; 306 to 329; or 330 to 353 of SEQ ID NO:51 are also contemplated.
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of one or more cysteine rich regions flanking the LRR of LINGO- 1.
- Such fragments include, for example, a fragment comprising, consisting essentially of, or consisting of amino acids 34 to 64 of SEQ ID NO:51 (the N-terminal LRR flanking region (LRRNT)), or a fragment comprising, consisting essentially of, or consisting of amino acids 363 to 416 of SEQ ID NO:51 (the C-terminal LRR flanking region (LRRCT)), amino acids
- Corresponding fragments of a variant LINGO-1 polypeptide at least 70%, 75%, 80%, 85%, 90%, or 95% identical to amino acids 34 to 64 and 363 to 416 of SEQ ID NO:51 are also contemplated.
- the anti- LINGO-1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 41 to 525 of SEQ ID NO:51; 40 to 526 of SEQ ID NO:51; 39 to 527 of SEQ ID NO:51; 38 to 528 of SEQ ID NO:51; 37 to 529 of SEQ ID NO:51; 36 to 530 of SEQ ID NO:51; 35 to 531 of SEQ ID NO:51 ; 34 to 531 of SEQ ID NO:51 ; 46 to 520 of SEQ ID NO:51 ; 45 to 521 of SEQ ID NO:51 ; 44 to 522 of SEQ ID NO:51 ; 43 to 523 of SEQ ID NO:51 ; and 42 to 524 of SEQ ID NO:51.
- the anti- LINGO-1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 1 to 33 of SEQ ID NO:51; 1 to 35 of SEQ ID NO:51; 34 to 64 of SEQ ID NO:51; 36 to 64 of SEQ ID NO:51; 66 to 89 of SEQ ID NO:51; 90 to 113 of SEQ ID NO:51; 114 to 137 of SEQ ID NO:51; 138 to 161 of SEQ ID NO:51; 162 to 185 of SEQ ID NO:51; 186 to 209 of SEQ ID NO:51; 210 to 233 of SEQ ID NO:51; 234 to 257 of SEQ ID NO:51; 258 to 281 of SEQ ID NO:51; 282 to 305 of SEQ ID NO:51; 306 to 329 of SEQ ID NO:51; 330 to 353 of SEQ ID NO:51; 363 to 416 of SEQ ID NO:51; 4
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 1 to 33 of SEQ ID NO:51; 1 to 35 of SEQ ID NO:51; 1 to 64 of SEQ ID NO:51; 1 to 89 of SEQ ID NO:51; 1 to 113 of SEQ ID NO:51; 1 to 137 of SEQ ID NO:51; 1 to 161 of SEQ ID NO:51; 1 to 185 of SEQ ID NO:51; 1 to 209 of SEQ ID NO:51; 1 to 233 of SEQ ID NO:51 ; 1 to 257 of SEQ ID NO:51 ; 1 to 281 of SEQ ID NO:51 ; 1 to 305 of SEQ ID NO:51 ; 1 to 329 of SEQ ID NO:51; 1 to 353 of SEQ ID NO:51; 1 to 416 of SEQ ID NO:51; 1 to 424 of SEQ ID NO:51 ; 1 to 493 of S
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 34 to 64 of SEQ ID NO:51 ; 34 to 89 of SEQ ID NO:51 ; 34 to 113 of SEQ ID NO:51 ; 34 to 137 of SEQ ID NO:51; 34 to 161 of SEQ ID NO:51; 34 to 185 of SEQ ID NO:51; 34 to 209 of SEQ ID NO:51 ; 34 to 233 of SEQ ID NO:51 ; 34 to 257 of SEQ ID NO:51 ; 34 to 281 of SEQ ID NO:51 ; 34 to 305 of SEQ ID NO:51 ; 34 to 329 of SEQ ID NO:51 ; 34 to 353 of SEQ ID NO:51; 34 to 416 of SEQ ID NO:51; 34 to 424 of SEQ ID NO:51; 34 to 493 of SEQ ID NO:51 ; and 34 to 551 of SEQ ID NO:
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 34 to 530 of SEQ ID NO:51 ; 34 to 531 of SEQ ID NO:51 ; 34 to 532 of SEQ ID NO:51 ; 34 to 533 of SEQ ID NO:51; 34 to 534 of SEQ ID NO:51; 34 to 535 of SEQ ID NO:51; 34 to 536 of SEQ ID NO:51 ; 34 to 537 of SEQ ID NO:51 ; 34 to 538 of SEQ ID NO:51 ; 34 to 539 of SEQ ID NO:51 ; 30 to 532 of SEQ ID NO:51 ; 31 to 532 of SEQ ID NO:51 ; 32 to 532 of SEQ ID NO:51 ; 33 to 532 of SEQ ID NO:51 ; 34 to 532 of SEQ ID NO:51 ; 35 to 532 of SEQ ID NO:51 ; 36 to 532 of SEQ
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 36 to 64 of SEQ ID NO:51 ; 36 to 89 of SEQ ID NO:51 ; 36 to 113 of SEQ ID NO:51 ; 36 to 137 of SEQ ID NO:51; 36 to 161 of SEQ ID NO:51; 36 to 185 of SEQ ID NO:51; 36 to 209 of SEQ ID NO:51 ; 36 to 233 of SEQ ID NO:51 ; 36 to 257 of SEQ ID NO:51 ; 36 to 281 of SEQ ID NO:51 ; 36 to 305 of SEQ ID NO:51 ; 36 to 329 of SEQ ID NO:51 ; 36 to 353 of SEQ ID NO:51 ; 36 to 416 of SEQ ID NO:51 ; 36 to 424 of SEQ ID NO:51 ; 36 to 493 of SEQ ID NO:51 ; and 36 to 551 of SEQ
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragments comprising, consisting essentially of, or consisting of amino acids 36 to 530 of SEQ ID NO:51; 36 to 531 of SEQ ID NO:51; 36 to 532 of SEQ ID NO:51 ; 36 to 533 of SEQ ID NO:51 ; 36 to 534 of SEQ ID NO:51 ; 36 to 535 of SEQ ID NO:51 ; 36 to 536 of SEQ ID NO:51 ; 36 to 537 of SEQ ID NO:51 ; 36 to 538 of SEQ ID NO:51; and 36 to 539 of SEQ ID NO:51.
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a fragment comprising, consisting essentially of, or consisting of amino acids 417 to 493 of SEQ ID NO:51; 417 to 494 of SEQ ID NO:51; 417 to 495 of SEQ ID NO:51; 417 to 496 of SEQ ID NO:51; 417 to 497 of SEQ ID NO:51; 417 to 498 of SEQ ID NO:51; 417 to 499 of SEQ ID NO:51; 417 to 500 of SEQ ID NO:51; 417 to 492 of SEQ ID NO:51; 417 to 491 of SEQ ID NO:51; 412 to 493 of SEQ ID NO:51; 413 to 493 of SEQ ID NO:51; 414 to 493 of SEQ ID NO:51; 415 to 493 of SEQ ID NO:51; 416 to 493 of SEQ ID NO:51; 411 to 493 of SEQ ID NO:51; 410 to 493
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a LINGO- 1 polypeptide comprising, consisting essentially of, or consisting of peptides of the Ig domain of LINGO- 1 or fragments, variants, or derivatives of such polypeptides.
- polypeptides comprising, consisting essentially of, or consisting of the following polypeptide sequences: ITXiX 2 X 3 (SEQ ID NO:88), ACXiX 2 X 3 (SEQ ID NO:89), VCXiX 2 X 3 (SEQ ID NO:90) and SPXiX 2 X 3 (SEQ ID NO:91) where Xi is lysine, arginine, histidine, glutamine, or asparagine, X 2 is lysine, arginine, histidine, glutamine, or asparagine and X 3 is lysine, arginine, histidine, glutamine, or asparagine.
- LINGO- 1 peptide fragments to which certain antibody molecules can bind include, those fragments comprising, consisting essentially of, or consisting of the following polypeptide sequences: SPRKH (SEQ ID NO:92), SPRKK (SEQ ID NO:93), SPRKR (SEQ ID NO:94), SPKKH (SEQ ID NO:95), SPHKH (SEQ ID NO:96), SPRRH (SEQ ID NO:97), SPRHH (SEQ ID NO:98), SPRRR (SEQ ID NO:99), SPHHH (SEQ ID NO: 100) SPKKK (SEQ ID NO: 101), LSPRKH (SEQ ID NO: 102), LSPRKK (SEQ ID NO: 103), LSPRKR (SEQ ID NO: 104), LSPKKH (SEQ ID NO: 105), LSPHKH (SEQ ID NO: 106), LSPRRH (SEQ ID NO: 107), LSPRHH (SEQ ID NO: 108), LSPRK
- LSPKKK SEQ ID NO: 111
- WLSPRKH SEQ ID NO: 112
- WLSPRKK SEQ ID NO: 113
- WLSPRKR SEQ ID NO: 114
- WLSPKKH SEQ ID NO: 115
- LINGO-1 polypeptides include the basic "RKH loop" (Arginine-Lysine- Histidine amino acids 456-458) in the Ig domain of LINGO-1.
- Additional LINGO-1 peptides which include a basic tripeptide are ITPKRR (SEQ ID NO: 122), ACHHK (SEQ ID NO: 123) and VCHHK (SEQ ID NO: 124).
- the anti- LINGO-1 antibody molecule specifically or preferentially binds to a LINGO-1 polypeptide comprising, consisting essentially of, or consisting of peptides of the Ig domain of LINGO-1 or fragments, variants, or derivatives of such polypeptides.
- peptides comprising, consisting essentially of, or consisting of the following polypeptide sequences: X 4 X 5 RKH (SEQ ID NO: 125), X 4 X 5 RRR (SEQ ID NO: 126), X 4 X 5 KKK (SEQ ID NO: 127), X 4 X 5 HHH (SEQ ID NO: 128), X 4 X 5 RKK (SEQ ID NO: 129), X 4 X 5 RKR (SEQ ID NO: 130), X 4 X 5 KKH (SEQ ID NO: 131), X 4 X 5 HKH (SEQ ID NO: 132), X 4 X 5 RRH (SEQ ID NO: 133) and X 4 X 5 RHH (SEQ ID NO: 134) where X 4 is any amino acid and X5 is any amino acid.
- the anti- LINGO-1 antibody molecule specifically or preferentially binds to a LINGO-1 polypeptide comprising, consisting essentially of, or consisting of peptides of the Ig domain of LINGO-1 or fragments, variants, or derivatives of such polypeptides.
- polypeptides comprising, consisting essentially of, or consisting of the following polypeptide sequences: ⁇ (SEQ ID NO: 135), ACX 6 X 7 X 8 (SEQ ID NO: 136), VCX 6 X 7 X 8 (SEQ ID NO: 137) and SPX 6 X 7 X 8 (SEQ ID NO: 138) where X 6 is lysine, arginine, histidine, glutamine, or asparagine, X 7 is any amino acid and X 8 is lysine, arginine, histidine, glutamine, or asparagine.
- a polypeptide comprising, consisting essentially of, or consisting of the following polypeptide sequence: SPRLH (SEQ ID NO: 139).
- the anti- LINGO- 1 antibody molecule specifically or preferentially binds to a LINGO- 1 polypeptide comprising, consisting essentially of, or consisting of peptides which contain amino acids 452-458 in the Ig domain of LINGO- 1, or derivatives thereof, wherein amino acid 452 is a tryptophan or phenylalanine residue.
- the anti-LINGO-1 antibody molecule specifically or preferentially binds to a LINGO- 1 polypeptide comprising, consisting essentially of, or consisting of peptides of the basic domain of LINGO- 1.
- a LINGO- 1 polypeptide comprising, consisting essentially of, or consisting of peptides of the basic domain of LINGO- 1.
- peptides comprising, consisting essentially of, or consisting of the following polypeptide sequences: RRARIRDRK (SEQ ID NO: 140), KKVKVKEKR (SEQ ID NO: 141), RRLRLRDRK (SEQ ID NO:142), RRGRGRDRK (SEQ ID NO: 143) and RRIRARDRK (SEQ ID NO: 144).
- antibodies produced which bind to any portion of LINGO- 1 can then be screened for their ability to act as an antagonist of LINGO- 1 and thus promote neurite outgrowth, neuronal and oligodendrocyte survival, proliferation and differentiation, as well as enhance myelination.
- Antibodies can be screened for oligodendrocyte/neuronal survival for example by using the methods described herein such as in Examples 11 or 12 or as described in PCT/US2008/000316, filed Jan. 9, 2008, and PCT/US2006/026271, filed Jul. 7, 2006, which are incorporated herein by reference in their entireties.
- antibodies can be screened for example by their ability to enhance myelination by using the methods described herein such as in Examples 2, 6, 9, 10, 11 or 13 or as described in PCT/US2008/000316 and/or PCT/US2006/026271. Finally, antibodies can be screened for their ability to promote oligodendrocyte proliferation and differentiation, as well as neurite outgrowth for example by using the methods described herein such as in Examples 4 or 5 or as described in
- PCT/US2008/000316 and/or PCT/US2006/026271 Other antagonist functions of antibodies of the present invention can be tested using other assays as described in the Examples of US 8,058,406, incorporated by reference herein.
- the anti-LINGO- 1 antibody molecule specifically or preferentially binds to at least one epitope of LINGO- 1, where the epitope comprises, consists essentially of, or consists of at least about four to five amino acids of SEQ ID NO:5, at least seven, at least nine, or between at least about 15 to about 30 amino acids of SEQ ID NO:5.
- the amino acids of a given epitope of SEQ ID NO:51 as described may be, but need not be contiguous or linear.
- the at least one epitope of LINGO- 1 comprises, consists essentially of, or consists of a non-linear epitope formed by the extracellular domain of LINGO- 1 as expressed on the surface of a cell or as a soluble fragment, e.g., fused to an IgG Fc region.
- the at least one epitope of LINGO- 1 comprises, consists essentially of, or consists of at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, between about 15 to about 30, or at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous or noncontiguous amino acids of SEQ ID NO:51, where the non-contiguous amino acids form an epitope through protein folding.
- the anti-LINGO-1 antibody molecule specifically or preferentially binds to at least one epitope of LINGO- 1, where the epitope comprises, consists essentially of, or consists of, in addition to one, two, three, four, five, six or more contiguous or non-contiguous amino acids of SEQ ID NO:51 as described above, and an additional moiety which modifies the protein, e.g., a carbohydrate moiety may be included such that the LINGO- 1 antibody binds with higher affinity to modified target protein than it does to an unmodified version of the protein. Alternatively, the LINGO- 1 antibody does not bind the unmodified version of the target protein at all.
- the anti-LINGO-1 antibody molecule specifically or preferentially binds to a LINGO- 1 polypeptide or fragment thereof, or a LINGO- 1 variant polypeptide, with an affinity characterized by a dissociation constant (K D ) which is less than the K D for said reference monoclonal antibody.
- K D dissociation constant
- the anti-LINGO-1 antibody molecule specifically or preferentially binds to at least one epitope of LINGO- 1 or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to an unrelated, or random epitope; binds preferentially to at least one epitope of LINGO- 1 or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope; competitively inhibits binding of a reference antibody which itself binds specifically or preferentially to a certain epitope of LINGO- 1 or fragment or variant described above; or binds to at least one epitope of LINGO- 1 or fragment or variant described above with an affinity characterized by a dissociation constant K D of less than about 5 x 10 "2 M, about 10 "2 M, about 5 x 10 "3 M, about 10 "3 M, about 5 x
- the anti-LINGO-1 antibody molecule binds LINGO- 1 polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5
- an antibody, or antigen- binding fragment, variant, or derivative thereof of the invention binds LINGO- 1 polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 x 10 "4 sec 1 , 10 "4 sec 1 , 5 x 10 "5 sec 1 , or 10 "5 sec 1 , 5 x 10 "6 sec 1 , 10 “6 sec 1 , 5 x 10 "7 sec 1 or 10 "7 sec 1 .
- the anti-LINGO-1 antibody molecule binds LINGO- 1 polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 10 3 M "1 sec “1 , 5 x 10 3 M “1 sec “1 , 10 4 M “1 sec “1 , 5 x 10 4 M “1 sec “1 .
- the antibody molecule binds LINGO- 1 polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 10 5 M “1 sec “1 , 5 x 10 5 M “1 sec “1 , 10 6 M “1 sec “1 , 5 x 10 6 M “1 sec “1 , or 10 7 M “1 sec , 5 x 10 7 M “1 sec “1 .
- the LINGO- 1 antibody molecule is an antagonist of LINGO- 1 activity.
- binding of an antagonist LINGO- 1 antibody to LINGO- 1, as expressed on neurons blocks myelin-associated neurite outgrowth inhibition or neuronal cell death.
- binding of the LINGO- 1 antibody to LINGO- 1, as expressed on oligodendrocytes blocks inhibition of oligodendrocyte growth or differentiation, or blocks demyelination or dysmyelination of CNS neurons.
- LINGO- 1 antibody molecules can be made from whole precursor or parent antibodies using techniques known in the art. Exemplary techniques are discussed in more detail herein.
- the antibody molecule can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating anti- LINGO- 1 antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International Publication No. WO
- the anti- LINGO- 1 antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- a rodent mouse or rat
- goat e.g., monkey
- camel antibody e.g., camel antibody.
- the non-human antibody can be a rodent
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g.,
- An anti- LINGO- 1 antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse.
- Chimeric, CDR-grafted, and humanized antibodies are within the invention.
- Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art. For example, a gene encoding the Fc constant region of a murine (or other species) monoclonal antibody molecule is digested with restriction enzymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fc constant region is substituted (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to LINGO- 1 or a fragment thereof.
- An antibody can be humanized by methods known in the art. Humanized antibodies can be generated by replacing sequences of the Fv variable region which are not directly involved in antigen binding with equivalent sequences from human Fv variable regions.
- Humanized or CDR-grafted antibodies can be produced by CDR- grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Patent 5,225,539; Jones et al. 1986 Nature 321:552-525;
- Humanized antibodies in which specific amino acids have been substituted, deleted or added.
- Humanized antibodies can have amino acid substitutions in the framework region, such as to improve binding to the antigen.
- a humanized antibody will have framework residues identical to the donor framework residue or to another amino acid other than the recipient framework residue.
- a selected, small number of acceptor framework residues of the humanized immunoglobulin chain can be replaced by the corresponding donor amino acids.
- Preferred locations of the substitutions include amino acid residues adjacent to the CDR, or which are capable of interacting with a CDR (see e.g., US 5,585,089).
- the anti- LINGO- 1 antibody can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target LINGO- 1 protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- LINGO- 1 antibody molecules can comprise a constant region which mediates one or more effector functions. For example, binding of the CI component of complement to an antibody constant region may activate the complement system. Activation of complement is important in the opsonisation and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and may also be involved in autoimmune
- FcR Fc receptor
- IgG gamma receptors
- IgE epsilon receptors
- IgA alpha receptors
- IgM mi receptors
- Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (also referred to herein as antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
- ADCC antibody-dependent cell-mediated cytotoxicity
- the anti-LINGO-1 antibody molecule in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as reduced effector functions, the ability to non-covalently dimerize, increased ability to localize at the site of a tumor, reduced serum half-life, or increased serum half-life when compared with a whole, unaltered antibody of approximately the same immunogenicity.
- certain antibodies for use in the diagnostic and treatment methods described herein are domain deleted antibodies which comprise a polypeptide chain similar to an immunoglobulin heavy chain, but which lack at least a portion of one or more heavy chain domains.
- one entire domain of the constant region of the modified antibody will be deleted, for example, all or part of the CH2 domain will be deleted.
- the Fc portion may be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region may be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
- the anti-LINGO-1 antibody molecules comprise, consist essentially of, or consist of an immunoglobulin heavy chain variable region (VH), where at least one of the CDRs of the heavy chain variable region, or at least two the CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain CDR1, CDR2, or CDR3 amino acid sequences of Li62 or Li81 or variants thereof as described in Table 3.
- VH immunoglobulin heavy chain variable region
- the CDR1, CDR2, and CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain CDR1, CDR2, and CDR3 amino acid sequences of Li62 or Li81 or variants thereof as described in Table 3.
- a heavy chain variable region of the invention has CDR1, CDR2, or CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 3.
- the anti-LINGO-1 antibody molecules comprise, consist essentially of, or consist of the VH polypeptide or a fragment thereof as described in Table 3, or an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto.
- WGRGTLVTVSS (SEQ ID NO:57) NO:2) (SEQ ID NO:21)
- WGRGTLVTVSS (SEQ ID NO:58) NO:2) (SEQ ID NO:22)
- WGRGTLVTVSS (SEQ ID NO:59) NO:2) (SEQ ID NO:23)
- WGRGTLVTVSS (SEQ ID NO:60) NO:2) (SEQ ID NO:24)
- WGRGTLVTVSS (SEQ ID NO:61) NO:2) (SEQ ID NO:25)
- WGRGTLVTVSS (SEQ ID NO:62) NO:2) (SEQ ID NO:26)
- VWGRGTLVTVSS (SEQ ID NO:63) NO:2) (SEQ ID NO:27)
- WGRGTLVTVSS (SEQ ID NO:64) NO:2) (SEQ ID NO:28)
- WGRGTLVTVSS (SEQ ID NO:65) NO:2) (SEQ ID NO:29)
- WGRGTLVTVSS (SEQ ID NO:66) NO:2) (SEQ ID NO:30)
- WGRGTLVTVSS (SEQ ID NO:68) NO:2) (SEQ ID NO:32)
- WGRGTLVTVSS (SEQ ID NO:69) NO:2) (SEQ ID NO:33)
- WGRGTLVTVSS (SEQ ID NO:70) NO:2) (SEQ ID NO:34)
- VRQAPGKGLEWVSVIGPSGGFTFYADSVKGRFTISRD K SEQ GFTFYA AFDI NSKNTLYLQMNSLRAEDTAVYYCATEGDNDAFDIW ID DSVKG (SEQ ID GQGTTVTVSS (SEQ ID NO:5) NO:6) (SEQ ID NO:8)
- GQGTTVTVSS (SEQ ID NO:71) NO:6) (SEQ ID NO:35)
- GQGTTVTVSS (SEQ ID NO:73) NO:6) (SEQ ID NO:37)
- GQGTTVTVSS (SEQ ID NO:74) NO:6) (SEQ ID NO:38)
- GQGTTVTVSS (SEQ ID NO:75) NO:6) (SEQ ID NO:39)
- GQGTTVTVSS (SEQ ID NO:79) NO:6) (SEQ ID NO:43)
- GQGTTVTVSS (SEQ ID NO:81) NO:6) (SEQ ID NO:45)
- GQGTTVTVSS (SEQ ID NO:82) NO:6) (SEQ ID NO:46)
- GQGTTVTVSS (SEQ ID NO:83) NO:6) (SEQ ID NO:47)
- GQGTTVTVSS (SEQ ID NO:85) NO:6) (SEQ ID NO:49)
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH), wherein at least the CDR3 region is at least 80%, 85%, 90% or 95% identical to a reference CDR3 sequence selected from the group consisting of SEQ ID NOs: 4, 8 and 17-49.
- VH immunoglobulin heavy chain variable region
- the CDR3 region is identical to a reference CDR3 sequence selected from the group consisting of SEQ ID NOs: 4, 8 and 17-49.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH), wherein, the CDRl and CDR2 regions are at least 80%, 85%, 90%, 95% or 100% identical to the CDRl and CDR2 amino acid sequences of SEQ ID NOs: 2 and 3,
- VH immunoglobulin heavy chain variable region
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH), wherein the CDRl and CDR2 regions are at least 80%, 85%, 90%, 95% or 100% identical to the CDRl and CDR2 amino acid sequences of SEQ ID NOs: 6 and 7, respectively, and the CDR3 region is at least 80%, 85%, 90%, 95% or 100% identical to a CDR3 amino acid sequence selected from the group consisting of SEQ ID NOs: 8 and 35-49.
- VH immunoglobulin heavy chain variable region
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH) in which the CDRl, CDR2, and CDR3 regions have polypeptide sequences which are identical to the CDRl, CDR2, and CDR3 groups shown in Table 3.
- VH immunoglobulin heavy chain variable region
- the anti-LINGO-1 antibody molecule includes the VH polypeptide specifically or preferentially binds to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide at least 80%, 85%, 90% 95% or 100% identical to a reference VH polypeptide sequence selected from SEQ ID NOs: 1, 5 and 53-85.
- the VH polypeptide comprises a CDR3 amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 8 and 17-49.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide selected from the group consisting of SEQ ID NOs: 1, 5 and 53-85.
- an antibody or antigen-binding fragment comprising the VH polypeptide specifically or preferentially binds to LINGO- 1.
- the anti-LINGO- 1 antibody molecule includes a VH comprising the amino acids of SEQ ID NO: 1 or SEQ ID NO: 5.
- an antibody or antigen-binding fragment comprising the VH that specifically or preferentially binds to LINGO- 1.
- an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH that specifically or preferentially binds to the same epitope as Li62, Li81 or a variant thereof as described in Table 3 or will competitively inhibit such a monoclonal antibody from binding to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide, comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain which is identical to the polypeptide of SEQ ID NO: 146 except for a replacement of one or more of the following amino acids: W50, P53, 157 and/or W104.
- W50 is replaced with an H, F, L, M, G, I, or D residue.
- P53 is replaced with an L, S, T, W, or G residue.
- 157 is replaced with a G, M, N, H, L, F, W, Y, S, P, V or T residue.
- W104 is replaced with a V, H, S, Q, M, L, T, or I residue.
- the anti-LINGO-1 antibody molecule includes a polypeptide, comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region which is identical to the polypeptide of SEQ ID NO:5 except for a
- P53 is replaced with an L, S, T, W, or G residue.
- the anti-LINGO-1 antibody molecule includes a polypeptide, comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region which is identical to the polypeptide of SEQ ID NO: 1 except for a
- W50, P53, 157 and/or W104 are replaced with one or more of the following amino acids: W50, P53, 157 and/or W104.
- W50 is replaced with an H, F, L, M, G, I, or D residue.
- P53 is replaced with an L, S, T, W, or G residue.
- 157 is replaced with a G, M, N, H, L, F, W, Y, S, P, V or T residue.
- W104 is replaced with a V, H, S, Q, M, L, T, or I residue.
- the anti-LINGO-1 antibody molecule includes a polypeptide, comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region which is identical to the polypeptide of SEQ ID NO:66 except for a replacement of one or more of the following amino acids: W50, P53, 157 and/or W104.
- W50 is replaced with an H, F, L, M, G, I, or D residue.
- P53 is replaced with an L, S, T, W, or G residue.
- 157 is replaced with a G, M, N, H, L, F, W, Y, S, P, V or T residue.
- W104 is replaced with a V, H, S, Q, M, L, T, or I residue.
- the anti-LINGO-1 antibody molecule includes one or more of the VH polypeptides described above specifically or preferentially binds to the same epitope as Li62, Li81 or a variant thereof as described in Table 3, or can competitively inhibit such an antibody from binding to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL), where at least one of the CDRs of the light chain variable region or at least two of the CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain CDR1, CDR2, or CDR3 amino acid sequences from monoclonal LINGO- 1 antibodies disclosed herein.
- the CDR1, CDR2 and CDR3 regions of the VL are at least 80%, 85%, 90% or 95% identical to reference light chain CDR1, CDR2, and CDR3 amino acid sequences from monoclonal LINGO- 1 antibodies disclosed herein.
- a light chain variable region of the antibody molecule has CDR1, CDR2, and CDR3 polypeptide sequences related to the polypeptides shown in Table 4.
- the anti-LINGO-1 antibody molecule comprising the VL polypeptide specifically or preferentially binds to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL) in which the CDR1, CDR2, and CDR3 regions have polypeptide sequences which are identical to the CDR1, CDR2, and CDR3 groups shown in Table 4.
- VL immunoglobulin light chain variable region
- an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide at least 80%, 85%, 90% or 95% identical to a reference VL polypeptide sequence selected from SEQ ID NO: 9 or SEQ ID NO: 13, shown in Table 4. In certain embodiments, the anti-LINGO-1 antibody molecule includes comprising the VL polypeptide specifically or preferentially binds to LINGO- 1. In another aspect, the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide selected from SEQ ID NO: 9 or SEQ ID NO: 13, shown in Table 4. In certain embodiments, the anti-LINGO-1 antibody molecule comprising the VL polypeptide specifically or preferentially binds to LINGO- 1.
- the anti-LINGO-1 antibody molecule includes a polypeptide consisting essentially of, or consisting of an immunoglobulin light chain which is identical to the polypeptide of SEQ ID NO: 145 except for a replacement of amino acid W94.
- W94 is replaced with an A, D, L, N, G, Q, V, or S residue.
- the anti-LINGO-1 antibody molecule includes a polypeptide, comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region which is identical to the polypeptide of SEQ ID NO:5 except for a replacement of amino acid W94.
- W94 is replaced with an A, D, L, N, G, Q, V, or S residue.
- the anti-LINGO-1 antibody molecule includes a polypeptide comprising, consisting essentially of, one or more of the VL polypeptides described above specifically or preferentially binds to the same epitope as Li62 or Li81, or will competitively inhibit such a monoclonal antibody from binding to LINGO- 1.
- the anti-LINGO-1 antibody molecule comprises, consists essentially of or consists of a VH polypeptide, as shown in Table 3, and a VL polypeptide, as shown in Table 4, selected from the group consisting of: i) SEQ ID NO: 1 or SEQ ID NOs: 53-70 and SEQ ID NO: 9; and iii) SEQ ID NO: 5 or SEQ ID NOs: 71-85 and SEQ ID NO: 13.
- the anti-LINGO-1 antibody molecule comprises, consists essentially of or consists of an antibody heavy chain as shown below in SEQ ID NO: 86, or an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto.
- the anti-LINGO-1 antibody molecule comprises, consists essentially of or consists of an aglycosylated version of an antibody heavy chain.
- an aglycosylated version of Li81 is described in PCT/US2008/000316, filed Jan. 9, 2008 and US 8,128,926, which are incorporated herein by reference in its entirety.
- An aglycosylated version of the Li81 antibody was created by changing a single amino acid (T to A) in the Li81 heavy chain sequence.
- SEQ ID NO:50 The sequence of an aglycosylated version of Li81 heavy chain (SEQ ID NO:50) is shown below.
- the single amino acid change is marked in bold and underlined: EVQLLESGGGLVQPGGSLRLSCAASGFTFSAYEMKWVRQAPGKGLEWVSV IGPSGGFTFYADISVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATE GDNDAFDIWGQGTTVTVSSASTKGPISVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTIVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK
- the anti-LINGO-1 antibody molecule includes a heavy chain at least 80%, 85%, 90% or 95% identical to a reference polypeptide comprising the amino acids of SEQ ID NO:50 or 86.
- an antibody or antigen-binding fragment comprising the heavy chain specifically or preferentially binds to LINGO- 1.
- the anti-LINGO-1 antibody molecule is a fully human anti- LINGO-1 monoclonal antibody engineered into an aglycosyl immunoglobulin G subclass 1 (IgGl) framework to reduce effector function (also referred to herein as anti-LINGO-1
- IgGl immunoglobulin G subclass 1
- Antibody 1 Histological and functional evaluations of LINGO- 1 knock-out mice have been performed, and in vivo pharmacological activity of anti-LINGO-1 Antibody 1 has been demonstrated in several animal models of demyelination. Anti-LINGO-1 Antibody 1 has been characterized in vitro and in vivo based on the evaluation of binding characteristics, biological activity, and pharmacological activity. The results of these studies indicate that anti-LINGO-1 Antibody 1 has the following characteristics described in Table 1.
- the antibody molecule includes a VH wherein the VH CDR1,
- CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 6, 7, and 8, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 2, 3, and 30, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VL wherein the VL CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 14, 15, and 16, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VL CDR1,
- CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 10, 11, and 12, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 6, 7, and 8, respectively; and a VL wherein the VL CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 14, 15, and 16, respectively; or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH wherein the VH CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 2, 3, and 30, respectively; and a VL wherein the VL CDR1, CDR2, and CDR3 comprise the amino acids of SEQ ID NOs: 10, 11, and 12, respectively; or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto).
- the antibody molecule includes a VH that includes the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 5).
- the antibody molecule includes a VH that includes the amino acid sequence of SEQ ID NO:66, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 66).
- the antibody molecule includes a VL that includes the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 13).
- the antibody molecule includes a VL that includes the amino acid sequence of SEQ ID NO:9, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 9).
- the antibody molecule includes a VH that includes the amino acid sequence of SEQ ID NO:5, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 5); and a VL that includes the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 13).
- the antibody molecule includes a VH that includes the amino acid sequence of SEQ ID NO:66, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 66); and a VL that includes the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical to said SEQ ID NO: 9).
- the antibody molecule includes a heavy chain as shown below, comprising the amino acid sequence of SEQ ID NO: 275, or a sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto), as follows:
- the antibody molecule includes a light chain as shown below comprising the amino acid sequence of SEQ ID NO: 276, or a sequence substantially identical thereto (e.g., an amino acid sequence at least 80%, 85%, 90% or 95% identical thereto), as follows:
- polypeptides described above may further include additional polypeptides, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein. Additionally, polypeptides of the invention include polypeptide fragments as described elsewhere.
- polypeptides of the invention include fusion polypeptide, Fab fragments, and other derivatives, as described herein.
- compositions comprising the polypeptides described above.
- LINGO- 1 antibody polypeptides as disclosed herein may be modified such that they vary in amino acid sequence from the naturally occurring binding polypeptide from which they were derived.
- a polypeptide or amino acid sequence derived from a designated protein may be similar, e.g., have a certain percent identity to the starting sequence, e.g., it may be 60%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the starting sequence.
- nucleotide or amino acid substitutions, deletions, or insertions leading to conservative substitutions or changes at "non-essential" amino acid regions may be made.
- a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for one or more individual amino acid substitutions, insertions, or deletions, e.g., one, two, three, four, five, six, seven, eight, nine, ten, fifteen, twenty or more individual amino acid substitutions, insertions, or deletions.
- a polypeptide or amino acid sequence derived from a designated protein has one to five, one to ten, one to fifteen, or one to twenty individual amino acid substitutions, insertions, or deletions relative to the starting sequence.
- the reparative agent e.g., the antagonist of LINGO- 1
- a soluble LINGO molecule e.g., a LINGO-1 molecule (e.g., a fragment of LINGO- 1)
- a soluble form of a component of the LINGO-1 complex e.g., a soluble form of NgRl, p75, or TAJ (TROY)
- a soluble LINGO molecule or a LINGO- 1 antibody molecule comprises an amino acid sequence or one or more moieties not normally associated with an antibody. Exemplary modifications are described in more detail below.
- a single- chain fv antibody fragment of the invention may comprise a flexible linker sequence, or may be modified to add a functional moiety (e.g., PEG, a drug, a toxin, or a label).
- An antibody molecule, a soluble form of LINGO- 1, or a complex component, as described herein, can be used alone or functionally linked (e.g., by chemical coupling, genetic or polypeptide fusion, non-covalent association or otherwise) to a second moiety, a heterologous moiety, e.g., a heterologous polypeptide.
- a heterologous moiety e.g., a heterologous polypeptide.
- heterologous as applied to a polynucleotide or a polypeptide, means that a portion with which it is not naturally linked in nature.
- the polynucleotide or polypeptide is derived from a distinct entity from that of the rest of the entity to which it is being compared.
- a "heterologous polypeptide" to be fused to a LINGO- 1 antibody molecule is derived from a non-immunoglobulin polypeptide of the same species, or an immunoglobulin or non- immunoglobulin polypeptide of a different species.
- heterologous moieties include, but are not limited to, an immunoglobulin Fc domain, serum albumin, pegylation, a GST, Lex-A and an MBP polypeptide sequence.
- the fusion proteins may additionally include a linker sequence joining the first moiety, e.g., the antibody molecule, the soluble form of LINGO-1 or the complex component, to the second moiety.
- additional amino acid sequences can be added to the N- or C-terminus of the fusion protein to facilitate expression, steric flexibility, detection and/or isolation or purification.
- a soluble form of LINGO- 1 or a complex component can be fused to a heavy chain constant region of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE.
- antibody molecules and soluble or fusion proteins described herein can be functionally linked (e.g., by chemical coupling, genetic fusion, non- covalent association or otherwise) to one or more other molecular entities, such as an antibody (e.g., a bispecific or a multispecific antibody), among others.
- an antibody e.g., a bispecific or a multispecific antibody
- the fusion protein includes the extracellular domain of LINGO or the complex component (or a sequence homologous thereto), and, e.g., fused to, a human immunoglobulin Fc chain, e.g., human IgG (e.g., human IgGl or human IgG2, or a mutated form thereof).
- a human immunoglobulin Fc chain e.g., human IgG (e.g., human IgGl or human IgG2, or a mutated form thereof).
- the Fc sequence can be mutated at one or more amino acids to reduce effector cell function, Fc receptor binding and/or complement activity.
- an anti-LINGO-1 antibody molecule can comprise, consist essentially of, or consist of, a fusion protein.
- Fusion proteins in this context are chimeric molecules which comprise, for example, an immunoglobulin antigen-binding domain with at least one target binding site, and at least one heterologous portion.
- the amino acid sequences can normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein, but are placed in a new arrangement in the fusion polypeptide. Fusion proteins can be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
- nucleic acid molecules, host cells and vectors that include a nucleotide sequence encoding any of the polypeptides, e.g., reparative agents and immunomodulators, described herein, are also encompassed by the invention.
- an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin heavy chain variable region (VH) of an anti-LINGO- 1 antibody molecule, where at least one of the CDRs of the heavy chain variable region or at least two of the CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain CDR1, CDR2, or CDR3 amino acid sequences of Li62 or Li81 or variants thereof as described in Table 3 is provided.
- VH immunoglobulin heavy chain variable region
- the CDRl, CDR2, and CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain CDRl, CDR2, and CDR3 amino acid sequences of Li62 or Li81 or variants thereof as described in Table 3.
- a heavy chain variable region of the invention has CDRl, CDR2, or CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 3.
- an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL) of an anti-LINGO- 1 antibody molecule, where at least one of the CDRs of the light chain variable region or at least two of the CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference light chain CDRl, CDR2, or CDR3 amino acid sequences from monoclonal LINGO- 1 antibodies disclosed herein is provided.
- VL immunoglobulin light chain variable region
- a light chain variable region of the invention has CDRl, CDR2, or CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 4.
- any of the polynucleotides described above may further include additional nucleic acids, encoding, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein.
- compositions comprising the polynucleotides comprising one or more of the polynucleotides described above are also disclosed.
- the compositions comprising a first polynucleotide and second polynucleotide wherein said first polynucleotide encodes a VH polypeptide as described herein and wherein said second polynucleotide encodes a VL polypeptide as described herein.
- polynucleotides of the invention are also contemplated by the invention.
- the polynucleotides can be produced or manufactured by any method known in the art.
- a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et ah, BioTechniques 17:242 (1994)), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
- Recombinant expression of a polypeptide described herein requires construction of an expression vector containing the polynucleotide that encodes the polypeptide, e.g., the antibody molecule.
- the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques known in the art.
- methods for preparing a protein by expressing a polynucleotide containing a polypeptide encoding nucleotide sequence are described herein and in US 8,058,406, the contents of which are incorporated by reference in their entirety.
- Replicable vectors comprising a nucleotide sequence encoding a polypeptide described herein (e.g., an anti-LINGO-1 antibody molecule, or a heavy or light chain thereof, or a heavy or light chain variable domain) operably linked to a promoter.
- Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., PCT Publication WO 86/05807; PCT Publication WO 89/01036; and U.S. Pat. No. 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy or light chain.
- the host cell may be co-transfected with two expression vectors, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
- the two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides.
- a single vector may be used which encodes both heavy and light chain polypeptides.
- the light chain is advantageously placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. Sci. USA 77:2197 (1980)).
- the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
- vector or "expression vector” is used herein to mean vectors used as a vehicle for introducing into and expressing a desired gene in a host cell.
- vectors can easily be selected from the group consisting of plasmids, phages, viruses and retroviruses.
- vectors compatible with the instant invention will comprise a selection marker, appropriate restriction sites to facilitate cloning of the desired gene and the ability to enter and/or replicate in eukaryotic or prokaryotic cells.
- vector systems may be employed.
- one class of vector utilizes DNA elements which are derived from animal viruses such as bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (RSV, MMTV or MOMLV) or SV40 virus.
- Others involve the use of polycistronic systems with internal ribosome binding sites.
- cells which have integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow selection of transfected host cells. The marker may provide for prototrophy to an auxotrophic host, biocide resistance (e.g., antibiotics) or resistance to heavy metals such as copper.
- the selectable marker gene can either be directly linked to the DNA sequences to be expressed, or introduced into the same cell by co-transformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include signal sequences, splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the cloned variable region genes are inserted into an expression vector along with the heavy and light chain constant region genes (preferably human) synthetic as discussed above.
- this is effected using a proprietary expression vector of Biogen IDEC, Inc., referred to as NEOSPLA (U.S. Pat. No. 6,159,730).
- NEOSPLA Biogen IDEC, Inc.
- This vector contains the cytomegalovirus promoter/enhancer, the mouse beta globin major promoter, the SV40 origin of replication, the bovine growth hormone polyadenylation sequence, neomycin phosphotransferase exon 1 and exon 2, the dihydrofolate reductase gene and leader sequence.
- This vector has been found to result in very high level expression of antibodies upon incorporation of variable and constant region genes, transfection in CHO cells, followed by selection in G418 containing medium and methotrexate amplification.
- any expression vector which is capable of eliciting expression in eukaryotic cells may be used in the present invention.
- Suitable vectors include, but are not limited to plasmids pcDNA3, pHCMV/Zeo, pCR3.1, pEFl/His, pIND/GS, pRc/HCMV2, pSV40/Zeo2, pTRACER-HCMV, pUB6/V5-His, pVAXl, and pZeoSV2 (available from Invitrogen, San Diego, Calif.), and plasmid pCI (available from Promega, Madison, Wis.).
- screening large numbers of transformed cells for those which express suitably high levels if immunoglobulin heavy and light chains is routine experimentation which can be carried out, for example, by robotic systems. Vector systems are also taught in U.S. Pat.
- the LINGO- 1 antibody molecules can be expressed using polycistronic constructs such as those disclosed in United States Patent Application
- the expression vector may be introduced into an appropriate host cell.
- Introduction of the plasmid into the host cell can be accomplished by various techniques well known to those of skill in the art. These include, but are not limited to, transfection (including electrophoresis and
- plasmid introduction into the host is via electroporation.
- the host cells harboring the expression construct are grown under conditions appropriate to the production of the light chains and heavy chains, and assayed for heavy and/or light chain protein synthesis.
- Exemplary assay techniques include enzyme- linked immunosorbent assay (ELISA), radioimmunoassay (RIA), or fluorescence-activated cell sorter analysis (FACS), immunohistochemistry and the like.
- the expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce a polypeptide for use in the methods described herein.
- the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, operably linked to a heterologous promoter.
- vectors encoding both the heavy and light chains may be co- expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed in US 8,058,406, the contents of which are incorporated by reference herein in its entirety.
- host cells refers to cells which harbor vectors constructed using recombinant DNA techniques and encoding at least one heterologous gene.
- the terms “cell” and “cell culture” are used interchangeably to denote the source of antibody unless it is clearly specified otherwise.
- recovery of polypeptide from the “cells” may mean either from spun down whole cells, or from the cell culture containing both the medium and the suspended cells.
- host-expression vector systems may be utilized to express polypeptides, e.g., antibody molecules, for use in the methods described herein. These include, but are not limited to, microorganisms such as bacteria (e.g., E. coli, B.
- subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing polypeptide coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing polypeptide coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BLK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter)
- bacterial cells such as Escherichia coli, and more typically, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant polypeptide or antibody molecule.
- mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for polypeptides antibodies (Foecking et al, Gene 45: 101 (1986); Cockett et al, Bio/Technology 8:2 (1990)).
- the host cell line used for protein expression is often of mammalian origin; those skilled in the art are credited with ability to preferentially determine particular host cell lines which are best suited for the desired gene product to be expressed therein.
- Exemplary host cell lines include, but are not limited to, CHO (Chinese Hamster Ovary), DG44 and DUXB 11 (Chinese Hamster Ovary lines, DHFR minus), HELA (human cervical carcinoma), CVI (monkey kidney line), COS (a derivative of CVI with SV40 T antigen), VERY, BHK (baby hamster kidney), MDCK, 293, W138, R1610 (Chinese hamster fibroblast) BALBC/3T3 (mouse fibroblast), HAK (hamster kidney line), SP2/0 (mouse myeloma), P3.times.63- Ag3.653 (mouse myeloma), BFA-lclBPT (bovine endothelial cells), RAJI (human lymph
- a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications ⁇ e.g., glycosylation) and processing ⁇ e.g., cleavage) of protein products may be important for the function of the protein.
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
- cell lines which stably express the antibody molecule may be engineered.
- host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
- appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
- engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
- This method may advantageously be used to engineer cell lines which stably express the antibody molecule.
- the antibody molecules are expressed in CHO cells stably transfected with expression vectors containing the IgGi- agly heavy light chain structural genes specific to the human LINGO- 1 protein.
- a native human kappa light chain signal peptide and a human heavy chain signal peptide, which are post-translationally removed by endoplasmic reticulum-associated signal peptidase, can be used to direct secretion of the anti-LINGO-1 antibody molecule.
- the antibody molecule can be purified from the media and formulated as a liquid.
- the antibody molecule can consists of 2 heavy and 2 light chains connected by inter-chain disulfide bonds. In one embodiment, the mass of the intact antibody molecule is approximately 144.4 kDa.
- a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA 48:202 (1992)), and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817 1980) genes can be employed in tk-, hgprt- or aprt-cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to
- methotrexate (Wigler et al., Natl. Acad. Sci. USA 77:357 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA 78: 1527 (1981)); gpt, which confers resistance to mycophenolic acid
- the LINGO- 1 antagonist inhibits the expression of nucleic acid encoding a LINGO- 1.
- LINGO- 1 antagonists include nucleic acid molecules, for example, antisense molecules, ribozymes, RNAi double stranded molecules, triple helix molecules, microRNA molecules that hybridize to a nucleic acid encoding a LINGO- 1, or a transcription regulatory region, and block or reduce mRNA expression of LINGO- 1.
- an “antisense” nucleic acid can include a nucleotide sequence which is
- Anti-sense agents can include, for example, from about 8 to about 80 nucleobases (i.e.
- Anti-sense compounds include ribozymes, external guide sequence (EGS) oligonucleotides (oligozymes), and other short catalytic RNAs or catalytic oligonucleotides which hybridize to the target nucleic acid and modulate its expression.
- Anti-sense compounds can include a stretch of at least eight consecutive nucleobases that are complementary to a sequence in the target gene. An oligonucleotide need not be 100% complementary to its target nucleic acid sequence to be specifically hybridizable.
- An oligonucleotide is specifically hybridizable when binding of the oligonucleotide to the target interferes with the normal function of the target molecule to cause a loss of utility, and there is a sufficient degree of complementarity to avoid nonspecific binding of the oligonucleotide to non-target sequences under conditions in which specific binding is desired, i.e., under physiological conditions in the case of in vivo assays or therapeutic treatment or, in the case of in vitro assays, under conditions in which the assays are conducted.
- Exemplary antisense compounds include DNA or RNA sequences that specifically hybridize to the target nucleic acid, e.g., the mRNA encoding LINGO- 1.
- the complementary region can extend for between about 8 to about 80 nucleobases.
- the compounds can include one or more modified nucleobases, which are known in the art.
- nucleic acid agents are available. See, e.g., U.S. Patent Nos. 4,987,071;.
- siRNAs are small double stranded RNAs (dsRNAs) that optionally include overhangs.
- the duplex region of an siRNA is about 18 to 25 nucleotides in length, e.g., about 19, 20, 21, 22, 23, or 24 nucleotides in length.
- the siRNA sequences are exactly complementary to the target mRNA.
- dsRNAs and siRNAs in particular can be used to silence gene expression in mammalian cells (e.g., human cells).
- siRNAs also include short hairpin RNAs (shRNAs) with 29-base-pair stems and 2-nucleotide 3' overhangs. See, e.g., Clemens et al. (2000) Proc. Natl.
- the nucleic acid molecule is a ribozyme.
- a ribozyme having specificity for a LINGO- 1 -encoding nucleic acid can include one or more sequences complementary to the nucleotide sequence of a LINGO- 1 mRNA, and a sequence having known catalytic sequence responsible for mRNA cleavage (see U.S. Pat. No. 5,093,246 or Haselhoff and Gerlach (1988) Nature 334:585-591; Cech et al. U.S. Patent No. 4,987,071; and Cech et al. U.S. Patent No. 5,116,742; Bartel, D. and Szostak, J.W. (1993) Science 261: 1411-1418).
- the nucleic acid molecule is a microRNA molecule.
- a microRNA having specificity for a LINGO- 1 -encoding nucleic acid can include one or more sequences complementary to the nucleotide sequence of a LINGO- 1 mRNA, which can result in gene silencing via translational repression or target degradation ⁇ see Bartel DP (2009) Cell 136 (2): 215-33; Kusenda B, et al. (2006) Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub 150 (2): 205-15).
- LINGO- 1 gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the LINGO-1 (e.g., the LINGO-1 promoter and/or enhancers) to form triple helical structures that prevent transcription of the LINGO- 1 gene in target cells.
- nucleotide sequences complementary to the regulatory region of the LINGO-1 e.g., the LINGO-1 promoter and/or enhancers
- the potential sequences that can be targeted for triple helix formation can be increased by creating a so-called "switchback" nucleic acid molecule.
- a LINGO-1 nucleic acid molecule can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule.
- synthetic oligonucleotides with modifications see Toulme (2001) Nature Biotech. 19: 17 and Faria et al. (2001) Nature Biotech. 19:40-44; Hyrup B. et al. (1996) Bioorganic & Medicinal Chemistry 4: 5-23).
- immunomodulatory agents are presently used to modify the course of multiple sclerosis in patients.
- agents include, but are not limited to, an IFN- ⁇ 1 molecule; a polymer of glutamic acid, lysine, alanine and tyrosine, e.g., glatiramer; an antibody or fragment thereof against alpha-4 integrin, e.g., natalizumab; an anthracenedione molecule, e.g., mitoxantrone; a fingolimod, e.g., FTY720; a dimethyl fumarate, e.g., an oral dimethyl fumarate; an antibody to the alpha subunit of the IL-2 receptor of T cells (CD25), e.g., daclizumab; an antibody against CD52, e.g., alemtuzumab; an inhibitor of a dihydroorotate dehydrogenase, e.g., teriflunomide; an antibody to
- immunomodulatory agents are described in more detail as follows.
- IFNfi agents Beta interferons
- Interferons are natural proteins produced by the cells of the immune systems of most animals in response to challenges by foreign agents such as viruses, bacteria, parasites and tumor cells. Interferons belong to the large class of glycoproteins known as cytokines. Interferon beta has 165 amino acids. Interferons alpha and beta are produced by many cell types, including T-cells and B- cells, macrophages, fibroblasts, endothelial cells, osteoblasts and others, and stimulate both macrophages and NK cells. Interferon gamma is involved in the regulation of immune and inflammatory responses. It is produced by activated T-cells and Thl cells.
- Interferon alpha (including forms interferon alpha-2a, interferon alpha- 2b, and interferon alfacon-1) was approved by the United States Food and Drug Administration (FDA) as a treatment for Hepatitis C.
- FDA United States Food and Drug Administration
- Interferon beta la (Avonex®) is identical to interferon beta found naturally in humans, and interferon beta lb (Betaseron®) differs in certain ways from interferon beta la found naturally in humans, including that it contains a serine residue in place of a cysteine residue at position 17.
- interferon beta uses of interferon beta have included treatment of AIDS, cutaneous T-cell lymphoma, Acute Hepatitis C (non-A, non-B), Kaposi's sarcoma, malignant melanoma, hairy cell leukemia, and metastatic renal cell carcinoma.
- IFNP agents can be administered to the subject by any method known in the art, including systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intravitreally, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation).
- systemically e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intravitreally, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation.
- the IFNP agents are administered subcutaneously, or intramuscularly.
- IFNP agents can be used to treat those subjects determined to be "responders" using the methods described herein.
- the IFNP agents are used as a monotherapy (i.e., as a single "disease modifying therapy") although the treatment regimen can further comprise the use of "symptom management therapies” such as antidepressants, analgesics, anti-tremor agents, etc.
- the IFNP agent is an IFNP-1A agent (e.g., Avonex®, Rebif®).
- the INFP agent is an INFP-1B agent (e.g., Betaseron®, Betaferon®, Extavia®).
- Avonex® an Interferon ⁇ -la
- Avonex® is indicated for the treatment of patients with relapsing forms of MS that are determined to be responders using the methods described herein to slow the accumulation of physical disability and decrease the frequency of clinical exacerbations.
- Avonex® (Interferon beta- la) is a 166 amino acid glycoprotein with a predicted molecular weight of approximately 22,500 daltons. It is produced by recombinant DNA technology using genetically engineered Chinese Hamster Ovary cells into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex® is identical to that of natural human interferon beta.
- the recommended dosage of Avonex® (Interferon beta- la) is 30 meg injected intramuscularly once a week.
- Avonex® is commercially available as a 30 meg lyophilized powder vial or as a 30 meg prefilled syringe.
- Interferon beta la (Avonex®) is identical to interferon beta found naturally in humans
- Interferon beta la (SwissProt Accession No. P01574 and gi:50593016).
- the sequence of interferon beta is:
- compositions e.g., IFN beta 1 a molecules
- Such other compositions include, e.g., other interferons and fragments, analogues, homologues, derivatives, and natural variants thereof with substantially similar biological activity.
- the INFP agent is modified to increase one or more pharmacokinetic properties.
- the INFP agent can be a modified form of interferon la to include a pegylated moiety. PEGylated forms of interferon beta la are described in, e.g., Baker, D.P.
- Pegylated forms of IFN beta la can be administered by, e.g., injectable routes of
- administration e.g., subcutaneously.
- Rebif® is also an Interferon ⁇ -la agent, while Betaseron®, Betaferon®, and Extavia® are Interferon ⁇ -lb agents. Both Rebif® and Betaseron® are formulated for administration by subcutaneous injection.
- Dosages of IFNP agents to administer can be determined by one of skill in the art, and include clinically acceptable amounts to administer based on the specific interferon-beta agent used.
- AVONEX® is typically administered at 30 microgram once a week via intramuscular injection.
- Other forms of interferon beta la, specifically REBIF®, is administered, for example, at 22 microgram three times a week or 44 micrograms once a week, via subcutaneous injection.
- Interferon beta- 1A can be administered, e.g.,
- AVONEX® can be administered every five to ten days, e.g., once a week, while Rebif® can be administered three times a week.
- Anti-VLA4 antibody e.g., Natalizumab (Tysabri®)
- Natalizumab Tysabri®
- Anti-VLA4 antibodies inhibit the migration of leukocytes from the blood to the central nervous system. These antibodies bind to VLA-4 (also called ⁇ 4 ⁇ 1) on the surface of activated T-cells and other mononuclear leukocytes. They can disrupt adhesion between the T-cell and endothelial cells, and thus prevent migration of mononuclear leukocytes across the endothelium and into the parenchyma. As a result, the levels of proinflammatory cytokines can also be reduced.
- VLA-4 also called ⁇ 4 ⁇ 1
- Natalizumab can decrease the number of brain lesions and clinical relapses and accumulation of disability in patients with relapse remitting multiple sclerosis and relapsing secondary-progressive multiple sclerosis.
- Natalizumab and related VLA-4 binding antibodies are described, e.g., in U.S. Pat. No. 5,840,299.
- Monoclonal antibodies 21.6 and HP1/2 are exemplary murine monoclonal antibodies that bind VLA-4.
- Natalizumab is a humanized version of murine monoclonal antibody 21.6 (see, e.g., U.S. Pat. No. 5,840,299).
- a humanized version of HP 1/2 has also been described (see, e.g., U.S. Pat. No.
- VLA-4 binding monoclonal antibodies such as HP2/1, HP2/4, L25 and P4C2 are described, e.g., in U.S. Pat. No. 6,602,503; Sanchez-Madrid et al, (1986) Eur. J. Immunol 16: 1343-1349; Hemler et al, (1987) J Biol. Chem. 2: 11478-11485; Issekutz et al. (1991) Immunol 147: 109 (TA-2 mab); Pulido et al. (1991) J Biol. Chem. 266: 10241-10245; and U.S. Pat. No. 5,888,507).
- the contents of the aforesaid publications are incorporated herein by reference in their entirety.
- DMF Dimethyl fumarate
- Tecfidera® is a fumaric acid ester.
- DMF is thought to decrease leukocyte passage through the blood brain barrier and exert neuroprotective effects by the activation of antioxidative pathways, specifically through activation of the Nrf-2 pathway (Lee et al. (2008) Int MS Journal 15: 12-18).
- BG-12® has the potential to reduce the activity and impact of inflammatory cells on the CNS and induce direct cytoprotective responses in CNS cells. These effects may enhance the CNS cells' ability to mitigate the toxic inflammatory and oxidative stress that plays a role in MS pathophysiology.
- Copaxone® (glatiramer acetate) consists of the acetate salts of synthetic polypeptides, specifically the four naturally occurring amino acids: L-glutamic acid, L- alanine, L-tyrosine, and L-lysine (Bornstein et al. (1987) N Engl J Med. 317: 408-414). Copaxone® exhibits structural similarity to myelin basic protein and is thought to function as an immune modulator by shifting the T helper cell type 1 response towards a T helper cell type 2 response (Duda et al. (2000) Clin Invest 105: 967-976; Nicholas et al. (2011) Drug Design,
- Mitoxantrone Novantrone®, an anthracenedione molecule
- Mitoxantrone is an anthracenedione molecule (l,4-dihydroxy-5,8-bis[2-(2- hydroxyethylamino) ethylamino]-anthracene-9,10-dione) and a type II topoisomerase inhibitor that disrupts DNA synthesis and repair of cells. It is used to treat cancers and MS. Mitoxantrone is used to treat several forms of advancing MS, including secondary progressive MS, progressive relapsing MS, and advanced relapsing-remitting MS.
- mitoxantrone is effective in slowing the progression of secondary progressive MS and extending the time between relapses in relapsing-remitting MS and progressive relapsing MS (Fox E (2006) Clin Ther 28 (4): 461-74).
- Fingolimod (Gilenya®; sphingosine 1 -phosphate receptor modulator)
- Fingolimod is an immunomodulating drug, approved for treating MS. It has reduced the rate of relapses in relapsing-remitting multiple sclerosis by over half, but may have serious adverse effects.
- Fingolimod is a sphingosine 1 -phosphate receptor modulator, which sequesters lymphocytes in lymph nodes, preventing them from moving to the central nervous system for autoimmune responses in MS.
- Antibodies to the alpha subunit of the IL-2 receptor of T cells (e.g., daclizumab HYP; ZINBRYTA®)
- CD25 e.g., daclizumab HYP; ZINBRYTA®
- Daclizumab HYP is a therapeutic humanized monoclonal antibody to the alpha subunit of the IL-2 receptor of T cells (CD25). Daclizumab HYP showed efficacy in reducing lesions and annualized relapse rate in patients with relapsing-remitting multiple sclerosis (Kappos et al. (2015). N. Engl. J. Med. 373 (15): 1418-28).
- Antibody against CD52 e.g., alemtuzumab
- Antibodies against CD52 e.g., alemtuzumab (currently under further development as Lemtrada®), bind to CD52, which is a protein present on the surface of mature lymphocytes, but not on stem cells.
- Lemtrada® a protein present on the surface of mature lymphocytes, but not on stem cells.
- Phase III studies reported positive results comparing alemtuzumab with Rebif® (high-dose subcutaneous interferon beta- la) in the treatment of patients with relapsing-remitting MS (RRMS).
- RRMS relapsing-remitting MS
- Antibody to CD20 e.g., ocrelizumab
- Antibodies against CD20 e.g., ocrelizumab, rituximab, ofatumumab, target mature B lymphocytes.
- Phase 2 clinical studies of rituximab and ocrelizumab in relapse remitting MS have demonstrated a statistically significant reduction in disease activity measured by brain lesions (e.g., measured by MRI scans) and relapse rate compared to placebo.
- Phase 3 studies of ocrelizumab showed both reduction in relapse rate and disability compared to interferon beta- la (e.g., Rebif®).
- Inhibitors of dihydroorotate dehydrogenase e.g., teriflunomide
- Inhibitors of dihydroorotate dehydrogenase e.g., teriflunomide
- Inhibitors of dihydroorotate dehydrogenase e.g., teriflunomide
- teriflunomide also known as A77 1726 or
- A77 1726 or ) is an active metabolite of
- Teriflunomide inhibits rapidly dividing cells, including activated T cells, which are thought to drive the disease process in MS. Teriflunomide was investigated in clinical trials as a medication for treating MS. (Vollmer EMS News (May 28, 2009)).
- Steroids e.g., corticosteroid, and ACTH agents can be used to treat acute relapses in relapsing-remitting MS or secondary progressive MS.
- Such agents include, but are not limited to, Depo-Medrol®, Solu-Medrol®, Deltasone®, Delta-Cortef®, Medrol®,
- One or more of the aforesaid immunomodulatory agents can be used in combination with the reparative agents disclosed herein, as described in more detail below and exemplified by the combination of IFN-b and anti-LINGO-1 Antibody Therapy.
- Reparative agents such as LINGO- 1 antagonists, can relieve NgRl -mediated inhibition of axonal regeneration and dendritic arborization that normally takes place in CNS neurons. This is beneficial in situations where axonal repair or neurite sprouting is needed in the brain or spinal cord following CNS injury.
- Spinal cord injury including partial or complete crush or severance, exemplifies a situation in which axonal repair is needed, but is normally inhibited through operation of the NgRl pathway.
- LINGO- 1 is expressed in oligodendrocytes, and contributes to
- Soluble derivatives of LINGO-1, polynucleotides (e.g. RNAi), as well as certain antibodies which specifically bind to LINGO-1 can act as antagonists to LINGO-1 function in oligodendrocytes, enhancing differentiation and survival of
- oligodendrocytes and promoting myelination of neurons in vitro and in vivo. This can be beneficial for treating or preventing disorders or conditions involving demyelination and dysmyelination.
- diseases or disorders in which axonal extension and/or neurite sprouting in the brain, and/or oligodendrocyte proliferation, differentiation and survival, and/or myelination or remyelination, can be beneficial include, but are not limited to, CNS demyelinating diseases, CNS injury, stroke, multiple sclerosis (MS), optic neuritis (e.g., acute optic neuritis), idiopathic inflammatory demyelinating disease, transverse myelitis, neuromyelitis optica (NMO), vitamin B 12 deficiency, progressive multifocal
- CNS demyelinating diseases CNS injury, stroke, multiple sclerosis (MS), optic neuritis (e.g., acute optic neuritis), idiopathic inflammatory demyelinating disease, transverse myelitis, neuromyelitis optica (NMO), vitamin B 12 deficiency, progressive multifocal
- ALS Degenerationamylotrophic lateral sclerosis
- Alzheimer's disease Parkinson's disease
- spinal cord injury traumatic brain injury, post radiation injury, neurologic complications of chemotherapy, neuropathy (e.g., diabetic neuropathy), acute ischemic optic neuropathy, isolated vitamin E deficiency syndrome, AR, Bassen-Kornzweig syndrome, Marchiafava-Bignami syndrome, metachromatic leukodystrophy, trigeminal neuralgia, Bell's palsy, spinal cord injury, traumatic glaucoma, essential tremor, osmotic hyponatremia, and neurological diseases related to neuronal cell death.
- neuropathy e.g., diabetic neuropathy
- acute ischemic optic neuropathy isolated vitamin E deficiency syndrome
- AR Bassen-Kornzweig syndrome
- Marchiafava-Bignami syndrome metachromatic leukodystrophy
- trigeminal neuralgia Bell's palsy
- spinal cord injury traumatic glaucom
- a CNS demyelinating disease can be chosen from one or more of the aforesaid disorders.
- the CNS demyelinating disease is multiple sclerosis.
- the CNS demyelinating disease is optic neuritis, e.g., acute optic neuritis.
- the method includes administering to the subject an effective amount of a reparative agent, e.g., a LINGO- 1 antagonist, alone or in combination with an immunomodulatory agent.
- a reparative agent e.g., a LINGO- 1 antagonist
- Treatment refers to the administration of a combination therapy, alone or in combination with one or more symptom management agents, to a subject, e.g., an MS patient or optic neuritis (e.g., acute optic neuritis) patient, to impede disease progression, to induce remission, to extend the expected survival time of the subject and or reduce the need for medical interventions (e.g., hospitalizations).
- a subject e.g., an MS patient or optic neuritis (e.g., acute optic neuritis) patient
- optic neuritis e.g., acute optic neuritis
- treatment can include, but is not limited to, inhibiting or reducing one or more symptoms such as numbness, tingling, muscle weakness and/or other symptoms described herein for optic neuritis; reducing relapse rate or severity, reducing size or number of sclerotic lesions;
- prevention contemplate an action that occurs before a subject begins to suffer from a relapse and/or which inhibits or reduces the severity of the disease.
- management encompass preventing the progression of disease symptoms in a subject who has already suffered from the disease, and/or lengthening the time that the subject who has suffered from the disease remains in remission.
- the terms encompass modulating the threshold, development and/or duration of the disease, or changing the way that a patient responds to the disease.
- a “therapeutically effective amount” of a compound is an amount sufficient to provide a therapeutic benefit in the treatment or management of the disease, or to delay or minimize one or more symptoms associated with the disease.
- a therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapeutic agents, which provides a therapeutic benefit in the treatment or management of the disease.
- the term "therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms or causes of the disease, or enhances the therapeutic efficacy of another therapeutic agent.
- a prophylactically effective amount of a compound is an amount sufficient to prevent relapse of the disease, or one or more symptoms associated with the disease, or prevent its recurrence.
- a prophylactically effective amount of a compound means an amount of the compound, alone or in combination with other therapeutic agents, which provides a prophylactic benefit in the prevention of disease relapse.
- the term "prophylactically effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
- the term "patient” or “subject” typically refers to a human (i.e., a male or female of any age group, e.g., a pediatric patient (e.g., infant, child, adolescent) or adult patient (e.g., young adult, middle-aged adult or senior adult) or other mammal, such as a primate (e.g., cynomolgus monkey, rhesus monkey); commercially relevant mammals such as cattle, pigs, horses, sheep, goats, cats, and/or dogs;, that will be or has been the object of treatment, observation, and/or experiment.
- a human i.e., a male or female of any age group, e.g., a pediatric patient (e.g., infant, child, adolescent) or adult patient (e.g., young adult, middle-aged adult or senior adult) or other mammal, such as a primate (e.g., cynomolgus
- treatment with a LINGO- 1 antagonist begins as soon as a subject is diagnosed with a disorder affecting myelination or is diagnosed as being at risk for a disorder affecting myelination.
- a subject having AON in one eye is treated to enhance myelination/prevent demyelination in the visual pathway that serves the fellow eye.
- a subject with AON is treated with a LINGO- 1 antagonist, alone or in combination with an immunomodulatory agent to slow or prevent progression to MS.
- a subject to be treated according to the methods herein has minor symptoms at the time of initiation of treatment.
- a subject to be treated according to the methods herein has marked impairment at the time of initiation of treatment.
- a subject with AON may have marked visual impairment in one eye at the time of treatment.
- Subject to be treated according the methods described herein can be of any age when they are affected by demyelination or dismyelination or are at risk thereof. In one
- a subject selected for treatment with a LINGO- 1 antagonist is at least about 25 years of age. In another embodiment, a subject selected for treatment with a LINGO- 1 antagonist is at least about 30 years of age. In still another embodiment, a subject selected for treatment with a LINGO- 1 antagonist is at least about 30 years of age. In yet another embodiment, a subject selected for treatment with a LINGO- 1 antagonist is at least about 30 years of age. In yet another embodiment, a subject selected for treatment with a LINGO- 1 antagonist is at least about 35 years of age. In yet another embodiment, a subject selected for treatment with a LINGO- 1 antagonist is at least about 40 years of age.
- the reparative agent alone or in combination, reduces one or more symptoms of an inflammatory condition of the optic nerve (e.g., optic neuritis, e.g., acute optic neuritis (AON)).
- AON is an inflammatory disease of the optic nerve that often occurs in multiple sclerosis. AON is caused by inflammatory injury to the optic nerve and presents with visual loss due to edema, inflammation, and damage to the myelin sheath covering the optic nerve and axons. There is significant loss of the retinal nerve fiber layer and retinalganglion cell layer as a result of AON.
- MS Multiple sclerosis
- Subjects having MS can be identified by clinical criteria establishing a diagnosis of clinically definite MS as defined by Poser et al. (1983) Ann. Neurol. 13:22 '. Briefly, an individual with clinically definite MS has had two attacks and clinical evidence of either two lesions or clinical evidence of one lesion and paraclinical evidence of another, separate lesion. Definite MS may also be diagnosed by evidence of two attacks and oligoclonal bands of IgG in cerebrospinal fluid or by combination of an attack, clinical evidence of two lesions and oligoclonal band of IgG in cerebrospinal fluid. The McDonald criteria can also be used to diagnose MS. (McDonald et al.
- Exacerbations are defined as the appearance of one or more new neurological symptoms that are attributable to MS and accompanied by an appropriate new neurologic abnormality on examination. In addition, the exacerbation must last at least 24 hours and be preceded by stability or improvement for at least 30 days, and should not have alternative explanations (such as infection, drug toxicity, primary psychiatric disorders). Briefly, patients are given a standard neurological examination by clinicians. Exacerbations are mild, moderate, or severe according to changes in a Neurological Rating Scale like, for example, the Scripps Neurological Rating Scale (Sipe et al. (1984) Neurology 34: 1368); the EDSS; or by patient reported outcomes ⁇ e.g., MSWS-12). An annual exacerbation rate and proportion of exacerbation-free patients are determined to monitor effectiveness of anti-inflammatory treatments.
- Anti-inflammatory therapy can be deemed to be effective using a clinical measure if there is a statistically significant difference in the rate or proportion of exacerbation-free or relapse-free patients between the treated group and the placebo group for either of these measurements.
- time to first exacerbation and exacerbation duration and severity may also be measured.
- a measure of effectiveness as therapy in this regard is a statistically significant difference in the time to first exacerbation or duration and severity in the treated group compared to control group.
- An exacerbation-free or relapse-free period of greater than one year, 18 months, 20, or 24 months is particularly noteworthy.
- Clinical measurements include the relapse rate in one and two-year intervals, and a change in EDSS, including time to worsening from baseline of 1.0 unit on the EDSS that persists for three or six months. On a Kaplan-Meier curve, a delay in sustained progression of disability shows efficacy. Other criteria include a change in area and volume of T2 images on MRI, and the number and volume of lesions determined by gadolinium enhanced images.
- MRI can be used to measure active inflammatory lesions using gadolinium-DTPA- enhanced imaging (McDonald et al., Ann. Neurol. 36: 14, 1994) or the location and extent of lesions using T2-weighted techniques. Briefly, baseline MRIs are obtained. The same imaging plane and patient position are used for each subsequent study. Positioning and imaging sequences can be chosen to maximize lesion detection and facilitate lesion tracing. The same positioning and imaging sequences can be used on subsequent studies. The presence, location and extent of MS lesions can be determined by radiologists. Areas of lesions can be outlined and summed slice by slice for total lesion area.
- MMR Magnetization Transfer Ratio
- DTI Diffusion Tensor Imaging
- MRS Magnetic Resonance Spectroscopy
- Magnetization Transfer Ratio is based on application of off-resonance radio- frequency pulses and observing their effects on MR images, as well as measuring the signal intensity with and without application of the pulses. MTR has been shown to detect microscopic white matter pathology in MS not detectable on a standard MRI. (Siger-Zajdel M. et al., J Neurol Neurosurg Psychiatry 2001 71:752-756).
- DTI Diffusion Tensor Imaging
- MRI can be used to measure changes in brain volume. Brain volume loss has been correlated with disability progression and cognitive impairment in MS, with the loss of grey matter volume more closely correlated with clinical measures than loss of white matter volume. (De Stefano N. et al., CNS Drugs. 2014 Feb;28(2): 147-56)
- MRS Magnetic Resonance Spectroscopy
- neurometabolites representing specific MS -related events such as demyelination
- Exemplary symptoms associated with multiple sclerosis which can be treated with the methods described herein or managed using symptom management therapies, include: optic neuritis, decreased visual acuity, diplopia, nystagmus, ocular dysmetria, internuclear ophthalmoplegia, movement and sound phosphenes, afferent pupillary defect, paresis, monoparesis, paraparesis, hemiparesis, quadraparesis, plegia, paraplegia, hemiplegia, tetraplegia, quadraplegia, spasticity, dysarthria, muscle atrophy, spasms, cramps, hypotonia, clonus, myoclonus, myokymia, restless leg syndrome, footdrop, dysfunctional reflexes, paraesthesia, anaesthesia, neuralgia, neuropathic and neurogenic pain, L'hermitte's, proprioceptive dysfunction, trigeminal neuralgia,
- MS relap sing-remitting MS
- PPMS Primary-progressive MS
- SPMS Secondary-progressive MS
- PPMS, SPMS, and PRMS are sometimes lumped together and called chronic progressive MS.
- the invention discloses combined administration of an immunomodulatory agent, e.g., an IFN- ⁇ agent, e.g. , Avonex®; and a reparative agent, e.g. , an anti-LINGO-1 antibody, for treatment of a demyelinating disorder, e.g., MS.
- an immunomodulatory agent e.g., an IFN- ⁇ agent, e.g. , Avonex®
- a reparative agent e.g., an anti-LINGO-1 antibody
- agents e.g., pharmaceutical compositions including the agents, can be any suitable agents.
- pharmaceutical compositions including the agents can be any suitable agents.
- each agent can be administered at a dose and/or on a time schedule determined for that agent.
- the additional therapeutic agent utilized in this combination can be administered together in a single composition or administered separately in different compositions.
- the particular combination to employ in a regimen will take into account compatibility of the pharmaceutical composition with the additional therapeutically active agent and/or the desired therapeutic effect to be achieved.
- additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- Treatment of a subject with a disease with a reparative agent can be combined with one or more immunomodulatory agents.
- immunomodulatory agents include, but are not limited to, an IFN- ⁇ 1 molecule; a polymer of glutamic acid, lysine, alanine and tyrosine, e.g., glatiramer; an antibody or fragment thereof against alpha-4 integrin, e.g., natalizumab; an anthracenedione molecule, e.g., mitoxantrone; a fingolimod, e.g., FTY720 or other S 1P1 modulators, such as BAF312 or ozanimod; a dimethyl fumarate, e.g., an oral dimethyl fumarate; an antibody to the alpha subunit of the IL-2 receptor of T cells (CD25), e.g., daclizumab; an antibody against CD52, e.g., alemtuzumab; an inhibitor of a dihydroorotate dehydrogenase, e.g., ter
- a combination of Avonex® and anti-LINGO- 1 antibody therapy is administered.
- an anti-LINGO- 1 antibody can be administered once about every 4 weeks (plus or minus about 5 days) by intravenous (IV) infusion in addition to once weekly Avonex® intramuscular (IM) injections.
- Anti-LINGO- 1 antibody treatment doses can include: IV infusions of: 3mg/kg; or lOmg/kg; or 30mg/kg; or 50mg/kg or 100 mg/kg; concurrent with once-weekly Avonex® IM injections.
- 3 mg/kg IV infusion once every 4 weeks of an anti-LINGO- 1 antibody was selected.
- This regimen is expected to yield a mean average serum concentration similar to rat serum EC50 in the spinal cord lysolecithin model (adjusted for -0.1% CNS penetration).
- Additional dosing regimens 10 mg/kg and 30 mg/kg can also be administered. These 2 dosing regimens are expected to yield mean average serum concentrations approximately 1.2-fold and 3.7-fold higher than the rat serum EC90 (adjusted for -0.1% brain penetration), respectively.
- the immunomodulatory agent is an IFN- ⁇ 1 molecule and is administered intravenously, subcutaneously or intramuscularly.
- the IFN- ⁇ 1 molecule can be administered at one or more of:
- Avonex® is administered at 30 microgram once a week via intramuscular injection. Following titration when applicable, Avonex® can be administered by IM injection following dosage and administration schedules known in the art.
- the IFN- ⁇ agent e.g., Avonex®
- an injection device e.g., an autoinjection device or pen.
- the anti-LINGO-1 antibody molecule is supplied as a liquid drug product containing 50 mg/mL opicinumab (BIIB033) (also referred to herein as an antibody molecule having a VH that includes the amino acid sequence of SEQ ID NO: 275 and a VL that includes the amino acid sequence of SEQ ID NO: 276), 10 mM sodium citrate, 160 mM L-arginine hydrochloride (pH 6.5), and 0.03% (weight per volume) polysorbate 80.
- the anti- LINGO-1 antibody molecule can be administered by IV infusion following saline dilution.
- the immunomodulatory agent is Avonex®, which is is formulated as a sterile clear liquid for IM injection. Each 0.5 mL of Avonex in a prefilled glass syringe contains 30 meg of interferon ⁇ -la. Other ingredients include sodium acetate trihydrate, glacial acetic acid, arginine hydrochloride, and polysorbate 20 in Water for Injection at a pH of approximately 4.8.
- the immunomodulatory agent e.g., Avonex®, can be administered by any suitable means, e.g., a pen or other device.
- Treatment of a subject with a combination therapy described herein can be combined with one or more of the following therapies often used in symptom management of subjects having MS: Tegretol® (carbamazepine), Epitol® (carbamazepine), Atretol® (carbamazepine), Carbatrol® (carbamazepine), Neurontin® (gabapentin), Topamax® (topiramate), Zonegran® (zonisamide), Dilantin® (phenytoin), Norpramin® (desipramine), Elavil® (amitriptyline), Tofranil® (imipramine), Imavate® (imipramine), Janimine® (imipramine), Sinequan® (doxepine), Adapin® (doxepine), Triadapin® (doxepine), Zonalon® (doxepine), Vivactil® (pro trip ty line), Marinol® (synthetic cannabinoids), Trental® (pentoxifylline
- Valium® (diazepam), BuSpar® (buspirone), Symmetrel® (amantadine), Cylert® (pemoline), Provigil® (modafinil), Ditropan XL® (oxybutynin), DDAVP® (desmopressin, vasopressin), Detrol® (tolterodine), Urecholine® (bethane), Dibenzyline® (phenoxybenzamine), Hytrin® (terazosin), Pro-Banthine® (propantheline), Urispas® (hyoscyamine), Cystopas®
- immunoglobulin pregabalin, ziconotide, Baclofen and AnergiX-MS®.
- Efficacy endpoints of the therapy in any subject can be evaluated using tests and assessments known in the art.
- the subject can be evaluated by acquiring the subject's status using EDSS.
- the subject can be evaluated by obtaining a measure of upper and/or lower extremity function, and/or a measure of ambulatory function, e.g., short distance ambulatory function, in addition to acquiring the subject' s status using EDSS.
- an assessment of lower extremity ambulatory function e.g., Timed Walk of 25 Feet (T25FW)
- an assessment of upper extremity function e.g., 9 Hole Peg Test (9HP)
- T25FW Timed Walk of 25 Feet
- 9HP 9 Hole Peg Test
- Additional exemplary efficacy endpoints that can be evaluated include one or more of the following.
- Subjects can be evaluated for confirmed improvement of neurophysical and/or cognitive function over treatment as measured by a composite endpoint comprising the Expanded Disability Status Scale (EDSS), Timed 25-Foot Walk (T25FW), 9-Hole Peg Test (9HPT), and (3-Second) Paced Auditory Serial Addition Test (PASAT).
- EDSS Expanded Disability Status Scale
- T25FW Timed 25-Foot Walk
- 9HPT 9-Hole Peg Test
- PASAT Paced Auditory Serial Addition Test
- Improvement on neurophysical and/or cognitive function can be defined as at least 1 of the following:
- the improvement can be detected using the Symbol Digit Modalities Test (SDMT).
- an exemplary end point for measuring the status of a patient with
- AON is measurement of the recovery of latency of the VEP (e.g., time for a signal to travel from the retina to the visual cortex). Latency is a measure of how well neurons can conduct, e.g., their conduction timing. Neurons that have intact myelin can conduct better (transmit a signal faster) than neurons that have lost or damaged myelin.
- the amplitude as measured by VEP is a measure of the number of funtioning neurons (e.g., that contain axons capable of transmitting information) and the number of inactive (e.g., dead/damaged) neurons, with a
- VEP full field visual evoked potential
- mfVEP multifocal VEP
- FF-VEP measures the latency and amplitude of the central visual field, e.g., sum of the latencies or amplitudes of the visual pathway representing about 5 degrees of the central vision (macular vision).
- mfVEP measures the latency and amplitude of up to 56 segments covering up to 60 degrees of the visual field for each individual eye.
- an improvement in latency delay is an indication of remyelination of lesions along the visual pathway, including optic nerves, optic radiations, or visual cortex.
- preserved amplitude e.g., preserved FF-VEP or mfVEP amplitude
- Subjects can be evaluated for confirmed worsening of neurophysical and/or cognitive function and/or disability treatment as measured by a composite endpoint of the EDSS,
- Progression of disability or worsening of neuro-physical and/or cognitive function is defined as at least 1 of the following:
- the worsening from baseline can be measured by SDMT.
- exemplary secondary endpoints to measure the status of a patient with AON include measuring the change in thickness of the retinal layers (retinal ganglion cells neurons and unmyelinated axonal segment) and/or measurement of retinal structure and function.
- Retinal structure can be measured using known methods, e.g., spectral domain optical coherence tomography (SD-OCT) while clinical visual function can be measured using visual acuity, e.g. low contrast letter acuity (1.25% and 2.5%), and/or high contrast visual acuity.
- SD-OCT spectral domain optical coherence tomography
- Multifocal visual evoked potential mjVEP which measure whether remaining (live) axons can be repaired via remyelination following AON.
- the FF-VEP and/or mfVEP amplitude is a different but equally important measure of visual pathway damage for each eye.
- an amplitude of at least 40 nanovolts (e.g., at least 40, 50, 60, 70, 80, 90, 100 nanovolts or more) lower than a control amplitude on mfVEP indicates the presence of visual pathway damage serving each of the two eye(s) of the subject.
- an amplitude that is at least 20% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more) lower than a control amplitude indicates the presence of optic nerve damage in the eye(s) of the subject.
- an mfVEP amplitude that is about 180 nanovolts or lower e.g., about 180, 170, 160, 150, 140,
- a control amplitude is the average VEP amplitude (e.g., FF-VEP in microvolts or mfVEP amplitude in microvolts) of a normal eye, e.g., an eye of a subject not having one or more symptoms of an optic nerve disorder or condition (e.g., acute optic neuritis); or the fellow eye of the subject where the fellow eye does not exhibit one or more symptoms of an optic nerve disorder or condition (e.g., acute optic neuritis) but the visual pathway can become affected over time as a results of new lesion development anywhere along the pathway.
- a control amplitude is the baseline VEP amplitude (e.g., FF-VEP or mfVEP amplitude) of a fellow normal eye.
- the FF-VEP and/or mfVEP latency is a measure of optic nerve conductance.
- a latency that is at least 3 milliseconds higher (e.g., at least 3, 4, 5, 6, 7, 8, 9, 10, or more milliseconds higher) than a control latency indicates a delay in optic nerve conductance in the eye(s) of the subject.
- a latency that is at least 3% e.g., at least 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 12%, 15%, 20%, 30%, 40%, 60%, 80%, or more
- higher than a control latency indicates a delay in optic nerve conductance in the eye(s) of the subject.
- a FF-VEP latency that is at least about 110 milliseconds (e.g., at least about 110, 120, 130, 140, 150, 160, 170, 180 milliseconds or more) indicates a delay in optic nerve conductance in the eye(s) of the subject.
- an mfVEP latency can be at least about 155 msec (e.g., at least about 155, 165, 175, 185 milliseconds or more).
- a control latency is the average VEP latency (e.g., FF-VEP or mfVEP latency) of a normal eye, e.g., an eye of a subject not having one or more symptoms of an optic nerve disorder or condition (e.g., acute optic neuritis); or the fellow eye of the subject where the fellow eye does not exhibit one or more symptoms of an optic nerve disorder or condition (e.g., acute optic neuritis).
- a control latency is the baseline VEP latency (e.g., FF-VEP or mfVEP latency) of a fellow normal eye.
- latency recovery is indicated by a FF-VEP and/or mfVEP latency of an affected eye after treatment that is within 15% (e.g., within 15%, 12%, 10%, 8%, 6%, 4%, or less) of the FF-VEP and/or mfVEP latency of a control latency, e.g., the baseline latency of the fellow normal eye or the unaffected eyes of healthy adults of similar age, sex, and head circumference (normative data).
- a control latency e.g., the baseline latency of the fellow normal eye or the unaffected eyes of healthy adults of similar age, sex, and head circumference (normative data).
- latency recovery is indicated by a FF-VEP and/or mfVEP latency of an affected eye after treatment that is within 15 milliseconds (e.g., within 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 milliseconds) of the FF-VEP and/or mfVEP latency of a control latency, e.g., the baseline latency of the fellow normal eye.
- latency recovery is indicated by a FF-VEP latency of an affected eye after treatment that is about 120 milliseconds or less (e.g., about 120, 110, 100, 90, 80 nanovolts, or less).
- SD-OCT Spectral Domain Optical Coherence Tomography
- RNFL retinal nerve fiber layer
- RGCL retinal ganglion cell layer
- the reduction of thickness in RNFL and RGCL following AON are considered evidence of axonal and neuronal loss (death).
- reduced loss of RNFL and/or RGCL thickness e.g., a less than 12% (e.g., less than 12%, 11%, 10%, 9%, 8%, 6%, 4%, or less) reduction in thickness compared to the thickness of RNFL and/or RGCL in a normal eye (e.g., normal fellow eye), is evidence of neuroaxonal protection and/or repair.
- visual function is measured by visual acuity, e.g., low-contrast (e.g., 1.25 or 2.5%) letter acuity (LCLA) or high-contrast (e.g., 100%) visual acuity (HCVA).
- LCLA letter acuity
- HCVA high-contrast
- Low Contrast Letter Acuity (secondary endpoint) is a measure of the ability of a patient to distinguish between degrees of low contrast (faint grey letters on white background).
- High contrast visual acuity is a measure of the ability to distinguish between degrees of high contrast (black letters on white background).
- the visual acuity is reported in number of letters that a subject is able to correctly read.
- an increase in visual acuity (e.g., by at least 6 letters, e.g., at least 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 30, 40, or more letters), e.g., LCLA and/or HCVA, is evidence of improvement or preservation of visual function in an AON- affected eye.
- visual quality of life is an endpoint used in accordance with the methods described herein.
- visual quality of life is measured as described herein, e.g., in Example 6.
- visual quality of life is measured by a patient reported outcome test.
- Exemplary patient reported outcome tests include but are not limited to a NIH-NEI visual functional questionnaire (NEI-VFQ) (see, e.g., Mangione et al. Arch. Opthalmol. 116.11(1998): 1496-1504) and a neuro-ophthalmic supplement (NOS-10) (see, e.g., Raphael et al. Am. J. Ophthalmol. 142.6(2006): 1026-35.e2).
- NEI-VFQ NIH-NEI visual functional questionnaire
- NOS-10 neuro-ophthalmic supplement
- an increase of at least 4 points is evidence of improvement of visual related quality of life.
- subjects can be evaluated using additional clinical measures, including:
- 6MW Six Minute Walk
- Analysis of brain MRI focused on measures of repair at the focal and diffuse levels with both new and preexisting lesions can include one or more of:
- DTI diffusion tensor imaging
- subjects can be evaluated by patient reported outcomes, including one or more of:
- MSWS-12 12-Item Multiple Sclerosis Walking Scale
- the summary statistics may generally include: the number of subjects randomized or dosed; or the number of subjects with data, mean, SD, median, and range.
- the summary statistics may generally include: the number of subjects randomized or dosed; the number of subjects with data, or the percent of subjects with data in each category.
- Exemplary primary efficacy endpoints can include the percentage of subjects with confirmed clinical improvement in 1 or more of the components of the composite endpoint (EDSS, T25FW, 9HPT, or PASAT).
- the percentage of confirmed improvers can be presented by treatment groups, and the data analyzed by a logistic regression model. Time to confirmed improvement may be analyzed using the Cox proportional hazards model.
- Baseline EDSS, T25FW, 9HPT (both dominant and non-dominant hands), PASAT, and stratification factors may be included in both logistic regression and Cox models as covariates. If 2 baseline EDSS assessments are performed, the higher EDSS score can be used for analysis. MRI activity may be explored as potential covariates as well.
- the secondary efficacy endpoint may include the percentage of subjects with confirmed clinical worsening in 1 or more of the components of the composite endpoint (EDSS, T25FW, 9HPT, or PASAT).
- the percentage of confirmed worseners can be presented by treatment groups, and the data analyzed by a logistic regression model. Time to confirmed worsening may be analyzed using the Cox proportional hazards model. Baseline EDSS, T25FW, 9HPT (both dominant and non-dominant hands), PASAT, and stratification factors may be included in both logistic regression and Cox models as covariates. If 2 baseline EDSS assessments are performed, the higher EDSS score can be used for analysis. MRI activity may be explored as potential covariates as well.
- the exploratory endpoints may include clinical metrics, MRI metrics, and PRO variables. They can be summarized by presenting summary statistics for continuous variables or frequency distributions for categorical variables. The statistical methods used will depend on the nature of the variables.
- Binary variables can be analyzed by using a logistic regression model; continuous variables can be analyzed by using the analysis of covariance model, adjusting for the corresponding baselines and stratification factors.
- Time-to-event variables can be analyzed using the Cox proportional hazards regression model, by adjusting for the corresponding baselines and stratification factors.
- Count variables can be analyzed by a Negative Binomial regression model or a Wilcoxon rank-sum test.
- the T25FW is a timed walk of 25 feet.
- the T25W is a measure of quantitative ambulatory capacity over a short distance that is responsive to deterioration mostly for subjects who are very disabled, e.g. , EDSS steps 6-6.5. It can be used as quantitative measure of lower extremity function.
- the patient is directed to one end of a clearly labeled 25-foot course and is instructed to walk 25 feet as quickly as possible, but safely.
- the task can be immediately administered again by having the patient walk back the same distance.
- Patients may use assistive devices when completing the T25W.
- a time limit of 3 minutes to complete the test is usually used. The test is discontinued if the patient cannot complete Trial 2 of the T25W after a 5 minute rest period, or if the patient cannot complete a trial in 3 minutes. 9HPT
- the 9HPT is a 9-hole peg test. It is a quantitative measure that captures a clinically important aspect of upper extremity ⁇ e.g. , arm and hand) function that is not measured by the EDSS or the T25FW. Unlike the EDSS and the T25FW, the 9HPT is responsive across a wide EDSS range. Broadly, a patient is asked to pick up 9 pegs one at a time, using their hands only, and put the pegs into the holes on a peg board as quickly as possible until all of the holes are filled. The patient must then, without pausing, remove the pegs one at a time and return them to the container as quickly as possible.
- Both the dominant and non-dominant hands are tested twice (two consecutive trials of the dominant hand, followed immediately by two consecutive trials of the non-dominant hand). A time limit of 5 minutes to complete the test is usually used. The test is discontinued if the patient cannot complete one trial of the 9HPT test in 5 minutes; if the patient cannot complete a trial with his or her dominant hand within 5 minutes, the patient is usually instructed to move onto the trials with the non-dominant hand.
- the 6 minute walking test (6MW) is used to assess walking distance. Broadly, the patient is asked to walk the fastest speed possible without physical assistance for 6 minutes and the distance is measured. Assistive devices can be used but should be kept consistent and documented from test to test. The patient should walk continuously if possible, but the patient can slow down to stop or rest during the test.
- the Scripps Neurological Rating Scale measures several parameters, including, mentation and mood; eyes and related cranial nerves, e.g. , visual acuity, visual fields, eye movements, nystagmus; lower cranial nerves; motor function in each extremity, e.g. , right upper, left upper, right lower, left lower; deep tendon reflexes, e.g. , upper extremities, lower extremities; Babinski sign, e.g. , left side, right side; sensory function in each extremity, e.g. , right upper, left upper, right lower, left lower; cerebellar signs, e.g. , upper extremities, lower extremities; and gait trunk balance, e.g. , special category for autonomic dysfunction, e.g. , bladder dysfunction, sexual dysfunction.
- SNRS Scripps Neurological Rating Scale
- the EDSS is based on a standardized neurological examination, focusing on the symptoms that occur frequently in MS.
- the EDSS assess the seven functional systems: visual, brainstem, pyramidal, cerebellar, sensory, bowel/bladder and cerebral;
- the EDSS also includes an assessment of walking range. Based on the functional system scores and the walking range, an EDSS step is determined. The range of the EDSS includes 19 steps from 0 to 10, with EDSS step 0 corresponding to a completely normal examination and EDSS step 10 to death due to MS. For EDSS ratings between 0 and 4, the scale relies mainly on the scores of the individual FS. For ratings over 4, the EDSS is primarily determined by the ability and range of walking.
- the Multiple Sclerosis Walking Scale- 12 (MSWS-12) test is a self rated measure of walking ability.
- the test contains 12 questions with Likert-type responses, describing the impact of MS on walking.
- the questions were generated from 30 MS patient interviews, expert opinions, and literature reviews.
- the ABILHAND 56-Item Questionnaire is a measure of manual ability designed to measure a patient's experience of problems in performing everyday tasks such as feeding, dressing, or managing tasks.
- MSIS-29 The Multiple Sclerosis Impact Scale 29 (MSIS-29) is a 29 item self report rating scale which measures physical and psychological parameters of MS. Three of the items deal with limited abilities, and the remaining 26 items are related to being impacted by symptoms or consequences of disease. Twenty of the items refer to physical function. Responses use a 5 point Likert scale range from 1 to 5.
- the short form 36 (SF-36) test measures overall health related quality of life.
- the SF- 36 is a structured, self report questionnaire that the patient can generally complete with little to no intervention from a physician. There is no single overall score for the SF-36, instead it generates 8 subscales and two summary scores.
- the 8 subscales include physical functioning, role limitations due to physical problems, bodily pain, general health perceptions, vitality, social functioning, role limitations due to emotional problems, and mental health.
- the two summary scores include a physical component summary and a mental health component summary.
- SDMT Digit Modalities Test
- the SDMT is a test that evaluates processing speed and working memory in which the subject is given 90 seconds to pair specific numbers with given geometric figures based on a reference key. It is modeled after the Digit Symbol or Coding Tasks tests, which have been included in the Wechsler intelligence scales for many years (e.g., Wechsler et al. (1974) Manual for the Wechsler Intelligence Scale for Children-Revised. New York: Psychological Corporation; Wechsler et al. (1981) WAIS-R Manual. New York: Psychological Corporation). Recognizing the limitations some patients have with manual dexterity, Rao and colleagues modified the SDMT to include only an oral response (Rao et al. (1991) Neurology 41: 685- 691).
- participant's are presented with an 8.5 x 11 inch sheet that contains the numbers and symbols to be processed.
- the top row of stimuli includes nine symbols, each of which is paired with a single digit in the key.
- the remainder of the page has a pseudo-randomized sequence of these symbols, and the participant's task is to respond orally with the digit associated with each of the symbols as quickly as possible.
- the score is the total number of correct matches (out of 110) made by the subject within the 90 second time frame.
- Neurology 63: 1301-1306) has also been confirmed.
- correlations between performance and brain MRI have also been documented (see e.g., Benedict et al. (2007) Multiple Sclerosis 13: 722-730; Houtchens et al. (2007) Neurology 69: 113-123; Tekok-Kilic et al. (2007) Neurolmage 36: 1294-1300).
- PASAT requires patients to monitor a series of 61 audiotaped digits while adding each consecutive digit to the one immediately preceding it (Gronwall et al. (1977) Perceptual and Motor Skills 44: 367-373).
- the PASAT requires both rapid information processing and simultaneous allocation of attention to two tasks, as well as reasonably intact calculation ability.
- the PASAT was administered at four inter- stimulus intervals (2.4 seconds, 2.0 seconds, 1.6 seconds, and 1.2 seconds). The number of inter- stimulus intervals and presentation rates were subsequently modified by Rao and colleagues for use with MS patients to 3.0 seconds and 2.0 seconds (Rao et al. (1991) A Manual for the Brief, Repeatable Battery of Neuropsychological Tests in Multiple Sclerosis: National Multiple Sclerosis Society; Rao et al. (1991) Neuropsychological Screening Battery for Multiple
- the SRT was first developed by Buschke et al. (see Buschke et al. (1974) Neurology 24: 1019-1025) who conducted research in the area of anterograde amnesia. Rather than ask patients to recall an entire word list on each successive learning trial, the experimenter only repeated words not recalled on each successive learning trial. Subsequently, several memory investigators developed normative data for the test, and alternate forms. Note, the original versions were based on a form of the test using 15 words and 12 learning trials. Such an administration is arduous and time consuming, and therefore there has been much interest in shorter forms of the SRT.
- the administration procedure widely used in MS research is a six- trial form developed by Rao et al. (see e.g., Rao et al. (1991) A Manual for the Brief,
- the BVMT-R is based on an initial effort to develop an equivalent alternate form visual memory test along the lines of the visual reproduction subtest from the Wechsler Memory Scale (Benedict et al. (1993) Neuropsychological Rehabilitation 3: 37-51; Benedict et al. (1995) Clinical Neuropsychologist 9: 11-16; Wechsler et al. (1987) Wechsler Memory Scale-Revised Manual. New York: Psychological Corporation).
- the BVMT included just a single exposure to a one-page presentation of six visual designs.
- the revised version includes three 10-second exposures to the stimulus (Benedict et al. (1997) Brief Visuospatial Memory Test - Revised: Professional Manual.
- Example 1 LINGO- 1 antagonism reduces morbidity and mortality from MQG-EAE in mice and promotes axonal protection in the inflamed optic nerve.
- Acute optic neuritis is an inflammatory disease of the optic nerve that often occurs in multiple sclerosis. AON is caused by inflammatory injury to the optic nerve and presents with visual loss due to edema, inflammation, and damage to the myelin sheath covering the optic nerve and axons. As a result of AON, there is often a significant loss of the retinal nerve fiber layer and retinal ganglion cell layer. Current treatment of AON is limited to intravenous treatment with high dose corticosteroids which fasten the resolution of edema but do not promote central nervous system (CNS) remyelination or provide neuroaxonal protection from CNS inflammatory demyelination.
- CNS central nervous system
- Animal models for the study of optic neuritis include the rat and mouse experimental autoimmune encephalomyelitis (EAE) models; in which EAE induction results in the development of optic nerve neuritis.
- EAE autoimmune encephalomyelitis
- the effects of LINGO- 1 antagonism were analyzed using an EAE mouse model. Briefly, EAE was induced in
- the optic nerve was imaged once at EAE-disease peak using diffusion tensor imaging (DTI) on a Bruker 4,7T MRI system.
- MRI images were acquired with the following parameters: TR of 1 s, TE of 30 ms, ⁇ of 10 ms, 8 NEX, slice thickness 0.5 mm, field of view
- mice were euthanized with pentobarbital, perfused with PBS, fixed with 4% paraformaldhyde (PFA) in 0.1M PBS, and the optic nerves removed and post fixed in 4% PFA solution containing 2.5% glutaraldhyde and 0.1M sodium cacodylate buffer and processed for electron microscopy.
- PFA paraformaldhyde
- Optic nerve diffusion MRI scans were conducted on 16 surviving control-treated mice and 18 surviving anti-LINGO-1 antibody treated mice at peak EAE severity on days 16-17 post induction.
- the optic nerve ROI images comprised 10 voxels in the center of the optic nerves at the prechiasmal level.
- Diffusion tensor imaging (DTI) showed significantly higher apparent diffusion coefficient (ADC) values parallel to the long axis (longitudinal, axial, or parallel diffusivity or ⁇ ) in anti-LINGO-1 antibody treated mice (mean 1,400, SD 27 msec) than in control-treated mice (mean 1,183, SD 36 msec) (FIG. 3, FIG. 4).
- LINGO- 1 antagonism reduced the morbidity and mortality from MOG-EAE in mice; and promoted axonal protection in the inflamed optic nerve by reducing the loss of axonal area and reducing the loss of axial diffusivity.
- damage to the optic nerve was seen in MOG-EAE histologically and by MRI, and it appeared to be reduced by LINGO- 1 blockade.
- Example 2 LINGO- 1 antagonism in combination with corticosteroid treatment provides increased axonal protection compared to LINGO- 1 antagonism alone in the rat EAE model.
- AON Acute optic neuritis
- CNS central nervous system
- Animal models for the study of optic neuritis include the rat and mouse experimental autoimmune encephalomyelitis (EAE) models; in which EAE induction results in the development of optic nerve neuritis.
- EAE experimental autoimmune encephalomyelitis
- the effects of LINGO- 1 antagonism alone and in combination with corticosteroid treatment were analyzed using the EAE rat model.
- rats were treated with 30mg/kg/day of methylprednisolone (MP) in saline solution or saline solution alone (Veh) intravenously for three consecutive days.
- MP methylprednisolone
- rats were given either 6mg/kg of the anti-LINGO- 1 monoclonal antibody or control antibody, administered intrapetitoneally once a week for three weeks.
- control treatment group Veh + control Antibody (Ab)
- MP treatment group MP + control antibody
- anti-LINGO-1 monoclonal antibody treatment group Veh + anti-LINGO-1 monoclonal antibody
- combination treatment group MP + anti-LINGO-1 monoclonal antibody
- the combination treatment group (MP + anti-LINGO-1 monoclonal antibody) showed an 8 -fold increase in axonal numbers compared with the control treatment group (Veh + control Antibody; suggesting that combination treatment of anti-LINGO-1 antagonist such as an anti-LINGO-1 monoclonal antibody with high dose corticosteroids can have a synergistic effect (FIG. 8).
- LINGO- 1 antagonism reduced axonal loss in the optic nerve in rat EAE.
- LINGO- 1 blockade with the monoclonal anti-LINGO- 1 antibody reduced axonal loss in rat MOG-EAE; and the neuroprotective effects of LINGO- 1 blockade in rat MOG-EAE were seen in the presence or absence of anti-inflammatory treatment with high- dose steroids.
- Example 3 Efficacy of anti-LINGO- 1 antibodies in a clinical study
- AON damages the optic nerve, causing loss of the myelin sheath and axonal injury, and may result in loss of visual function, e.g., result in permanent structural and functional visual deficits.
- AON is one of the initial manifestations of MS. There are commonalities in the pathology of MS and AON lesions (e.g., demyelination, axonal loss, inflammation).
- IV corticosteroids that decrease inflammation in the acute phase but do not affect long-term visual outcome.
- CNS central nervous system
- AON is considered a good clinical model to measure the mechanisms of action of anti-
- LINGO- 1 remyelination and neuroprotection.
- Anti-LINGO- 1 is a first-in-class human monoclonal antibody directed against LINGO- 1 (leucine-rich repeat and immunoglobulin domain-containing neurite outgrowth inhibitor receptor-interacting protein- 1), a CNS-specific cell surface glycoprotein and inhibitor of oligodendrocyte differentiation, myelination and remyelination.
- Anti-LINGO- 1 has shown efficacy in preclinical models of remyelination and neuroprotection, and was well tolerated in Phase 1 clinical studies. See, e.g., Mi et al. CNS Drugs 27.7(2013):493-503; and Tran et al. Neurol. Neuroimmunol. Neuroinflamm.
- the randomized, double-blind, placebo-controlled, parallel-group Phase 2 (RENEW) trial (ClinicalTrials.gov Identifier: NCT01721161) was aimed to determine the efficacy and safety of anti-LINGO-1, e.g., BIIB033, e.g., opicinumab, for CNS remyelination following the onset of a first episode of AON and establish proof of biology.
- BIIB033 e.g., opicinumab
- Eligible subjects were 18-55 years of age, had no history of multiple sclerosis (MS), and were experiencing a first unilateral AON episode.
- a diagnosis AON was based on the presence of at least two of the following: reduced visual acuity; afferent pupillary defect; color vision loss; visual field abnormality; and pain on eye movement. Enrollment was permitted irrespective of whether demyelinating lesions were present on brain magnetic resonance imaging. AON as onset of multiple sclerosis (MS; newly diagnosed) was acceptable.
- FF-VEP full-field visual evoked potential
- a concomitant ophthalmologic disorder e.g., diabetic retinopathy, macular degeneration, macular exudate, macular edema, glaucoma, severe astigmatism, ocular trauma, neuromyelitis optica, ischemic optic neuropathy, congenital nystagmus, or other ophthalmologic conditions that could confound the assessment of functional and anatomic endpoint; a history of any clinically significant cardiac, endocrinologic, hematologic, hepatic, immunologic, metabolic, urologic, pulmonary, neurologic, dermatologic, psychiatric, oncologic, renal, severe allergic or anaphylactic reactions, or other major disease; a history of HIV, hepatit
- Participants also were excluded if the investigator felt there were other reasons making participation unsuitable or, if female participants were currently pregnant, were breastfeeding or were planning to conceive during the study. All participants received treatment with 1 g methylprednisolone/day IV for 3-5 days before randomization. Following treatment with high-dose methylprednisolone, participants were randomized 1: 1 to placebo or anti-LINGO-1 100 mg/kg IV every 4 weeks from baseline to week 20 (6 treatments) and followed to week 32 (FIG. 9). Only the pharmacists preparing treatments/pharmacy monitors were unblinded. Participants were randomized by the permuted block method using a centralized interactive voice and web response system. The block size was four and the number of blocks was 50. An independent biostatistician was responsible for overseeing the randomization.
- FF-VEP Full-field VEP
- SD-OCT spectral-domain optical coherence tomography
- LCLA low-contrast letter acuity
- RNFL thickness in the affected eye compared with the unaffected eye at baseline (i) RGCL/inner plexiform retinal layer (IPL) thickness in the affected eye compared with the unaffected eye at baseline; (iii) change in low-contrast letter acuity (LCLA) from baseline measured using
- Thickness of the retinal nerve fiber layer and ganglion cell layer were methods used to evaluate neuroprotection.
- ANCOVA covariance
- MMRM mixed-effect model repeated measure
- the per-protocol population is defined as subjects from the ITT population who complete the study, did not miss more than one dose of anti-LINGO-1 or placebo, and did not receive MS modifying therapies during the study period. Last observation carried forward was used for imputation in the ANCOVA analyses.
- SD-OCT scans were obtained according to a standardized study protocol. Images were obtained at each site from a Spectralis (Heidelberg Engineering, Heidelberg Germany) or Cirrus (Carl Zeiss Meditec, Dublin, CA) system.
- a dense 97-line preset scan covering a 20° x 20° area of the macula centered on the foveal center point in high-speed mode with an ART setting of 16 was used to image the neurosensory retinal layers and vitreoretinal interface;
- a seven-line preset scan pattern covering a 30° x 5° area centered on the foveal center point in high-resolution mode with an ART setting of 25 was used to assess the central macula;
- an optic nerve head 73-line preset scan covering a 15° x 15° area centered on the optic nerve in high-speed mode with an ART setting of 9 was used to image the optic nerve, peripapillary area, and corresponding vitreoretinal interface;
- an RNFL preset optic nerve 12° diameter circle scan centered on the optic nerve was used to measure the RNFL thickness.
- a 512 x 128 macular cube covering a 6 mm x 6 mm area of the macula centered on the foveal center point was used to image the neurosensory retinal layers and vitreoretinal interface;
- a five-line raster (HD) preset raster scan pattern centered on the foveal center point was used to assess the central macula;
- a 200 x 200 optic nerve cube preset scan centered on the optic nerve was used to image the optic nerve, peripapillary area, and corresponding vitreoretinal interface, and to measure RNFL thickness.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Psychiatry (AREA)
- Ophthalmology & Optometry (AREA)
- Hospice & Palliative Care (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2016205197A AU2016205197B2 (en) | 2015-01-08 | 2016-01-08 | LINGO-1 antagonists and uses for treatment of demyelinating disorders |
| JP2017536321A JP2018504400A (ja) | 2015-01-08 | 2016-01-08 | Lingo‐1拮抗薬及び脱髄障害の治療のための使用 |
| MX2017009038A MX2017009038A (es) | 2015-01-08 | 2016-01-08 | Antagonistas de proteina 1 de interacción con el receptor de nogo que contiene el dominio de inmunoglobulina y repeticiones ricas en leucina (lingo-1) y usos para el tratamiento de trastornos desmielinizantes. |
| EP16703864.5A EP3242893A1 (en) | 2015-01-08 | 2016-01-08 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
| CA2973266A CA2973266A1 (en) | 2015-01-08 | 2016-01-08 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
| HK18106253.9A HK1246810A1 (zh) | 2015-01-08 | 2016-01-08 | Lingo-1对抗药及用於治疗脱髓鞘疾病的用途 |
| US15/541,944 US10435467B2 (en) | 2015-01-08 | 2016-01-08 | LINGO-1 antagonists and uses for treatment of demyelinating disorders |
| IL253271A IL253271A0 (en) | 2015-01-08 | 2017-07-02 | Lingo-1 antagonists and uses for the treatment of demyelinating disorders |
| US16/589,322 US20200216533A1 (en) | 2015-01-08 | 2019-10-01 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
| US17/127,324 US20210277111A1 (en) | 2015-01-08 | 2020-12-18 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
| IL281089A IL281089A (en) | 2015-01-08 | 2021-02-24 | LINGO–1 antagonists and uses for the treatment of demyelinating disorders |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562101336P | 2015-01-08 | 2015-01-08 | |
| US62/101,336 | 2015-01-08 | ||
| US201562147783P | 2015-04-15 | 2015-04-15 | |
| US62/147,783 | 2015-04-15 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/541,944 A-371-Of-International US10435467B2 (en) | 2015-01-08 | 2016-01-08 | LINGO-1 antagonists and uses for treatment of demyelinating disorders |
| US16/589,322 Continuation US20200216533A1 (en) | 2015-01-08 | 2019-10-01 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016112270A1 true WO2016112270A1 (en) | 2016-07-14 |
Family
ID=55346189
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/012619 Ceased WO2016112270A1 (en) | 2015-01-08 | 2016-01-08 | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US10435467B2 (https=) |
| EP (1) | EP3242893A1 (https=) |
| JP (2) | JP2018504400A (https=) |
| AU (1) | AU2016205197B2 (https=) |
| CA (1) | CA2973266A1 (https=) |
| HK (1) | HK1246810A1 (https=) |
| IL (2) | IL253271A0 (https=) |
| MX (1) | MX2017009038A (https=) |
| WO (1) | WO2016112270A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9745375B2 (en) | 2008-07-09 | 2017-08-29 | Biogen Ma Inc. | Compositions comprising antibodies to LINGO or fragments thereof |
| US9796780B2 (en) | 2012-05-14 | 2017-10-24 | Biogen Ma Inc. | LINGO-2 antagonists for treatment of conditions involving motor neurons |
| WO2018013714A1 (en) * | 2016-07-13 | 2018-01-18 | Biogen Ma Inc. | Dosage regimens of lingo-1 antagonists and uses for treatment of demyelinating disorders |
| US10435467B2 (en) | 2015-01-08 | 2019-10-08 | Biogen Ma Inc. | LINGO-1 antagonists and uses for treatment of demyelinating disorders |
| US11167003B2 (en) | 2017-03-26 | 2021-11-09 | Mapi Pharma Ltd. | Methods for suppressing or alleviating primary or secondary progressive multiple sclerosis (PPMS or SPMS) using sustained release glatiramer depot systems |
| US12097292B2 (en) | 2016-08-28 | 2024-09-24 | Mapi Pharma Ltd. | Process for preparing microparticles containing glatiramer acetate |
| US12370233B2 (en) | 2016-08-31 | 2025-07-29 | Mapi Pharma Ltd. | Depot systems comprising glatiramer acetate |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11737665B2 (en) * | 2019-06-21 | 2023-08-29 | Tesseract Health, Inc. | Multi-modal eye imaging with shared optical path |
| CN113584041A (zh) * | 2021-04-15 | 2021-11-02 | 浙江警察学院 | 一种转基因斑马鱼(mbp:egfp)脱脊髓疾病模型的构建方法 |
| WO2022245816A1 (en) * | 2021-05-18 | 2022-11-24 | Pelican Therapeutics, Inc. | Treatment of autoimmune inflammatory diseases with tnfrsf25-binding agents |
Citations (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4987071A (en) | 1986-12-03 | 1991-01-22 | University Patents, Inc. | RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods |
| US5116742A (en) | 1986-12-03 | 1992-05-26 | University Patents, Inc. | RNA ribozyme restriction endoribonucleases and methods |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US5840299A (en) | 1994-01-25 | 1998-11-24 | Athena Neurosciences, Inc. | Humanized antibodies against leukocyte adhesion molecule VLA-4 |
| US6159730A (en) | 1992-11-13 | 2000-12-12 | Idec Pharmaceutical Corporation | Impaired dominant selectable marker sequence and intronic insertion strategies for enhancement of expression of gene product and expression vector systems comprising same |
| US6413777B1 (en) | 1997-03-14 | 2002-07-02 | Idec Pharmaceuticals Corp. | Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same |
| WO2003014161A2 (en) | 2001-08-10 | 2003-02-20 | Aberdeen University | Antigen binding domains from fish |
| US20030143204A1 (en) | 2001-07-27 | 2003-07-31 | Lewis David L. | Inhibition of RNA function by delivery of inhibitors to animal cells |
| US6602503B1 (en) | 1993-01-12 | 2003-08-05 | Biogen, Inc. | Recombinant anti-VLA-4 antibody molecules |
| US20030166282A1 (en) | 2002-02-01 | 2003-09-04 | David Brown | High potency siRNAS for reducing the expression of target genes |
| US20030224432A1 (en) | 2002-05-03 | 2003-12-04 | Jason Myers | Methods and compositions for use in preparing siRNAs |
| US20040038278A1 (en) | 2002-08-12 | 2004-02-26 | George Tzertzinis | Methods and compositions relating to gene silencing |
| US20040086884A1 (en) | 2000-03-16 | 2004-05-06 | Genetica, Inc. | Methods and compositions for RNA interference |
| WO2010005570A2 (en) * | 2008-07-09 | 2010-01-14 | Biogen Idec Ma Inc. | Compositions comprising antibodies to lingo or fragments thereof |
| WO2012109108A1 (en) | 2011-02-07 | 2012-08-16 | Biogen Idec Ma Inc. | S1p modulating agents |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2014058875A2 (en) * | 2012-10-09 | 2014-04-17 | Biogen Idec Ma Inc. | Combination therapies and uses for treatment of demyelinating disorders |
Family Cites Families (231)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| IE52535B1 (en) | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| GB8308235D0 (en) | 1983-03-25 | 1983-05-05 | Celltech Ltd | Polypeptides |
| US6054561A (en) | 1984-02-08 | 2000-04-25 | Chiron Corporation | Antigen-binding sites of antibody molecules specific for cancer antigens |
| EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4694778A (en) | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| JPS63501765A (ja) | 1985-11-01 | 1988-07-21 | インタ−ナショナル、ジェネティック、エンジニアリング インコ−ポレ−テッド | 抗体遺伝子のモジュ−ル組立体、それにより産生された抗体及び用途 |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US4904582A (en) | 1987-06-11 | 1990-02-27 | Synthetic Genetics | Novel amphiphilic nucleic acid conjugates |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| US5336603A (en) | 1987-10-02 | 1994-08-09 | Genentech, Inc. | CD4 adheson variants |
| WO1989006692A1 (en) | 1988-01-12 | 1989-07-27 | Genentech, Inc. | Method of treating tumor cells by inhibiting growth factor receptor function |
| GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
| ATE120454T1 (de) | 1988-06-14 | 1995-04-15 | Cetus Oncology Corp | Kupplungsmittel und sterisch gehinderte, mit disulfid gebundene konjugate daraus. |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| EP0436597B1 (en) | 1988-09-02 | 1997-04-02 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0368684B2 (en) | 1988-11-11 | 2004-09-29 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| EP0401384B1 (en) | 1988-12-22 | 1996-03-13 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
| IE63847B1 (en) | 1989-05-05 | 1995-06-14 | Res Dev Foundation | A novel antibody delivery system for biological response modifiers |
| DE69031120T2 (de) | 1989-05-19 | 1998-01-15 | Genentech, Inc., South San Francisco, Calif. | Her2 extrazellulare domäne |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5180820A (en) | 1989-08-30 | 1993-01-19 | Barde Yves Alain | Brain-derived neurotrophic factor |
| US5605690A (en) | 1989-09-05 | 1997-02-25 | Immunex Corporation | Methods of lowering active TNF-α levels in mammals using tumor necrosis factor receptor |
| GB8928874D0 (en) | 1989-12-21 | 1990-02-28 | Celltech Ltd | Humanised antibodies |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| EP1690934A3 (en) | 1990-01-12 | 2008-07-30 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| AU654811B2 (en) | 1990-03-20 | 1994-11-24 | Trustees Of Columbia University In The City Of New York, The | Chimeric antibodies with receptor binding ligands in place of their constant region |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5219837A (en) | 1990-06-21 | 1993-06-15 | Trustees Of The University Of Pennsylvania | Method of stimulating myelination of cells |
| EP0585287B1 (en) | 1990-07-10 | 1999-10-13 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US5532351A (en) | 1990-07-12 | 1996-07-02 | Arch Development Corporation | Nucleic acid sequences encoding OMGP |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| ATE352612T1 (de) | 1990-08-29 | 2007-02-15 | Pharming Intellectual Pty Bv | Homologe rekombination in säugetier-zellen |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| ATE300615T1 (de) | 1990-08-29 | 2005-08-15 | Genpharm Int | Transgene mäuse fähig zur produktion heterologer antikörper |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| DE69133036T2 (de) | 1990-11-09 | 2003-02-06 | Stephen D. Gillies | Cytokine immunokonjugate |
| US5252714A (en) | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
| CA2405246A1 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with alterred binding properties |
| EP0575485A1 (en) | 1991-03-01 | 1993-12-29 | Dyax Corp. | Process for the development of binding mini-proteins |
| DK0580737T3 (da) | 1991-04-10 | 2004-11-01 | Scripps Research Inst | Heterodimere receptorbiblioteker ved anvendelse af phagemider |
| CA2110799A1 (en) | 1991-06-14 | 1992-12-23 | Arnold H. Horwitz | Microbially-produced antibody fragments and their conjugates |
| DE4122599C2 (de) | 1991-07-08 | 1993-11-11 | Deutsches Krebsforsch | Phagemid zum Screenen von Antikörpern |
| US5756096A (en) | 1991-07-25 | 1998-05-26 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| IE922437A1 (en) | 1991-07-25 | 1993-01-27 | Idec Pharma Corp | Recombinant antibodies for human therapy |
| ES2136092T3 (es) | 1991-09-23 | 1999-11-16 | Medical Res Council | Procedimientos para la produccion de anticuerpos humanizados. |
| ES2341666T3 (es) | 1991-12-02 | 2010-06-24 | Medimmune Limited | Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos. |
| ATE244763T1 (de) | 1992-02-11 | 2003-07-15 | Cell Genesys Inc | Erzielen von homozygotem durch zielgerichtete genetische ereignisse |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| WO1994017828A2 (en) | 1993-02-09 | 1994-08-18 | Biogen, Inc. | Treatment for insulin dependent diabetes |
| US5468872A (en) | 1993-09-16 | 1995-11-21 | Cephalon, Inc. | K-252a functional derivatives potentiate neurotrophin-3 for the treatment of neurological disorders |
| WO1995014930A1 (en) | 1993-11-23 | 1995-06-01 | Genentech, Inc. | Kinase receptor activation assay |
| US5753225A (en) | 1993-12-03 | 1998-05-19 | The Regents Of The University Of California | Antibodies that mimic actions of neurotrophins |
| EP0733070A1 (en) | 1993-12-08 | 1996-09-25 | Genzyme Corporation | Process for generating specific antibodies |
| PT1231268E (pt) | 1994-01-31 | 2005-11-30 | Univ Boston | Bancos de anticorpos policlonais |
| GB9402331D0 (en) | 1994-02-07 | 1994-03-30 | Univ Mcgill | Nerve growth factor structural analogs and their uses |
| US5877016A (en) | 1994-03-18 | 1999-03-02 | Genentech, Inc. | Human trk receptors and neurotrophic factor inhibitors |
| DE4415539C2 (de) | 1994-05-03 | 1996-08-01 | Osama Dr Dr Med Omer | Pflanzen mit virustatischer und antiviraler Wirkung |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO2001004311A1 (en) | 1999-07-07 | 2001-01-18 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| HU226980B1 (en) | 1994-10-25 | 2010-04-28 | Toyama Chemical Co Ltd | Use of 1,2-ethanediol derivatives or salts thereof for the preparation of pharmaceutical compositions having nerve growth factor (nfg) potentiator activity |
| US5770577A (en) | 1994-11-14 | 1998-06-23 | Amgen Inc. | BDNF and NT-3 polypeptides selectively linked to polyethylene glycol |
| US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US6280964B1 (en) | 1995-04-14 | 2001-08-28 | The Regents Of The University Of California | Binding sites for phosphotyrosine binding domains |
| CA2219361C (en) | 1995-04-27 | 2012-02-28 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| EP0823941A4 (en) | 1995-04-28 | 2001-09-19 | Abgenix Inc | HUMAN ANTIBODIES DERIVED FROM IMMUNIZED XENO MOUSES |
| US5811524A (en) | 1995-06-07 | 1998-09-22 | Idec Pharmaceuticals Corporation | Neutralizing high affinity human monoclonal antibodies specific to RSV F-protein and methods for their manufacture and therapeutic use thereof |
| CA2245835A1 (en) | 1995-06-14 | 1997-01-03 | The Regents Of The University Of California | Novel high affinity human antibodies to tumor antigens |
| US5707829A (en) | 1995-08-11 | 1998-01-13 | Genetics Institute, Inc. | DNA sequences and secreted proteins encoded thereby |
| IT235676Y1 (it) | 1995-07-27 | 2000-07-12 | Felice Gaudioso | Allestimenti per lo svolgimento del gioco wormhole action match. |
| GB9524973D0 (en) | 1995-12-06 | 1996-02-07 | Lynxvale Ltd | Viral vectors |
| GB9525180D0 (en) | 1995-12-08 | 1996-02-07 | Univ Mcgill | Design of hormone-like antibodies with agonistic and antagonistic fuctions |
| JP2978435B2 (ja) | 1996-01-24 | 1999-11-15 | チッソ株式会社 | アクリロキシプロピルシランの製造方法 |
| US6455277B1 (en) | 1996-04-22 | 2002-09-24 | Amgen Inc. | Polynucleotides encoding human glial cell line-derived neurotrophic factor receptor polypeptides |
| JP2000501416A (ja) | 1996-04-26 | 2000-02-08 | ユニバーシティー オブ オタワ | ニューロン病を治療し予防するための、治療法および薬物のスクリーニング法 |
| PT912184E (pt) | 1996-06-25 | 2002-12-31 | Cephalon Inc | Utilizacao de um derivado de k-252a para o tratamento de doencas do sietma nervoso central ou periferico e sobre-producao de citoquina |
| WO1998002540A1 (en) | 1996-07-12 | 1998-01-22 | Genentech, Inc. | Chimeric heteromultimer adhesins |
| IL127872A0 (en) | 1996-07-19 | 1999-10-28 | Amgen Inc | Analogs of cationic proteins |
| BR9712978A (pt) | 1996-09-11 | 2000-04-18 | Gen Hospital Corp | Vìrus de dna de não-mamìferos possuindo uma proteìna de revestimento alterada |
| US6261545B1 (en) | 1996-09-13 | 2001-07-17 | Advanced Medicine Research Institute | Ophthalmic compositions of neurotrophic factors, remedies for optic nerve function disorders and method for treating optic nerve function disorders |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US6420140B1 (en) | 1996-10-11 | 2002-07-16 | Abgenix, Inc. | Production of multimeric protein by cell fusion method |
| US20070213290A1 (en) | 1996-10-17 | 2007-09-13 | Kingsman Alan J | Neurite regeneration |
| US6593290B1 (en) | 1996-11-01 | 2003-07-15 | Genentech, Inc. | Treatment of inner ear hair cells |
| US6156728A (en) | 1996-11-01 | 2000-12-05 | Genentech, Inc. | Treatment of inner ear hair cells |
| EP1500329B1 (en) | 1996-12-03 | 2012-03-21 | Amgen Fremont Inc. | Human antibodies that specifically bind human TNF alpha |
| US20020137890A1 (en) | 1997-03-31 | 2002-09-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| BRPI9809391B8 (pt) | 1997-04-14 | 2021-05-25 | Amgen Res Munich Gmbh | processo para a produção de um receptor de antígeno anti-humano, anticorpo humano e composição farmacêutica |
| US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1998052976A1 (en) | 1997-05-21 | 1998-11-26 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US20020112251A1 (en) | 1997-08-04 | 2002-08-15 | Mccarthy Sean A. | Novel genes encoding proteins having prognostic, diagnostic, preventive, therapeutic and other uses |
| AU8768798A (en) | 1997-08-04 | 1999-02-22 | Millennium Pharmaceuticals, Inc. | Tango-78, tango-79, and tango-81 nucleic acid molecules and polypeptides |
| NZ503343A (en) | 1997-09-17 | 2002-09-27 | Genentech Inc | Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells |
| US6974689B1 (en) | 1997-09-18 | 2005-12-13 | Genentech, Inc. | Nucleic acid encoding PRO211 polypeptides |
| EP1205546B1 (en) | 1997-10-24 | 2005-11-23 | Genentech, Inc. | Polypeptide and nucleic acids encoding the same |
| FR2776661B1 (fr) | 1998-03-26 | 2002-04-05 | Centre Nat Rech Scient | Polypeptide immunoreactif du recepteur trka du ngf et utilisations |
| US7282482B2 (en) | 1998-04-08 | 2007-10-16 | The Regents Of The University Of California | NGF for the prevention of demyelination in the nervous system |
| AU5922999A (en) | 1998-09-16 | 2000-04-03 | Genentech Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| CZ304224B6 (cs) | 1998-11-06 | 2014-01-15 | Schwab | Monoklonální protilátka |
| WO2000034317A2 (en) | 1998-12-08 | 2000-06-15 | Biovation Limited | Method for reducing immunogenicity of proteins |
| CA2383592A1 (en) | 1999-03-31 | 2000-10-05 | Curagen Corporation | 2384891 acids including open reading frames encoding polypeptides; orfx |
| US7034132B2 (en) | 2001-06-04 | 2006-04-25 | Anderson David W | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
| US20040067490A1 (en) | 2001-09-07 | 2004-04-08 | Mei Zhong | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
| US6949245B1 (en) | 1999-06-25 | 2005-09-27 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| WO2001001748A2 (en) | 1999-07-02 | 2001-01-11 | Genentech, Inc. | Peptide compounds that bind her2 |
| EP1074617A3 (en) | 1999-07-29 | 2004-04-21 | Research Association for Biotechnology | Primers for synthesising full-length cDNA and their use |
| WO2001009318A1 (fr) | 1999-07-29 | 2001-02-08 | Helix Research Institute | Genes associes au cancer du foie |
| JP2003527089A (ja) | 1999-08-17 | 2003-09-16 | インサイト・ゲノミックス・インコーポレイテッド | 膜関連タンパク質 |
| US6461414B1 (en) | 1999-10-29 | 2002-10-08 | Baker Hughes Incorporated | Foam monitoring and control system |
| EP1672070A3 (en) | 1999-12-01 | 2006-10-04 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US6680209B1 (en) | 1999-12-06 | 2004-01-20 | Biosite, Incorporated | Human antibodies as diagnostic reagents |
| US7119165B2 (en) | 2000-01-12 | 2006-10-10 | Yale University | Nogo receptor-mediated blockade of axonal growth |
| IL150566A0 (en) | 2000-01-12 | 2003-02-12 | Univ Yale | Nucleic acids and polypeptides and nogo-receptor proteins |
| DE60123399T2 (de) | 2000-01-18 | 2007-08-23 | The Texas A & M University System, College Station | Pharmazeutische zubereitungen enthaltend beta-turn peptidomimetische zyklische substanzen |
| WO2001055333A2 (en) | 2000-01-25 | 2001-08-02 | Hyseq, Inc. | Methods and materials relating to transforming growth factor alpha-like polypeptides and polynucleotides |
| CA2393616A1 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| CA2395872A1 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| WO2001059063A2 (en) | 2000-01-31 | 2001-08-16 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| CA2399652A1 (en) | 2000-02-03 | 2001-08-09 | Hyseq, Inc. | Methods and materials relating to neuronal guidance molecule-like (ngm-like) polypeptides and polynucleotides |
| US6800607B2 (en) | 2000-02-29 | 2004-10-05 | Ltt Bio-Pharma Co., Ltd. | Modified BDNF |
| CN101289511A (zh) | 2000-04-11 | 2008-10-22 | 杰南技术公司 | 多价抗体及其应用 |
| AU2001266787A1 (en) | 2000-06-07 | 2002-01-08 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| US6430914B1 (en) | 2000-06-29 | 2002-08-13 | Foster Wheeler Energy Corporation | Combined cycle power generation plant and method of operating such a plant |
| US20040010118A1 (en) | 2000-08-16 | 2004-01-15 | Zerhusen Bryan D. | Novel proteins and nucleic acids encoding same |
| AU9261901A (en) | 2000-09-13 | 2002-03-26 | Smithkline Beecham Corp | Novel compounds |
| WO2002029058A2 (en) | 2000-10-05 | 2002-04-11 | Curagen Corporation | Human proteins, polynucleotides encoding them and methods of using the same |
| NZ525422A (en) | 2000-10-06 | 2006-09-29 | Biogen Idec Inc | Isolated polynucleotides comprising a nucleic acid which encodes a polypeptide which modulates axonal growth in CNS neurons |
| EP1340088B1 (en) | 2000-11-17 | 2007-01-17 | University Of Rochester | In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells |
| US20030216558A1 (en) | 2000-12-22 | 2003-11-20 | Morris David W. | Novel compositions and methods for cancer |
| AU2002255478A1 (en) | 2001-01-10 | 2002-09-12 | Pe Corporation (Ny) | Kits, such as nucleic acid arrays, comprising a majority of human exons or transcripts, for detecting expression and other uses thereof |
| BR0206985A (pt) | 2001-01-29 | 2005-04-19 | Idec Pharma Corp | Anticorpos modificados e métodos de uso |
| AU2002327164A1 (en) | 2001-01-29 | 2002-12-09 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| WO2003008583A2 (en) | 2001-03-02 | 2003-01-30 | Sagres Discovery | Novel compositions and methods for cancer |
| CA2448073A1 (en) | 2001-06-04 | 2002-12-12 | Curagen Corporation | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
| US20030162734A1 (en) | 2001-06-28 | 2003-08-28 | Miller Carol A. | Modulation of DENN-MADD expression and interactions for treating neurological disorders |
| US7223558B2 (en) | 2001-07-11 | 2007-05-29 | Bristol-Myers Squibb Company | Polynucleotides encoding three novel human cell surface proteins with leucine rich repeats and immunologobulin folds, BGS2, 3, and 4 and variants thereof |
| US20030226155A1 (en) | 2001-08-30 | 2003-12-04 | Biorexis Pharmaceutical Corporation | Modified transferrin-antibody fusion proteins |
| US20040142325A1 (en) | 2001-09-14 | 2004-07-22 | Liat Mintz | Methods and systems for annotating biomolecular sequences |
| US20050123990A1 (en) | 2001-09-26 | 2005-06-09 | Incyte Corporation | Membrane associated proteins |
| AU2002365258A1 (en) | 2001-10-12 | 2003-09-02 | University Of Vermont And State Agricultural College | Binding peptides specific for the extracellular domain of erbb2 and uses therefor |
| WO2003035833A2 (en) | 2001-10-22 | 2003-05-01 | Exelixis, Inc. | Modifier of the p53 pathway and methods of use |
| US20030157641A1 (en) | 2001-11-16 | 2003-08-21 | Idec Pharmaceuticals Corporation | Polycistronic expression of antibodies |
| US7309485B2 (en) | 2001-12-03 | 2007-12-18 | Children's Medical Center Corporation | Reducing myelin-mediated inhibition of axon regeneration |
| EP1504099A4 (en) | 2001-12-10 | 2006-05-10 | Nuvelo Inc | NEW NUCLEIC ACIDS AND POLYPEPTIDES |
| US20030133912A1 (en) | 2001-12-11 | 2003-07-17 | Davidson Beverly L. | Receptor-targeted adenoviral vectors |
| US20030215849A1 (en) | 2002-03-01 | 2003-11-20 | Marcia Belvin | PDPK1s as modifiers of the p53 pathway and methods of use |
| WO2003086289A2 (en) | 2002-04-05 | 2003-10-23 | Amgen Inc. | Human anti-opgl neutralizing antibodies as selective opgl pathway inhibitors |
| PT1534736E (pt) | 2002-08-10 | 2010-09-07 | Univ Yale | Antagonistas do receptor nogo |
| WO2005016955A2 (en) | 2003-08-07 | 2005-02-24 | Biogen Idec Ma Inc. | Nogo receptor antagonists |
| CA2824167C (en) | 2002-09-06 | 2018-09-25 | Amgen Inc. | Therapeutic human anti-il-1r1 monoclonal antibody |
| US6919426B2 (en) | 2002-09-19 | 2005-07-19 | Amgen Inc. | Peptides and related molecules that modulate nerve growth factor activity |
| US7816497B2 (en) | 2002-10-30 | 2010-10-19 | University Of Kentucky | Compositions and methods for inhibiting drusen complement components C3a and C5a for the treatment of age-related macular degeneration |
| US20040186044A1 (en) | 2002-11-06 | 2004-09-23 | Cosgaya Jose Miguel | Modulation of myelination by interaction with P75 and TRK receptors |
| US7388079B2 (en) | 2002-11-27 | 2008-06-17 | The Regents Of The University Of California | Delivery of pharmaceutical agents via the human insulin receptor |
| US7347818B2 (en) | 2003-02-24 | 2008-03-25 | Neurotrax Corporation | Standardized medical cognitive assessment tool |
| WO2004085648A2 (en) | 2003-03-19 | 2004-10-07 | Biogen Idec Ma Inc. | Nogo receptor binding protein |
| CN1871259A (zh) | 2003-08-22 | 2006-11-29 | 比奥根艾迪克Ma公司 | 具有改变的效应物功能的经改进的抗体和制备它的方法 |
| US20070275871A1 (en) | 2003-08-28 | 2007-11-29 | Biorexis Technology, Inc. | Epo Mimetic Peptides and Fusion Proteins |
| US7205387B2 (en) | 2003-08-28 | 2007-04-17 | Agency For Science, Technology And Research | Recombinant polypeptide useful for neurotrophin receptor mediated gene delivery and as neurotrophin agonist |
| US7288638B2 (en) | 2003-10-10 | 2007-10-30 | Bristol-Myers Squibb Company | Fully human antibodies against human 4-1BB |
| WO2005063819A2 (en) | 2003-12-23 | 2005-07-14 | Crucell Holland B.V. | Human binding molecule against cd1a |
| JP2007527712A (ja) | 2004-02-12 | 2007-10-04 | レキシコン・ジェネティクス・インコーポレーテッド | 新規な遺伝子破壊、これに関する組成物と方法 |
| US7973139B2 (en) | 2004-03-26 | 2011-07-05 | Human Genome Sciences, Inc. | Antibodies against nogo receptor |
| US20050214288A1 (en) | 2004-03-26 | 2005-09-29 | Human Genome Sciences, Inc. | Antibodies against Nogo receptor |
| JP4969440B2 (ja) | 2004-04-08 | 2012-07-04 | デビッド, ビー. エイガス, | 疼痛治療のためのErbBアンタゴニスト |
| PT1776136E (pt) | 2004-06-24 | 2012-12-05 | Biogen Idec Inc | Tratamento de estados que envolvem desmielinização |
| US20060009288A1 (en) | 2004-07-07 | 2006-01-12 | Devos John A | Conveying information to an interrogator using resonant and parasitic radio frequency circuits |
| CA2576193A1 (en) | 2004-08-03 | 2006-02-16 | Biogen Idec Ma Inc. | Taj in neuronal function |
| JO3000B1 (ar) | 2004-10-20 | 2016-09-05 | Genentech Inc | مركبات أجسام مضادة . |
| EP1833509A4 (en) | 2004-12-03 | 2008-12-03 | Biogen Idec Inc | DELAYING OR PREVENTING THE APPEARANCE OF MULTIPLE SCLEROSIS |
| AR054260A1 (es) | 2005-04-26 | 2007-06-13 | Rinat Neuroscience Corp | Metodos de tratamiento de enfermedades de la neurona motora inferior y composiciones utilizadas en los mismos |
| WO2006119013A2 (en) | 2005-04-29 | 2006-11-09 | Wyeth | Nogo receptor functional motifs and peptide mimetics related thereto and methods of using the same |
| US8309517B2 (en) | 2005-05-16 | 2012-11-13 | Mcgill University | LGI, LINGO and p75NTR family members: novel modulators of neuronal growth |
| WO2006133164A2 (en) | 2005-06-06 | 2006-12-14 | Wyeth | Anti-trkb monoclonal antibodies and uses thereof |
| WO2006133353A2 (en) | 2005-06-08 | 2006-12-14 | The University Of North Carolina At Chapel Hill | Methods of facilitating neural cell survival using non-peptide and peptide bdnf neurotrophin mimetics |
| JP2008543790A (ja) | 2005-06-16 | 2008-12-04 | ユニバーシティー・テクノロジーズ・インターナショナル・インコーポレイテッド | 短腸症候群の治療 |
| SI1904104T1 (sl) | 2005-07-08 | 2013-12-31 | Biogen Idec Ma Inc. | Protitelesa SP35 in njihova uporaba |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| EP1940460A4 (en) | 2005-10-27 | 2009-08-12 | Biogen Idec Inc | OLIGOD DRO CYTEN MYELIN GLYCOPROTEIN COMPOSITIONS AND USES THEREOF |
| KR20080080109A (ko) | 2005-11-04 | 2008-09-02 | 바이오겐 아이덱 엠에이 인코포레이티드 | 도파민성 뉴런의 신경돌기 성장 및 생존의 촉진 방법 |
| CA2631181A1 (en) | 2005-12-02 | 2007-06-07 | Biogen Idec Ma Inc. | Treatment of conditions involving demyelination |
| US20070186296A1 (en) | 2006-02-02 | 2007-08-09 | Wyeth | Cloning, characterization, and application of tnfrsf19 in neurological disorders |
| CN101405297A (zh) | 2006-02-03 | 2009-04-08 | 惠氏公司 | Lingo-1结构 |
| WO2007098283A2 (en) | 2006-02-27 | 2007-08-30 | Biogen Idec Ma Inc. | Use of antagonists of maif receptor complex molecules and neurotrophic factors for treatment of neurological diseases and disorders |
| JP2009544703A (ja) | 2006-07-24 | 2009-12-17 | バイオジェン・アイデック・エムエイ・インコーポレイテッド | Sp35またはTrkAアンタゴニストの投与により髄鞘形成、ニューロンの生存および希乏突起膠細胞の分化を促進するための方法 |
| ATE502960T1 (de) | 2006-11-17 | 2011-04-15 | Novartis Ag | Lingo bindende moleküle und pharmazeutische verwendung davon |
| CA2672750A1 (en) | 2006-12-20 | 2008-07-03 | Rinat Neuroscience Corporation | Trkb agonists for treating autoimmune disorders |
| US8128926B2 (en) | 2007-01-09 | 2012-03-06 | Biogen Idec Ma Inc. | Sp35 antibodies and uses thereof |
| CN101636168B (zh) | 2007-01-09 | 2013-05-29 | 比奥根艾迪克Ma公司 | Sp35抗体及其用途 |
| WO2009048605A1 (en) | 2007-10-11 | 2009-04-16 | Biogen Idec Ma Inc. | Methods for treating pressure induced optic neuropathy, preventing neuronal degeneration and promoting neuronal cell, survival via administration of lingo-1 antagonists and trkb agonists |
| CA2702630C (en) | 2007-11-08 | 2017-11-21 | Biogen Idec Ma Inc. | Use of lingo-4 antagonists in the treatment of conditions involving demyelination |
| US7988647B2 (en) | 2008-03-14 | 2011-08-02 | Bunn Frank E | Assessment of medical conditions by determining mobility |
| US8460657B2 (en) | 2008-06-25 | 2013-06-11 | H. Lundbeck A/S | Modulation of the TrpV: Vps10p receptor system for the treatment of pain |
| EA019512B1 (ru) | 2008-07-02 | 2014-04-30 | Эмерджент Продакт Дивелопмент Сиэтл, Ллс | Il-6-опосредованная иммунотерапия |
| CN102171247A (zh) | 2008-07-02 | 2011-08-31 | 特鲁比昂药品公司 | TNF-α拮抗剂多靶点结合蛋白 |
| WO2010056374A2 (en) | 2008-11-17 | 2010-05-20 | Veracyte, Inc. | Methods and compositions of molecular profiling for disease diagnostics |
| JP5289986B2 (ja) | 2009-01-20 | 2013-09-11 | 株式会社オーディオテクニカ | 赤外線送信機 |
| FR2958293B1 (fr) | 2010-04-01 | 2014-09-26 | Centre Nat Rech Scient | Outils pour l'identification de ligands de lingo-1,lingo-2, lingo-3 et lingo-4, et utilisations |
| WO2011133799A1 (en) | 2010-04-21 | 2011-10-27 | Northwestern University | Medical evaluation system and method using sensors in mobile devices |
| KR101360409B1 (ko) | 2011-07-11 | 2014-02-11 | 연세대학교 산학협력단 | 위암 암 줄기세포 특성에 기초한 위암의 치료용 타겟 |
| EP2845134A1 (en) | 2012-04-20 | 2015-03-11 | Biogen Idec MA Inc. | Cognitive composite parameters and uses thereof for evaluating multiple sclerosis |
| CN104470541A (zh) | 2012-05-14 | 2015-03-25 | 比奥根艾迪克Ma公司 | 用于治疗涉及运动神经元的疾患的lingo-2拮抗剂 |
| WO2014028299A1 (en) | 2012-08-13 | 2014-02-20 | Biogen Idec Ma Inc. | Disease progression parameters and uses thereof for evaluating multiple sclerosis |
| JP6663859B2 (ja) | 2014-05-20 | 2020-03-13 | ユニバーシティー オブ アイオワ リサーチ ファウンデーション | ハンチントン病の治療化合物 |
| JP2018504400A (ja) | 2015-01-08 | 2018-02-15 | バイオジェン・エムエイ・インコーポレイテッドBiogen MA Inc. | Lingo‐1拮抗薬及び脱髄障害の治療のための使用 |
-
2016
- 2016-01-08 JP JP2017536321A patent/JP2018504400A/ja not_active Withdrawn
- 2016-01-08 EP EP16703864.5A patent/EP3242893A1/en not_active Ceased
- 2016-01-08 AU AU2016205197A patent/AU2016205197B2/en not_active Ceased
- 2016-01-08 US US15/541,944 patent/US10435467B2/en not_active Expired - Fee Related
- 2016-01-08 WO PCT/US2016/012619 patent/WO2016112270A1/en not_active Ceased
- 2016-01-08 CA CA2973266A patent/CA2973266A1/en not_active Abandoned
- 2016-01-08 HK HK18106253.9A patent/HK1246810A1/zh unknown
- 2016-01-08 MX MX2017009038A patent/MX2017009038A/es unknown
-
2017
- 2017-07-02 IL IL253271A patent/IL253271A0/en unknown
-
2019
- 2019-10-01 US US16/589,322 patent/US20200216533A1/en not_active Abandoned
-
2020
- 2020-10-28 JP JP2020180193A patent/JP2021008522A/ja active Pending
- 2020-12-18 US US17/127,324 patent/US20210277111A1/en not_active Abandoned
-
2021
- 2021-02-24 IL IL281089A patent/IL281089A/en unknown
Patent Citations (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| US4987071A (en) | 1986-12-03 | 1991-01-22 | University Patents, Inc. | RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods |
| US5093246A (en) | 1986-12-03 | 1992-03-03 | University Patents, Inc. | Rna ribozyme polymerases, dephosphorylases, restriction endoribo-nucleases and methods |
| US5116742A (en) | 1986-12-03 | 1992-05-26 | University Patents, Inc. | RNA ribozyme restriction endoribonucleases and methods |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US6159730A (en) | 1992-11-13 | 2000-12-12 | Idec Pharmaceutical Corporation | Impaired dominant selectable marker sequence and intronic insertion strategies for enhancement of expression of gene product and expression vector systems comprising same |
| US6602503B1 (en) | 1993-01-12 | 2003-08-05 | Biogen, Inc. | Recombinant anti-VLA-4 antibody molecules |
| US5840299A (en) | 1994-01-25 | 1998-11-24 | Athena Neurosciences, Inc. | Humanized antibodies against leukocyte adhesion molecule VLA-4 |
| US6413777B1 (en) | 1997-03-14 | 2002-07-02 | Idec Pharmaceuticals Corp. | Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same |
| US20040086884A1 (en) | 2000-03-16 | 2004-05-06 | Genetica, Inc. | Methods and compositions for RNA interference |
| US20030143204A1 (en) | 2001-07-27 | 2003-07-31 | Lewis David L. | Inhibition of RNA function by delivery of inhibitors to animal cells |
| WO2003014161A2 (en) | 2001-08-10 | 2003-02-20 | Aberdeen University | Antigen binding domains from fish |
| US20030166282A1 (en) | 2002-02-01 | 2003-09-04 | David Brown | High potency siRNAS for reducing the expression of target genes |
| US20030224432A1 (en) | 2002-05-03 | 2003-12-04 | Jason Myers | Methods and compositions for use in preparing siRNAs |
| US20040038278A1 (en) | 2002-08-12 | 2004-02-26 | George Tzertzinis | Methods and compositions relating to gene silencing |
| WO2010005570A2 (en) * | 2008-07-09 | 2010-01-14 | Biogen Idec Ma Inc. | Compositions comprising antibodies to lingo or fragments thereof |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2012109108A1 (en) | 2011-02-07 | 2012-08-16 | Biogen Idec Ma Inc. | S1p modulating agents |
| WO2014058875A2 (en) * | 2012-10-09 | 2014-04-17 | Biogen Idec Ma Inc. | Combination therapies and uses for treatment of demyelinating disorders |
Non-Patent Citations (200)
| Title |
|---|
| "Antibody Engineering Lab Manual", SPRINGER-VERLAG, article "Protein Sequence and Structure Analysis of Antibody Variable Domains" |
| "Antisense RNA and DNA", vol. 89, 1988, COLD SPRING HARBOR LABORATORY, pages: 7305 - 9 |
| "Current Prolocols in Human Genetics", 1994, JOHN WILEY & SONS |
| "Current Protocols in Molecular Biology", 1993, JOHN WILEY & SONS |
| "Current Protocols in Molecular Biology", vol. 2, 1996, JOHN WILEY & SONS, INC., article "Chapter 11--Immunology" |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ARDUINI, RM ET AL., PROTEIN EXPR PURIF, vol. 34, no. 2, 2004, pages 229 - 42 |
| ASHER MULLARD: "An audience with Doug Williams", NATURE REVIEWS DRUG DISCOVERY, vol. 13, 1 December 2014 (2014-12-01), pages 880 - 881, XP055260095, DOI: 10.1038/nrd4496 * |
| BAKER, D.P. ET AL., BIOCONJUG CHEM, vol. 17, no. 1, 2006, pages 179 - 88 |
| BAKER, D.P. ET AL., J INTERFERON CYTOKINE RES, vol. 30, no. 10, 2010, pages 777 - 85 |
| BALCER ET AL., NEUROLOGY, vol. 74, no. 3, 2010, pages 16 - 23 |
| BARBAS ET AL., PNAS, vol. 88, 1991, pages 7978 - 7982 |
| BARRETTE ET AL., MOL CELL NEUROSCI, vol. 34, 2007, pages 519 - 38 |
| BARTEL DP, CELL, vol. 136, no. 2, 2009, pages 215 - 33 |
| BARTEL, D.; SZOSTAK, J.W., SCIENCE, vol. 261, 1993, pages 1411 - 1418 |
| BECK RW ET AL., N ENGL J MED, vol. 326, 1992, pages 581 - 8 |
| BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060 |
| BENEDICT ET AL., ARCHIVES OF NEUROLOGY, vol. 63, 2006, pages 1301 - 1306 |
| BENEDICT ET AL., CLINICAL NEUROPSYCHOLOGIST, vol. 16, 2002, pages 381 - 397 |
| BENEDICT ET AL., CLINICAL NEUROPSYCHOLOGIST, vol. 9, 1995, pages 11 - 16 |
| BENEDICT ET AL., JOURNAL OF THE INTERNATIONAL NEUROPSYCHOLOGICAL SOCIETY, vol. 11, 2005, pages 727 - 736 |
| BENEDICT ET AL., JOURNAL OF THE INTERNATIONAL NEUROPSYCHOLOGICAL SOCIETY, vol. 12, 2006, pages 549 - 558 |
| BENEDICT ET AL., JOURNAL OF THE INTERNATIONAL NEUROPSYCHOLOGICAL SOCIETY, vol. 16, 2006, pages 228 - 237 |
| BENEDICT ET AL., MULTIPLE SCLEROSIS, vol. 13, 2007, pages 722 - 730 |
| BENEDICT ET AL., MULTIPLE SCLEROSIS, vol. 14, 2008, pages 940 - 946 |
| BENEDICT ET AL., NEUROPSYCHOLOGICAL REHABILITATION, vol. 3, 1993, pages 37 - 51 |
| BENEDICT ET AL., PSYCHOLOGICAL ASSESSMENT, vol. 8, 1996, pages 145 - 153 |
| BENEDICT ET AL.: "Brief Visuospatial Memory Test - Revised: Professional Manual", 1997, PSYCHOLOGICAL ASSESSMENT RESOURCES, INC. |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BILLY ET AL., PROC. NATL. SCI. USA, vol. 98, 2001, pages 14428 - 14433 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BITSCH ET AL., BRAIN, vol. 123, 2000, pages 1174 - 1183 |
| BJARTMAR ET AL., CURR OPIN NEUROL, vol. 14, 2001, pages 271 - 278 |
| BJARTMAR ET AL., J NEUROCYTOL, vol. 28, 1999, pages 383 - 395 |
| BOCK, M. ET AL., BR J OPHTHALMOL., vol. 96, no. 1, 2012, pages 62 - 7 |
| BORNSTEIN ET AL., N ENGL J MED., vol. 317, 1987, pages 408 - 414 |
| BRUGGEMAN ET AL., EUR J IMMUNOI, vol. 21, 1991, pages 1323 - 1326 |
| BRUGGEMAN ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 33 - 40 |
| BUSCHKE ET AL., NEUROLOGY, vol. 24, 1974, pages 1019 - 1025 |
| CADAVID ET AL., 29H CONGRESS EUROPEAN COMMITTEE FOR TREATMENT AND RESEARCH IN MS, 2 October 2013 (2013-10-02) |
| CARIM-TODD ET AL., EUR JOURNAL NEUROSCI, vol. 18, 2003, pages 3167 - 82 |
| CHANG ET AL., N ENGL J MED, vol. 346, 2002, pages 165 - 173 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHRISTODOULOU ET AL., NEUROLOGY, vol. 60, 2003, pages 1793 - 1798 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLEMENS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 6499 - 6503 |
| CLINICAL PHARMACY, vol. 12, pages 488 - 505 |
| COCKETT ET AL., BIOL1'ECHNOLOGY, vol. 8, 1990, pages 2 |
| COLBERRE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 1 |
| COLCHER, D. ET AL., ANN N YACAD SCI, vol. 880, 1999, pages 263 - 80 |
| COLE, S.R. ET AL., INVEST OPHTALMOL VIS SCI, vol. 41, no. 5, 2000, pages 1017 - 1021 |
| DE STEFANO N. ET AL., CNS DRUGS, vol. 28, no. 2, February 2014 (2014-02-01), pages 147 - 56 |
| DELOIRE ET AL., JOURNAL OF NEUROLOGY, NEUROSURGERY & PSYCHIATRY, vol. 76, 2005, pages 519 - 526 |
| DIEGO CADAVID ET AL: "Efficacy Analysis of the Anti-LINGO-1 Monoclonal Antibody BIIB033 in Acute Optic Neuritis: the RENEW Trial (P7.202)", NEUROLOGY, vol. 84, no. No. 14, Supplement P7.202, 6 April 2015 (2015-04-06), XP055259950 * |
| DRAKE ET AL., MULTIPLE SCLEROSIS, vol. 16, 2010, pages 228 - 237 |
| DUBESSY A-L ET AL: "Biotherapies in multiple sclerosis: a step toward remyelination and neuroprotection?", REVUE NEUROLOGIQUE DEC 2014, vol. 170, no. 12, December 2014 (2014-12-01), pages 770 - 778, XP009189206, ISSN: 0035-3787 * |
| DUDA ET AL., J CLIN INVEST, vol. 105, 2000, pages 967 - 976 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| ELBASHIR ET AL., NATURE., vol. 411, 2001, pages 494 - 8 |
| FARIA ET AL., NATURE BIOTECH., vol. 19, 2001, pages 40 - 44 |
| FERGUSON ET AL., BRAIN, vol. 120, 1997, pages 393 - 399 |
| FOECKING ET AL., GENE, vol. 45, 1986, pages 101 |
| FOX E, CLIN THER, vol. 28, no. 4, 2006, pages 461 - 74 |
| FU ET AL., INVEST OPTHALMOL VIS SCI, vol. 49, 2008, pages 975 - 85 |
| FUCHS ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 1370 - 1372 |
| GARRAD ET AL., BIOL/TECHNOLOGY, vol. 9, 1991, pages 1373 - 1377 |
| GRAM ET AL., PNAS, vol. 89, 1992, pages 3576 - 3580 |
| GREEN, L.L. ET AL., NATURE GENET., vol. 7, 1994, pages 13 - 21 |
| GRIFFTHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GRONWALL ET AL., PERCEPTUAL AND MOTOR SKILLS, vol. 44, 1977, pages 367 - 373 |
| HANNAY ET AL., J CLIN EXP NEUROPSYCHOL., vol. 7, 1985, pages 251 - 263 |
| HASELHOFF; GERLACH, NATURE, vol. 334, 1988, pages 585 - 59 |
| HASELHOFF; GERLACH, NATURE, vol. 334, 1988, pages 585 - 591 |
| HAWKINS ET AL., J MOL BIOL, vol. 226, 1992, pages 889 - 896 |
| HAY ET AL., HUM ANTIBOD HYBRIDOMAS, vol. 3, 1992, pages 81 - 85 |
| HEIDI LEDFORD: "Drug that boosts nerve signals offers hope for multiple sclerosis", NATURE, vol. 520, 22 April 2015 (2015-04-22), pages 417, XP055259946 * |
| HELENE, ANN. N.Y. ACAD. SCI., vol. 660, 1992, pages 27 - 36 |
| HELENE, C., ANN. N.Y. ACAD. SCI., vol. 660, 1992, pages 27 - 36 |
| HELENE, C., ANTICANCER DRUG DES., vol. 6, 1991, pages 569 - 84 |
| HEMLER, J BIOL. CHEM., vol. 2, 1987, pages 11478 - 11485 |
| HOOD ET AL., TRANS. AM. OPHTHALMOL. SOC., vol. 104, 2006, pages 71 - 77 |
| HOOGENBOOM ET AL., NUC ACID RES, vol. 19, 1991, pages 4133 - 4137 |
| HOUTCHENS ET AL., NEUROLOGY, vol. 69, 2007, pages 113 - 123 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HYRUP B. ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 4, 1996, pages 5 - 23 |
| INOUE ET AL., PROC NATL ACAD SCI, vol. 104, 2007, pages 14430 - 5 |
| ISSEKUTZ ET AL., J IMMUNOL, vol. 147, 1991, pages 109 |
| JASMIN; OHARA, NEUROSCIENTISTS, vol. 8, no. 3, 2002, pages 198 - 203 |
| JI ET AL., MOL CELL NEUROSCI, vol. 33, 2006, pages 311 - 20 |
| JI ET AL., MOL CELL NEUROSCI, vol. 39, 2008, pages 258 - 67 |
| JIWON OH ET AL: "Emerging injectable therapies for multiple sclerosis", LANCET NEUROL, vol. 12, 1 October 2013 (2013-10-01), pages 1115 - 1126, XP055259935 * |
| JONES ET AL., NATURE, vol. 321, 1986, pages 552 - 525 |
| K. A. IRVINE ET AL: "Remyelination protects axons from demyelination-associated axon degeneration", BRAIN., vol. 131, no. 6, 29 January 2008 (2008-01-29), GB, pages 1464 - 1477, XP055260289, ISSN: 0006-8950, DOI: 10.1093/brain/awn080 * |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| KAPPOS ET AL., N. ENGL. J. MED., vol. 373, no. 15, 2015, pages 1418 - 28 |
| KLISTORNER A ET AL., INVEST OPHTHALMOL VIS SCI., vol. 51, no. 5, 2010, pages 2770 - 2777 |
| KOHLER, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 2197 |
| KORNEK ET AL., AM J PATHOL, vol. 157, 2000, pages 267 - 276 |
| KRIEGLER: "Gene Transfer and Expression, A Laboratory Manual", 1990, STOCKTON PRESS |
| KURTZKE, ANN. NEUROL., vol. 36, 1994, pages 573 - 79 |
| KUSENDA B ET AL., BIOMED PAP MED FAC UNIV PALACKY OLOMOUC CZECH REPUB, vol. 150, no. 2, 2006, pages 205 - 15 |
| KUTMEIER ET AL., BIOTECHNIQUES, vol. 17, 1994, pages 242 |
| LEE ET AL., INT MS JOURNAL, vol. 15, 2008, pages 12 - 18 |
| LEE ET AL., J NEUROSCI, vol. 27, 2007, pages 220 - 5 |
| LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526 |
| LIU ET AL., PNAS, vol. 84, 1987, pages 3439 - 3443 |
| LLORENS ET AL., DEV NEUROBIOL, vol. 68, 2008, pages 521 - 41 |
| LOBUGLIO ET AL., HYBRIDOMA, vol. 5, 1986, pages 5117 - 5123 |
| LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LOWY ET AL., CELL, vol. 22, 1980, pages 817 |
| LV ET AL., NEUROIMMUNOMODULAT, vol. 17, 2010, pages 270 - 8 |
| MACKAY, AM, INVEST OPHTHALMOL VIS SCI., vol. 49, no. 1, 2008, pages 438 - 41 |
| MAHER, BIOASSAYS, vol. 14, 1992, pages 807 - 15 |
| MAHER, L.J., BIOASSAYS, vol. 14, 1992, pages 807 - 15 |
| MANGIONE CM ET AL., ARCH OPHTHALMOL., vol. 116, no. 11, 1988, pages 1496 - 1504 |
| MANGIONE CM ET AL., ARCH OPHTHALMOL., vol. 116, no. 11, 1998, pages 1496 - 1504 |
| MANGIONE ET AL., ARCH. OPTHALMOL., vol. 116, no. 11, 1998, pages 1496 - 1504 |
| MCDONALD ET AL., ANN. NEUROL., vol. 36, 1994, pages 14 |
| MCDONALD ET AL.: "Recommended diagnostic criteria for Multiple sclerosis: guidelines from the International Panel on the Diagnosis of Multiple Sclerosis", ANN NEUROL, vol. 50, 2001, pages 121 - 127, XP009053064, DOI: doi:10.1002/ana.1032 |
| MI ET AL., ANN NEUROLOGY, vol. 65, 2009, pages 304 - 15 |
| MI ET AL., CNS DRUGS, vol. 27, no. 7, 2013, pages 493 - 503 |
| MI ET AL., INT JOURNAL BIOCHEM CELL BIOL, vol. 40, no. 10, 2008, pages 1971 - 8 |
| MI ET AL., NAT MED, vol. 13, 2007, pages 1228 - 33 |
| MI ET AL., NAT NEUROSCI, vol. 7, 2004, pages 221 - 8 |
| MI ET AL., NAT NEUROSCI, vol. 8, 2005, pages 745 - 51 |
| MI ET AL., NATURE NEUROSCI., vol. 7, 2004, pages 221 - 228 |
| MI SHA ET AL: "Blocking LINGO-1 as a therapy to promote CNS repair: from concept to the clinic.", CNS DRUGS JUL 2013, vol. 27, no. 7, July 2013 (2013-07-01), pages 493 - 503, XP009189205, ISSN: 1172-7047 * |
| MI SHA ET AL: "LINGO-1 antagonist promotes spinal cord remyelination and axonal integrity in MOG-induced experimental autoimmune encephalomyelitis", NATURE MEDICINE, NATURE PUBLISHING GROUP, NEW YORK, NY, US, vol. 13, no. 10, 30 September 2007 (2007-09-30), pages 1228 - 1233, XP002525677, ISSN: 1078-8956, [retrieved on 20070930], DOI: 10.1038/NM1664 * |
| MI, S. ET AL., CNS DRUGS, vol. 27, no. 7, 2013, pages 493 - 503 |
| MORGAN; ANDERSON, ANN. REV. BIOCHEM., vol. 62, 1993, pages 191 - 217 |
| MORRISON, S. L., SCIENCE, vol. 229, 1985, pages 1202 - 1207 |
| MORRISON, S.L. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1994, pages 6851 - 6855 |
| MULLIGAN, SCIENCE, vol. 260, 1993, pages 926 - 932 |
| MULLIGAN; BERG, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 2072 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NICHOLAS ET AL., DRUG DESIGN, DEVELOPMENT, AND THERAPY, vol. 5, 2011, pages 255 - 274 |
| NISHIMURA ET AL., CANC. RES., vol. 47, 1987, pages 999 - 1005 |
| O'HARE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 1527 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| OKAFUJI ET AL., GENE EXPR PATTERNS, vol. 6, 2005, pages 57 - 62 |
| PARK ET AL., NEUROSCI LETT, vol. 404, 2006, pages 61 - 6 |
| PARMENTER ET AL., J INT NEUROPSYCHOL SOC, vol. 16, 2010, pages 6 - 16 |
| PATY ET AL., NEUROLOGY, vol. 43, 1993, pages 665 |
| PEPINSKY, RB ET AL., J. PHARMACOL. EXP. THER., vol. 297, no. 3, 2001, pages 1059 - 66 |
| PETERSON ET AL., J NEUROPATHOL EXP NEUROL, vol. 61, 2002, pages 539 - 546 |
| POLMAN ET AL., ANNALS OF NEUROLOGY, 2011 |
| POLMAN, C.H. ET AL., ANN. NEUROL., vol. 69, no. 2, 2011, pages 292 - 302 |
| POLMAN, CH ET AL.: "Diagnostic criteria for multiple sclerosis: 2005 revisions to the ''McDonald Criteria''", ANNALS OF NEUROLOGY, vol. 58, no. 6, December 2005 (2005-12-01), pages 840 - 6 |
| POSER ET AL., ANN. NEUROL., vol. 13, 1983, pages 227 |
| PROUDFOOT, NATURE, vol. 322, 1986, pages 52 |
| PULIDO ET AL., J BIOL. CHEM., vol. 266, 1991, pages 10241 - 10245 |
| R. B. PEPINSKY ET AL: "Exposure Levels of Anti-LINGO-1 Li81 Antibody in the Central Nervous System and Dose-Efficacy Relationships in Rat Spinal Cord Remyelination Models after Systemic Administration", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 339, no. 2, 1 August 2011 (2011-08-01), pages 519 - 529, XP055260072, DOI: 10.1124/jpet.111.183483 * |
| R. B. PEPINSKY ET AL: "Structure of the LINGO-1-Anti-LINGO-1 Li81 Antibody Complex Provides Insights into the Biology of LINGO-1 and the Mechanism of Action of the Antibody Therapy", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 350, no. 1, 22 April 2014 (2014-04-22), pages 110 - 123, XP055259941, DOI: 10.1124/jpet.113.211771 * |
| RAO ET AL., NEUROLOGY, vol. 41, 1991, pages 685 - 691 |
| RAO ET AL., NEUROLOGY, vol. 41, 1991, pages 692 - 696 |
| RAO ET AL.: "A Manual for the Brief, Repeatable Battery of Neuropsychological Tests in Multiple Sclerosis", 1991, NATIONAL MULTIPLE SCLEROSIS SOCIETY |
| RAO ET AL.: "Neuropsychological Screening Battery for Multiple Sclerosis", 1991, NATIONAL MULTIPLE SCLEROSIS SOCIETY |
| RAPHAEL BA ET AL., AM J OPHTHALMOL., vol. 142, no. 6, 2006, pages 1026 - 1035 |
| RAPHAEL ET AL., AM. J. OPHTHALMOL., vol. 142, no. 6, 2006, pages 1026 - 35 |
| REITER, Y., CANCER RES, vol. 2, 1996, pages 245 - 52 |
| RIDGWAY, A. A. G.: "Vectors", 1988, BUTTERWORTHS, article "Mammalian Expression Vectors", pages: 470 - 472 |
| SALEH ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 32, 1990, pages 180 - 190 |
| SANCHEZ-MADRID ET AL., EUR. J. IMMUNOL, vol. 16, 1986, pages 1343 - 1349 |
| SANTERRE ET AL., GENE, vol. 30, 1984, pages 147 |
| SHA MI ET AL: "Promotion of central nervous system remyelination by induced differentiation of oligodendrocyte precursor cells", ANNALS OF NEUROLOGY, vol. 65, no. 3, 1 March 2009 (2009-03-01), pages 304 - 315, XP055098017, ISSN: 0364-5134, DOI: 10.1002/ana.21581 * |
| SHAO ET AL., NEURON, vol. 45, 2005, pages 353 - 9 |
| SHAW ET AL., J. NATL CANCER INST., vol. 80, 1988, pages 1553 - 1559 |
| SIGER-ZAJDEL M. ET AL., J NEUROL NEUROSURG PSYCHIATRY, vol. 71, 2001, pages 752 - 756 |
| SIOLAS ET AL., NAT. BIOTECHNOL., vol. 23, no. 2, 2005, pages 227 - 31 |
| SIPE ET AL., NEUROLOGY, vol. 34, 1984, pages 1368 |
| STRELTSOV, PROTEIN SCI., vol. 14, 2005, pages 2901 - 2909 |
| STROBER ET AL., MULTIPLE SCLEROSIS, vol. 15, 2009, pages 1077 - 1084 |
| SUN ET AL., PNAS, vol. 84, 1987, pages 214 - 218 |
| SUNER IJ ET AL., INVEST OPHTHALMOL VIS SCI., vol. 50, no. 8, 2009, pages 3629 - 3635 |
| SZYBALSKA; SZYBALSKI, PROC. NATL. ACAD. SCI. USA, vol. 48, 1992, pages 202 |
| TEKOK-KILIC ET AL., NEUROIMAGE, vol. 36, 2007, pages 1294 - 1300 |
| TIB TECH, vol. 11, no. 5, May 1993 (1993-05-01), pages 155 - 215 |
| TOLSTOSHEV, ANN. REV. PHARMACOL. TOXICOL., vol. 32, 1993, pages 573 - 596 |
| TOULME, NATURE BIOTECH., vol. 19, 2001, pages 17 |
| TRAN ET AL., NEUROL. NEUROIMMUNOL. NEUROINFLAMM., vol. 1.2, 2014, pages E18 |
| TRAPP ET AL., N ENGL J MED, vol. 338, 1998, pages 278 - 285 |
| TRAPP ET AL., N ENGL JMED, vol. 338, 1998, pages 278 - 285 |
| TUAILLON ET AL., PNAS, vol. 90, 1993, pages 3720 - 3724 |
| VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VICK ET AL., J. NEUROTRAUMA, vol. 9, 1992, pages 93 - 103 |
| VOLLMER, EMS NEWS, 28 May 2009 (2009-05-28) |
| WECHSLER ET AL.: "Manual for the Wechsler Intelligence Scale for Children-Revised", 1974, PSYCHOLOGICAL CORPORATION |
| WECHSLER ET AL.: "WAIS-R Manua", 1981, PSYCHOLOGICAL CORPORATION |
| WECHSLER ET AL.: "Wechsler Memory Scale-Revised Manual", 1987, PSYCHOLOGICAL CORPORATION |
| WIGLER ET AL., CELL, vol. 11, 1977, pages 223 |
| WIGLER ET AL., NATL. ACAD. SCI. USA, vol. 77, 1980, pages 357 |
| WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449 |
| WOOLF ET AL., PROC NATL ACAD SCI USA, 1992 |
| WU, BUTZKUEVEN ET AL., NEUROIMAGE, vol. 37, 2007, pages 13138 - 1147 |
| WU; WU, BIOTHERAPY, vol. 3, 1991, pages 87 - 95 |
| YAMASHITA ET AL., MOL NEUROBIOL, vol. 32, 2005, pages 105 - 11 |
| YANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 9942 - 9947 |
| ZHAO ET AL., CELL MOL NEUROBIOL, vol. 28, 2008, pages 727 - 35 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9745375B2 (en) | 2008-07-09 | 2017-08-29 | Biogen Ma Inc. | Compositions comprising antibodies to LINGO or fragments thereof |
| US9796780B2 (en) | 2012-05-14 | 2017-10-24 | Biogen Ma Inc. | LINGO-2 antagonists for treatment of conditions involving motor neurons |
| US10435467B2 (en) | 2015-01-08 | 2019-10-08 | Biogen Ma Inc. | LINGO-1 antagonists and uses for treatment of demyelinating disorders |
| WO2018013714A1 (en) * | 2016-07-13 | 2018-01-18 | Biogen Ma Inc. | Dosage regimens of lingo-1 antagonists and uses for treatment of demyelinating disorders |
| US12097292B2 (en) | 2016-08-28 | 2024-09-24 | Mapi Pharma Ltd. | Process for preparing microparticles containing glatiramer acetate |
| US12370233B2 (en) | 2016-08-31 | 2025-07-29 | Mapi Pharma Ltd. | Depot systems comprising glatiramer acetate |
| US11167003B2 (en) | 2017-03-26 | 2021-11-09 | Mapi Pharma Ltd. | Methods for suppressing or alleviating primary or secondary progressive multiple sclerosis (PPMS or SPMS) using sustained release glatiramer depot systems |
| US12343371B2 (en) | 2017-03-26 | 2025-07-01 | Mapi Pharma Ltd. | Method for suppressing or alleviating primary or secondary progressive multiple sclerosis (PPMS or SPMS) using a sustained release depot formulation comprising glatiramer acetate |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210277111A1 (en) | 2021-09-09 |
| IL281089A (en) | 2021-04-29 |
| EP3242893A1 (en) | 2017-11-15 |
| CA2973266A1 (en) | 2016-07-14 |
| US20200216533A1 (en) | 2020-07-09 |
| US20180148505A1 (en) | 2018-05-31 |
| HK1246810A1 (zh) | 2018-09-14 |
| AU2016205197B2 (en) | 2021-10-21 |
| MX2017009038A (es) | 2017-10-25 |
| AU2016205197A1 (en) | 2017-07-27 |
| JP2021008522A (ja) | 2021-01-28 |
| US10435467B2 (en) | 2019-10-08 |
| JP2018504400A (ja) | 2018-02-15 |
| IL253271A0 (en) | 2017-08-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20210260185A1 (en) | Combination Therapies and Uses for Treatment of Demyelinating Disorders | |
| US20210277111A1 (en) | Lingo-1 antagonists and uses for treatment of demyelinating disorders | |
| US20210403556A1 (en) | Dosage Regimens of Lingo-1 Antagonists and Uses for Treatment of Demyelinating Disorders | |
| JP7051150B2 (ja) | 気分障害の治療及び診断のための抗-配列類似性19を持つファミリー、メンバーa5抗体の用途 | |
| TW200934791A (en) | Improved Nogo-A binding molecules and pharmaceutical use thereof | |
| HK40040606A (en) | Combination therapies and uses for treatment of demyelinating disorders | |
| KR20250148576A (ko) | 알파-시누클레인병증을 치료하기 위한 조성물 및 방법 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16703864 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 253271 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2973266 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15541944 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2017536321 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/009038 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016205197 Country of ref document: AU Date of ref document: 20160108 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016703864 Country of ref document: EP |