WO2016018133A1 - 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 - Google Patents
보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 Download PDFInfo
- Publication number
- WO2016018133A1 WO2016018133A1 PCT/KR2015/008094 KR2015008094W WO2016018133A1 WO 2016018133 A1 WO2016018133 A1 WO 2016018133A1 KR 2015008094 W KR2015008094 W KR 2015008094W WO 2016018133 A1 WO2016018133 A1 WO 2016018133A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- protein
- complement protein
- binding
- present
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*1=CCCC1 Chemical compound C*1=CCCC1 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/34—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Corynebacterium (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
Definitions
- the present invention relates to a novel polypeptide capable of binding to complement protein C5a, and more specifically, to a polypeptide capable of binding to complement protein C5a and inhibiting its activity, a polynucleotide encoding the polypeptide, the poly
- the present invention relates to a recombinant vector comprising a nucleotide, a recombinant microorganism into which the recombinant vector is introduced, a method for producing the polypeptide using the recombinant microorganism, and a pharmaceutical composition for treating immunological diseases or sepsis containing the polypeptide.
- proteins play a wide range of biological roles as macromolecules that perform the maintenance and function of life phenomena. To play this role, protein-protein interactions must first occur, which is the basis of all life phenomena. If protein interactions are not properly regulated, homeostasis in the body is broken, resulting in various diseases. Therefore, various methods for treating diseases by artificially regulating protein interactions have been researched and developed, and various medicines that can be used for therapeutic purposes have been successfully developed.
- Antibodies are important proteins in immune responses that perform biological functions through specific interactions with antigens. This specific binding force enables high therapeutic effects without side effects, unlike conventional low molecular weight chemicals. Therefore, many research institutes and pharmaceutical companies are actively working to develop antibodies that bind to well-known therapeutic targets using various screening techniques. Antibody therapies have been invested in development by global pharmaceutical companies and biotechnology companies because of their low side effects and high therapeutic efficacy compared to chemicals, and many antibody therapeutics are currently being used in clinical trials. In addition, it is widely used in various fields, such as separation and purification of biological material and molecular medical diagnostic technology, not just for therapeutic purposes.
- the lipid body refers to a polypeptide that is fused based on the similarity of the structure of the Variable Lymphocyte Receptor (VLR) with the N-terminus of an internalin having a Leucine-rich repeat (LRR) structure and optimized for a concession design.
- VLR Variable Lymphocyte Receptor
- LRR Leucine-rich repeat
- the lipid body is one-fifth the size of an antibody, is mass produced in Escherichia coli, and shows little immunogenicity in animal experiments.
- the thermal and pH stability is very good, the binding force to the target can be very easily increased to the pico-mole level, the specificity of the target is very excellent.
- complement protein C5a is known as a disease-causing factor related to immune diseases such as asthma, rheumatoid arthritis and lupus.
- various bacteria invade the blood and produce poisoning by toxic substances produced by the toxic substance, which is a major target for the treatment of sepsis, a disease causing systemic infection.
- Sepsis is known worldwide as a leading cause of morbidity and mortality in the ICU. In the United States, 750,000 sepsis patients occur each year. The mortality rate is also very high at around 40%, but as the FDA-approved therapies withdrew from the market in 2011, there are still very few effective treatments or treatments. Therefore, the development of therapeutic agents targeting complement protein C5a as a treatment for sepsis has been actively conducted.
- the inventors have successfully prepared specific protein binders for various disease-related target proteins using the lipid body scaffold, and verified that there is a biological inhibitory effect by a cell-based method. Applied research is still in its infancy, and further research is being actively conducted.
- the present inventors have made efforts to develop a protein that specifically binds to the complement protein C5a, which is known to be deeply related to various immune diseases, using the above-described lipid body skeleton. Based on the random mutant library constructed through the selection of a novel polypeptide having a specific binding force to the complement protein C5a, and confirmed that the binding force of the polypeptide and complement protein C5a is higher than the complement protein C5a receptor present in nature This invention was completed.
- Another object of the present invention is to provide a polynucleotide encoding the polypeptide, a recombinant vector comprising the polynucleotide, and a recombinant microorganism into which the recombinant vector is introduced.
- Still another object of the present invention is to provide a method for producing the polypeptide using the recombinant microorganism.
- Another object of the present invention to provide a pharmaceutical composition for the treatment of immune diseases or sepsis containing the polypeptide as an active ingredient.
- the present invention provides a polypeptide that specifically binds to the complement protein C5a, in which the N-terminus of the internalin B protein, the modified repeat module of the VLR protein, and the C-terminus of the VLR protein are fused. do.
- the present invention also provides a polynucleotide encoding the polypeptide, a recombinant vector comprising the polynucleotide, and a recombinant microorganism into which the recombinant vector is introduced.
- the present invention also comprises the steps of (a) culturing the recombinant microorganism to obtain a culture; And (b) recovering the polypeptide from the cultured recombinant microorganism or culture, thereby providing a method for producing a polypeptide that specifically binds to complement protein C5a.
- the present invention also provides a pharmaceutical composition for treating immune diseases or sepsis containing the polypeptide as an active ingredient.
- FIG. 2 is a result of measuring dissociation constants using an isothermal titration calorimetry (ITC) for G7, the clone showing the highest binding force among the clones obtained in FIG. 1, and having a low 2.8 M for complement protein C5a. It is confirmed that it has a binding force.
- ITC isothermal titration calorimetry
- FIG. 3 shows a sequence from which the C-terminal loop determined to interfere with the binding of the lipid body and complement protein C5a in the clone selected from FIG. 2, G7.
- Figure 4 shows the amino acid residues present in the LRRV5 module and LRRVe module in which a second library was constructed based on G7, a clone primarily selected for increasing binding capacity.
- FIG. 5 shows the results of biopanning the phage display using the second library.
- Normalization of the binding signal by enzyme-linked immunosorbent assay (ELISA) to complement protein C5a compared to BSA was defined as a lipid body clone with increased binding capacity for clones with an increased signal of 5 or more times.
- ELISA enzyme-linked immunosorbent assay
- FIG. 7 shows amino acid residues present in the LRRV3 module where a third library was constructed based on F5, a clone that was secondary screened to increase binding capacity.
- FIG. 8 shows the results of biopanning the phage display using a third library. Normalization of the binding signal by enzyme-linked immunosorbent assay (ELISA) to complement protein C5a compared to BSA was defined as a cloned clone with increased binding capacity for clones with an increased signal of 30-fold or more.
- ELISA enzyme-linked immunosorbent assay
- FIG. 9 shows the results of measuring the dissociation constants of the clones obtained in FIG. 8 by using an isothermal calorimeter for the clones having increased binding force than F5.
- Clone E8 has the highest binding force of about 1.9 nM to complement protein C5a, which is about 29 times greater than the F5 clone before binding.
- FIG. 10 shows amino acid residues present in the LRR1 and LRRV1 modules in which the final library was constructed based on E8, a clone that was triselected to increase binding capacity.
- FIG. 11 shows the results of biopanning the phage display using the final library. Normalization of the binding signal by enzyme-linked immunosorbent assay (ELISA) against complement protein C5a compared to BSA was defined as a lipid body clone with increased binding capacity for clones with an increased signal of 15-fold or more.
- ELISA enzyme-linked immunosorbent assay
- FIG. 12 is a displacement isothermal titration calorimetry using a clone in which the C-terminal loop is inserted into clone F5 for D5, which is a clone with increased binding force than E8 among the clones obtained in FIG. It shows the result of measuring the dissociation constant.
- Figure 13 shows the result of measuring the binding force and the complement protein C5a after inserting the C-terminal loop in F5, the clone showing the highest binding force among the clones obtained in FIG.
- a polypeptide having high binding specificity and capable of mass production was identified.
- a new polypeptide having a high binding capacity to the complement protein C5a was identified by performing a method of increasing the binding capacity of the Lipibody to the complement protein C5a using the module-based method. .
- the present invention relates to a polypeptide that specifically binds to C5a of the complement protein, in which the N-terminus of the internalin B protein, the modified repeat module of the VLR protein, and the C-terminus of the VLR protein are fused in one aspect. .
- a polypeptide comprising an amino acid sequence of any one of SEQ ID NOs: 1 to 8 and capable of effectively binding to complement protein C5a was selected.
- complement component C5a (complement component C5a) of the present invention is a small protein fragment of about 9 kDa that is formed by complement protein C5 being cut during complement activation.
- Complement protein C5a releases histamine by destroying mast cells and basophils to increase vascular permeability, and is involved in various inflammatory reactions such as leukocytes to promote phagocytosis.
- excessive and present C5a in the body causes an excessive immune response, causing an abnormal inflammatory response, which is found in various diseases such as asthma, rheumatoid arthritis, lupus, sepsis and the like.
- LRR Leucine of Variable Lymphocyte Receptor (VLR) -terminus of Internalin B protein -rich repeat
- a library was constructed containing randomly repeat modules of the polypeptide, to which the protein portions were fused.
- the polypeptide contained in the library is encoded by the polynucleotide sequence of SEQ ID NO: 1 described in the prior patent (KR2012-0019927) of the present inventors or 75%, preferably 85%, more preferably Can be encoded by a polynucleotide sequence having 90%, more preferably 95% or more homology.
- the library may be in the form of a phagemid containing the polynucleotide.
- phagemid refers to a circular polynucleotide molecule derived from phage, which is an E. coli-host virus, and includes sequences of proteins and surface proteins necessary for propagation and propagation. Recombinant phagemids can be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes or the like generally known in the art.
- the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, an enhancer, and mainly fused a desired protein with the surface protein of the phage to label the phage surface.
- the promoter of phagemid is mainly inducible and may comprise a selectable marker for selecting host cells.
- the phagemid comprises MalEss, DsbAss or PelBss, which is a signal sequence or leader sequence for expressing and secreting the polynucleotides encoding the polypeptides constituting the library, the recombinant protein on the surface of the phage.
- the polynucleotide of SEQ ID NO: 2 of the prior patent comprising a histidine-tag for confirming expression and a polynucleotide encoding a gp3 domain, which is a kind of surface protein of M13 phage for expression on the phage surface It may be, but is not particularly limited thereto.
- a novel polypeptide SEQ ID NO: 1 of the lipid body form having excellent binding to the complement protein C5a (Fig. 1).
- these selected polypeptides have a lower level of binding to complement protein C5a than the complement component 5a recpetor in nature (FIG. 2), thereby mutating the selected polypeptide to complement protein.
- FOG. 2 complement component 5a recpetor in nature
- a second library was constructed by mutating four amino acid residues located in the LRRV5 module and three amino acid residues located in the LRRVe module with respect to the selected SEQ ID NO: 1 (FIG. 4), and a phage display method using the second library.
- the new polypeptide (SEQ ID NO: 2) with enhanced binding to complement protein C5a was used for secondary selection.
- the LRRV4 module was mutated in the same manner to construct a third library (FIG.
- a novel polypeptide (SEQ ID NOS: 3-6) in the form of a repeating body with further increased binding to C5a was selected.
- the binding force to complement protein C5a was measured using isothermal titration calorimetry (FIG. 9), wherein the polypeptide of SEQ ID NO: 6 had a binding force of 1.9 nM to complement protein C5a.
- the highest clone was identified.
- polypeptides that bind to selected complement protein C5a are expected to have low biological potency because they have a lower binding capacity than complement protein C5a receptors present in nature.
- the present inventors mutated a total of four amino acid residues present in the LRR1 and LRRV1 modules based on SEQ ID NO: 6 in order to further improve the binding ability with complement protein C5a and at the same time obtain a lipid body having biological efficacy.
- the library was built.
- the phage display method using the fourth library was finally used to select a novel polypeptide (SEQ ID NO: 7) in the form of a repeat body, which further increased the binding capacity to complement protein C5a to about 78 pM.
- internal B protein refers to a type of LRR family protein expressed in Listeria strains, which is different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule.
- N-terminal structure is known to be stably expressed in microorganisms.
- the N-terminus of these internalin proteins is the microorganism from which the N-terminus site, which is most important for folding the repeat module, contains a more stable structure, including its alpha helix, so that the LRR family of proteins It can be effectively used for stable expression.
- N-terminus of an internalin protein refers to the N-terminus of an internalin protein necessary for water soluble expression and folding of the protein, and refers to an alpha helical capping motif and repeat module of an internalin protein. it means.
- the N-terminus of the internalin protein includes without limitation the N-terminus of the internalin protein necessary for the water soluble expression and folding of the protein, but may include, for example, the alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" and a repeat module.
- the repeating module pattern may include "LxxLxxLxLxxN".
- L in the repeating module pattern is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine, x means hydrophilic amino acid.
- the N-terminus of the internalin protein can be selected as the N-terminus having high structural similarity according to the type of LRR family protein that can be fused, and the most stable amino acid can be selected through calculation of binding energy and the like. Variation is possible.
- VLR variable lymphocyte receptor
- LRR protein of the present invention means a protein composed of a combination of modules in which leucine is repeated at a predetermined position, and (i) has one or more LRR repeating modules, and (ii) the LRR The repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN" in a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan Hydrophobic amino acids, such as N, asparagine, glutamine, serine, cysteine or threonine, x means any, (iv) LRR family protein means a protein having a structure having a three-dimensional structure, such as horseshoe do.
- the LRR family proteins of the present invention are not only known in the sequence, or newly discovered using a newly derived mRNA or cDNA in vivo, but also have a sequence not known in nature through the design of a consensus design. It may include all variants with skeletal structure of the module.
- lipibody refers to a polypeptide which is fused based on the similarity of the structure of the VLR with the N-terminus of the internalin having an LRR structure and optimized for consensus design.
- Lipibody proteins can be divided into concave regions (Concave) and convex regions (Convex) structurally (Fig. 4). The concave regions are known for their high degree of sequence diversity and important sites for protein interaction. Convex regions, on the other hand, play a role in keeping the overall structure of the protein stable based on highly conserved sequences.
- Lipibody proteins may include all fusion LRR family proteins that have enhanced the water-soluble expression and protein biophysical properties of all proteins belonging to the LRR family having repeat modules in this manner.
- the present invention relates to a polynucleotide encoding the polypeptide, a recombinant vector comprising the polynucleotide, and a recombinant microorganism into which the recombinant vector is introduced.
- the polynucleotide provided in the present invention is not particularly limited thereto, but may be a polynucleotide encoding any one of the amino acid sequences of SEQ ID NOs: 1 to 8, 70% or more of the polynucleotide, and more preferably 80 It may be a polynucleotide having a nucleotide sequence having at least%, more preferably at least 90% homology, but is not particularly limited thereto.
- the term "vector” refers to a DNA preparation containing a nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence so that the target protein can be expressed in a suitable host.
- the regulatory sequence includes a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosomal binding site, and a sequence regulating termination of transcription and translation.
- the vector used in the present invention is not particularly limited as long as it can be replicated in the host, and any vector known in the art may be used.
- Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
- pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, Charon21A, etc. can be used as a phage vector or cosmid vector, and pBR-based, pUC-based, pBluescriptII-based, etc.
- pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
- the vector usable in the present invention is not particularly limited and known expression vectors can be used.
- pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vector and the like can be used.
- pET-21a and pET-32a vectors can be used.
- the term "recombinant microorganism” refers to a cell in which a vector having a gene encoding at least one target protein is transfected into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells.
- bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; Yeast cells; Fungal cells such as Pchia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, bow melanoma cells; Or plant cells.
- the host cell usable in the present invention is not particularly limited, but E. coli can be preferably used as the host cell. Most preferably, E. coli BL21 (DE3), OrigamiB (DE3) can be used as a host cell.
- the term "recombinant” means introducing a vector containing a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
- Recombinant polynucleotides include all of them, as long as they can be expressed in the host cell, regardless of whether they are inserted into or located outside the chromosome of the host cell.
- the polynucleotide also includes DNA and RNA encoding the target protein.
- the polynucleotide may be introduced in any form as long as it can be expressed by being introduced into a host cell.
- the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct containing all elements necessary for self-expression.
- the expression cassette typically includes a promoter, transcription termination signal, ribosomal binding site and translation termination signal operably linked to the polynucleotide.
- the expression cassette may be in the form of an expression vector capable of self replication.
- the polynucleotide may be introduced into the host cell in its own form and operably linked with a sequence required for expression in the host cell.
- the present invention (a) culturing the recombinant microorganism to obtain a culture; And (b) recovering said polypeptide from said cultured recombinant microorganism or culture.
- the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, continuous culture method, fed-batch culture method, and the like, and the culture conditions are not particularly limited thereto.
- a basic compound e.g. sodium hydroxide, potassium hydroxide or ammonia
- an acidic compound e.g. phosphoric acid or sulfuric acid
- the appropriate pH pH 5-9, preferably pH 6-8, most preferably pH 6.8
- introducing an oxygen or oxygen-containing gas mixture into the culture to maintain aerobic conditions incubation temperature 20 to 45, preferably 25 to 40, incubated for about 10 to 160 hours This is preferable.
- the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
- the culture medium to be used is a carbon source as sugar and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), fats and oils (e.g.
- soybean oil Sunflower seed oil, peanut oil and coconut oil
- fatty acids such as palmitic acid, stearic acid and linoleic acid, alcohols such as glycerol and ethanol and organic acids such as acetic acid Can
- Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and Ammonium nitrate) and the like can be used individually or in combination
- As a source of phosphorus, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, a corresponding sodium-containing salt, and the like can be used individually or in combination
- Other metal salts such as magnesium sulfate or iron sulfate, and essential growth-promoting substances such as amino acids and vitamins.
- the method for recovering the polypeptide produced in the culturing step of the present invention is a method for recovering the desired polypeptide from the culture medium using a suitable method known in the art according to the culture method, for example, batch, continuous or fed-batch culture method, etc. Can be collected.
- the present invention relates to a pharmaceutical composition for treating immune disease or sepsis, containing the polypeptide as an active ingredient.
- the immune disease includes asthma, rheumatism, arthritis and lupus.
- Therapeutic pharmaceutical compositions comprising the polypeptide of the present invention may further comprise suitable excipients and diluents commonly used in the manufacture of pharmaceutical compositions.
- the therapeutic pharmaceutical composition comprising the polypeptide according to the present invention respectively, oral formulations such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, external preparations, suppositories, and sterilization according to a conventional method It can be formulated and used in the form of injectable solutions.
- Carriers, excipients, and diluents that may be included in the composition comprising the polypeptide include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, maltitol, starch, glycerin, starch, acacia rubber, alginate, gelatin, calcium phosphate , Calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
- diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, surfactants, etc. which are commonly used can be prepared.
- Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and such solid preparations include at least one excipient such as starch, calcium carbonate, sucrose in the polypeptide. ) Or lactose, gelatin and the like can be mixed.
- lubricants such as magnesium styrate talc may also be used.
- Liquid preparations for oral administration include suspensions, solvents, emulsions, and syrups.In addition to commonly used simple diluents such as water and liquid paraffin, various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included. Can be.
- Formulations for non-oral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized preparations, suppositories.
- the non-aqueous preparation and suspending agent propylene glycol, polyethylene glycol, vegetable oils such as olive oil, injectable esters such as ethyl oleate and the like can be used.
- a coloring agent what is permitted to add to a pharmaceutical product is used, for example, a cocoa powder, a peppermint brain, an aromatic acid, peppermint oil, a dragon brain, a cinnamon powder, etc. are used. These tablets do not exclude the appropriate coating of sugars, gelatin, and other necessities in the case of granules.
- a pH adjuster, a buffer, a stabilizer, a preservative, etc. are added as needed, and it is made into a subcutaneous, intramuscular, intravenous injection by a conventional method.
- the amount of the polypeptide-containing composition of the present invention may vary depending on the age, sex, and weight of the patient, but in general, an amount of 5 to 500 mg / kg, preferably 100 to 250 mg / kg, 1 to 3 times a day. It may be administered separately, the dosage may be increased or decreased depending on the route of administration, the degree of disease, sex, weight, age and the like. Therefore, the above dosage does not limit the scope of the present invention in any aspect.
- Example 1-1 Constructing a Lipibody Library Based on Protein Structure
- Lipibodies like LRR proteins in nature, have a concave region due to the curvature of the shape of the entire structure and the modularity of the repeating units having conserved leucine sequences to maintain the overall protein structure. ) And the convex region.
- Lipibody is divided into Concave, which recognizes biomolecules, and Convex, which is important for structural maintenance.
- concave regions hypervariable regions, such as complementarity determining regions (CDRs) of antibodies, are located to mediate protein-protein interactions.
- convex regions play an important role in maintaining the overall structure of the LRR based on well-conserved sequences.
- the primers were used to perform overlap polymerase chain reaction (Overlap PCR) for two modules to obtain library DNA, and inserted into the phagemid pBEL118M to obtain a final library phagemid.
- overlap PCR overlap polymerase chain reaction
- the obtained library was introduced into E. coli XL1-Blue by electroporation to obtain recombinant microorganisms, thereby constructing a library having a synthetic diversity of 1.8 ⁇ 10 8 level.
- a polypeptide that can bind to complement protein C5a was selected and purified.
- complement protein C5a was added to the immunotube (Immuno-tube) at a concentration of 100 / and coated for 4 to 12 hours.
- the coated immunotubes were washed three times with PBS and blocked with PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 for 4 to 2 hours.
- the purified phages were then added to the coated immunotubes at a concentration of 10 12 cfu / ml and allowed to react at room temperature for 2 hours.
- ELISA was performed using the 96-well plate coated with the complement protein C5a and BSA by the method of Example 1-2, so that the absorbance (OD450) of the complement protein C5a (B450) was 9 times higher than that of BSA.
- Lipibody candidates were selected (FIG. 1), their respective amino acid sequences were identified, and clones with the same amino acid sequence were excluded. As a result, a total of three kinds of lipid bodies were identified from the selected phage, and as a result of measuring the dissociation constant for complement protein C5a using isothermal calorimetry for three kinds of lipid bodies, only clone G7 was complement protein C5a. It was confirmed that the specific binding to (Fig. 2).
- G7 is substituted for isoleucine amino acid 91 is substituted with phenylalanine, threonine amino acid 93 is substituted with asparagine acid, glycine amino acid 94 is substituted with phenylalanine, amino acid valine is substituted for tyrosine 115, 117 It was confirmed that the amino acid valine was replaced with serine, and glutamic acid 118 amino acid was substituted with proline (SEQ ID NO: 1).
- Example 2 Enhancement of Avidity to Lipibody Complement Protein C5a Using a Module-Based Method
- the module-based affinity enhancement method described in the present invention was performed according to the prior patent (KR2012-0019927).
- the method is a universally available technique for proteins with repeat modules, which has been successfully reproduced in this patent to enable the design of proteins with high levels of affinity.
- Example 2-1 Verifying Additional Library Construction and Increasing Cohesion Using Modules
- the dissociation constant for complement protein C5a of G7 was 2.8 M (FIG. 2), but complement of naturally occurring complement protein C5a receptor
- the dissociation constant for protein C5a is at 1.0 nM level. Therefore, it was expected that the lipid body candidate of the present invention could not sufficiently inhibit the activity of complement protein C5a.
- the first module-based affinity library mutated a total of seven amino acid residues of the LRRV5 and LRRVe module (Fig. 4), to secure a binding F5 (SEQ ID NO: 2) through a total of four panning process
- a binding F5 SEQ ID NO: 2
- the binding protein C5a had a binding force of 56 nM (FIG. 6).
- the F5 as a base polypeptide was mutated four residues of the LRRV4 module (Fig. 7), and then through the same panning process, E8 (SEQ ID NO: 6) was selected.
- E8 SEQ ID NO: 6
- the binding protein C5a had a binding force of 1.9 nM (FIG. 9). This is about a 29-fold improvement over the F5 used as the base polypeptide.
- the present inventors have successfully obtained a lipid body having a higher binding force than the receptor of the naturally occurring complement protein C5a, and confirmed that it is a polypeptide having a specific binding force to the complement protein C5a.
- the polypeptide of the present invention can bind to and inhibit the activity of complement protein C5a with higher affinity than the complement protein C5a receptor present in nature, it can be widely used in the development of a preparation for the prevention or treatment of complement protein C5a-related diseases. There will be.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
본 발명은 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드에 관한 것으로, 보다 구체적으로, 보체 단백질 C5a와 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물, 상기 재조합 미생물을 이용한 상기 폴리펩타이드 생산방법 및 상기 폴리펩타이드를 함유하는 면역질환 또는 패혈증 치료용 의약 조성물에 관한 것이다. 본 발명의 폴리펩타이드는 자연계에 존재하는 보체 단백질 C5a 수용체보다도 높은 친화력으로 보체 단백질 C5a에 결합하여 그의 활성을 억제할 수 있으므로, 보체 단백질 C5a 관련 질환의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있을 것이다.
Description
본 발명은 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드에 관한 것으로, 보다 구체적으로, 보체 단백질 C5a와 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물, 상기 재조합 미생물을 이용한 상기 폴리펩타이드 생산방법 및 상기 폴리펩타이드를 함유하는 면역질환 또는 패혈증 치료용 의약 조성물에 관한 것이다.
생체 내에 존재하는 다양한 물질 중에서, 단백질은 생명 현상의 유지 및 기능을 수행하는 거대 분자로서 넓은 범위의 생물학적 역할을 담당하고 있다. 이런 역할을 수행하기 위해서는 우선 단백질-단백질 간 상호작용이 이루어져야 하며, 이는 모든 생명현상의 기초라고 할 수 있다. 만약 단백질 상호작용이 제대로 조절되어지지 않게되면 체내의 항상성은 망가지게 되어 결과적으로 다양한 질병을 일으키게 된다. 따라서 단백질 상호작용을 인위적으로 조절함으로써 질병을 치료하기 위한 다양한 방법이 연구 및 개발되어 왔으며 실제로 치료 목적에 사용가능한 다양한 의약품들이 성공적으로 개발되어 왔다.
항체는 면역반응의 중요단백질로 항원과의 특이적 상호작용을 통해 생물학적 기능을 수행한다. 이런 특이적인 결합력은 기존의 저분자 화학제재와 달리 부작용 없이 높은 치료효과를 가능하게 한다. 따라서, 많은 연구기관과 제약회사들은 다양한 선별기술을 활용하여 잘 알려진 치료제 표적에 대해 결합력을 갖는 항체들을 개발하기 위한 연구를 활발히 진행하고 있다. 항체 치료제는 화학제재에 비해 낮은 부작용과 높은 치료 효능 때문에 글로벌 제약기업과 생명공학 기업들이 개발에 집중 투자를 하여 현재 다수의 항체 치료제가 임상에 사용되고 있으며 많은 치료제 후보가 임상실험 중에 있다. 또한, 치료용 목적만이 아닌 생체물질의 분리정제 및 분자 의학적 진단기술 등 다양한 분야에서 폭 넓게 이용되고 있다. 하지만, 이런 장점에도 불구하고, 생산 비용이 비싸고 기존 특허 장벽을 벗어나기 힘들며 분자량이 커서 세포내 침투가 어렵고 기대만큼 실제 환자의 치료 효과가 높지 않은 문제점이 있기 때문에, 최근에는 항체 치료제를 대체하기 위한 인공항체의 개발이 활발하게 진행되고 있다. 이러한 인공항체 골격 단백질은 항체 치료제와 달리 암 조직 내로 침투되는 효율에 크게 향상되어 결과적으로 치료 효과를 향상 시킬 수 있다는 장점이 많은 연구를 통해 밝혀지고 있다.
이러한 배경 하에, 본 발명자들은 기존의 항체를 대체할 수 있는 비 항체 단백질 골격(non-antibody protein scaffold)인 리피바디(repebody)를 성공적으로 개발하였다. 상기 리피바디는 LRR(Leucine-rich repeat) 구조를 갖는 인터날린의 N-말단과 상기 VLR(Variable Lymphocyte Receptor)의 구조의 유사성을 바탕으로 융합하여 컨세서스 디자인으로 최적화시킨 폴리펩타이드를 의미한다. 상기 리피바디는 크기가 항체의 1/5 수준이고, 대장균에서 대량생산 되며, 동물 실험결과 면역원성이 거의 없다. 또한, 열 및 pH 안정성이 매우 우수하고 타겟에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며, 타겟에 대한 특이성이 매우 탁월함을 하다.
한편, 보체 단백질 C5a는 천식, 류마티스 관절염, 루프스와 같은 면역 질환에 관련된 질환유발인자로 알려져 있다. 특히, 혈액 중에 다양한 세균이 침범하여 번식하면서 생산된 독성물질에 의해 중독 증세를 나타내거나 전신에 감염증을 일으키는 질병인 패혈증 치료에 주요 표적으로 각광받고 있다. 패혈증은 전 세계적으로 중환자실 이환율 및 사망률의 주요한 원인으로 알려져 있고 미국의 경우 해마다 750,000명의 패혈증 환자가 발생하며 국내에서도 정확한 통계는 없지만 매우 높은 발병률을 나타내고 있다. 치사율 또한 40% 정도로 매우 높은 편이나, 2001년 FDA 승인을 받은 치료제가 2011년 시장에서 퇴출되면서 아직까지 효과적인 치료법이나 치료 물질은 매우 부족한 실정이다. 따라서 패혈증의 치료제로써 보체 단백질 C5a를 표적으로 하는 치료제 개발 연구가 활발하게 진행되고 있다.
본 발명자들은 상기 리피바디 골격을 이용하여 다양한 질환 관련 표적 단백질들에 대한 특이적인 결합 단백질(Specific protein binder)을 성공적으로 제조하고, 세포 기반의 방법으로 생물학적인 저해효과가 있음을 검증하였으나, 이에 대한 응용연구는 아직 시작 단계에 불과하여, 추가적인 연구를 활발히 진행하고 있다.
이에, 본 발명자들은 상기 리피바디 골격을 이용하여 다양한 면역 질환과 관련이 깊은 것으로 알려진 보체 단백질 C5a에 특이적으로 결합하는 단백질을 개발하고자 예의 노력한 결과, 리피바디의 구조적 특징인 모듈성과 전체구조분석을 통해 구축한 무작위한 돌연변이 라이브러리를 바탕으로 보체 단백질 C5a에 대해 특이적인 결합력을 갖는 신규한 폴리펩타이드를 선별하고, 상기 폴리펩타이드와 보체 단백질 C5a의 결합력이 자연계에 존재하는 보체 단백질 C5a 수용체 보다 높은 것을 확인하고, 본 발명을 완성하게 되었다.
발명의 요약
본 발명의 목적은 보체 단백질 C5a와 특이적으로 강하게 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드를 제공하는 데 있다.
본 발명의 다른 목적은 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터 및 상기 재조합 벡터가 도입된 재조합 미생물을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 재조합 미생물을 이용하여 상기 폴리펩타이드를 생산하는 방법을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 폴리펩타이드를 유효성분으로 함유하는 면역질환 또는 패혈증 치료용 의약 조성물을 제공하는데 있다.
상기 목적을 달성하기 위하여, 본 발명은 인터날린 B 단백질의 N-말단, VLR 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합된, 보체 단백질 C5a에 특이적으로 결합하는 폴리펩타이드를 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터 및 상기 재조합 벡터가 도입된 재조합 미생물을 제공한다.
본 발명은 또한, (a) 상기 재조합 미생물을 배양하여 배양물을 수득하는 단계; 및 (b) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는, 보체 단백질 C5a에 특이적으로 결합하는 폴리펩타이드의 생산방법을 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 유효성분으로 함유하는 면역질환 또는 패혈증 치료용 의약 조성물을 제공한다.
도 1은 상기 선행특허(KR2012-0019927)에서 구축된 파지 라이브러리를 이용하여, 보체 단백질 C5a에 대한 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 보체 단백질 C5a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 10배 이상의 신호가 증가한 클론에 대해 특이적인 결합력을 갖는 리피바디 클론으로 정의한다.
도 2는 상기 도 1에서 얻어진 클론 중 가장 높은 결합력을 보이는 클론인 G7에 대해 등온열량측정기 (Isothermal titration calorimetry; ITC)를 이용하여 해리상수를 측정한 결과로, 보체 단백질 C5a에 대해 2.8 M의 낮은 결합력을 가지고 있음을 확인한 것이다.
도 3은 상기 도 2에서 선별된 클론인 G7에서 리피바디와 보체 단백질 C5a의 결합을 방해할 것으로 판단되는 C-말단 루프를 제거한 서열을 나타낸 것이다.
도 4는 결합력을 증대시키기 위해 일차적으로 선별된 클론인 G7을 바탕으로 두 번째 라이브러리가 구축된 LRRV5 모듈과 LRRVe 모듈에 존재하는 아미노산 잔기를 나타낸 것이다.
도 5는 두 번째 라이브러리를 이용하여 파지 디스플레이의 바이오 패닝을 수행한 결과를 나타낸 것이다. BSA 대비 보체 단백질 C5a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 5배 이상의 신호가 증가한 클론에 대해 결합력이 증대된 리피바디 클론으로 정의한다.
도 6은 상기 도 5에서 얻어진 클론 중 가장 높은 결합력을 보이는 클론인 F5에 대해 등온열량측정기를 이용하여 해리상수를 측정한 결과로, 보체 단백질 C5a에 대해 56 nM의 결합력을 가지고 있음을 확인한 것이다. 이는 결합력 증대 전의 G7 클론에 비해 약 53배 결합력이 증대된 것이다.
도 7은 결합력을 증대시키기 위해 이차적으로 선별된 클론인 F5를 바탕으로 세 번째 라이브러리가 구축된 LRRV3 모듈에 존재하는 아미노산 잔기를 나타낸 것이다.
도 8은 세 번째 라이브러리를 이용하여 파지 디스플레이의 바이오 패닝을 수행한 결과를 나타낸 것이다. BSA 대비 보체 단백질 C5a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 30배 이상의 신호가 증가한 클론에 대해 결합력이 증대된 리피바디 클론으로 정의한다.
도 9는 상기 도 8에서 얻어진 클론 중 F5보다 결합력이 증대된 클론들에 대해 등온열량측정기를 이용하여 해리상수를 측정한 결과를 나타낸 것이다. 클론 E8이 보체 단백질 C5a에 대해 약 1.9 nM로 가장 높은 결합력을 가지며, 이는 결합력 증대 전의 F5 클론에 비해 약 29배 결합력이 증대된 것이다.
도 10은 결합력을 증대시키기 위해 삼차적으로 선별된 클론인 E8을 바탕으로 최종 라이브러리가 구축된 LRR1과 LRRV1 모듈에 존재하는 아미노산 잔기를 나타낸 것이다.
도 11은 최종 라이브러리를 이용하여 파지 디스플레이의 바이오 패닝을 수행한 결과를 나타낸 것이다. BSA 대비 보체 단백질 C5a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 15배 이상의 신호가 증가한 클론에 대해 결합력이 증대된 리피바디 클론으로 정의한다.
도 12는 상기 도 11에서 얻어진 클론 중 E8보다 결합력이 증대된 클론인 D5에 대해 클론 F5에 C-말단 루프가 삽입된 클론을 이용하여 디스플레이스먼트 등온열량측정기 (Displacement isothermal titration calorimetry)를 이용하여 해리상수를 측정한 결과를 나타낸 것이다.
도 13은 상기 도 5에서 얻어진 클론 중 가장 높은 결합력을 보이는 클론인 F5에 C-말단 루프를 삽입한 후 보체 단백질 C5a와 결합력을 측정한 결과를 나타낸 것이다.
발명의 상세한 설명 및 바람직한
구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 보체 단백질 C5a와 특이적으로 결합할 수 있는 신규 폴리펩타이드를 개발하는데 있어, 결합 특이성이 높고, 대량생산이 가능한 폴리펩타이드를 발굴하였다. 신규 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물을 이용하여 인터날린 B 단백질의 N-말단, VLR 단백질의 LRR 단백질 부분이 융합된, 폴리펩타이드의 반복모듈을 무작위적으로 포함하는 라이브러리를 구축한 후, 모듈 기반 방법을 이용한 리피바디의 보체 단백질 C5a에 대한 결합력 증대 방식 수행을 통해, 보체 단백질 C5a에 대해 높은 결합력을 가지는 신규 폴리펩타이드를 확인하였다.
따라서, 본 발명은 일 관점에서 인터날린 B 단백질의 N-말단, VLR 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합된, 보체 단백질의 C5a에 특이적으로 결합하는 폴리펩타이드에 관한 것이다.
본 발명의 일 실시예에서는 서열번호 1 내지 8 중 어느 하나의 아미노산 서열을 포함하고, 보체 단백질 C5a와 효과적으로 결합할 수 있는 폴리펩타이드를 선별하였다.
본 발명의 용어 보체 단백질 C5a (complement component C5a)는 보체 활성화 과정에서 보체 단백질 C5가 잘리면서 형성된 약 9 kDa의 작은 단백질 조각이다. 보체 단백질 C5a는 비만세포와 호염구 과립 파괴로 히스타민을 방출시켜 혈관 투과성을 증가시키며, 백혈구를 불러들여 식작용을 촉진시키는 등의 다양한 염증 반응에 관여한다. 특히 체내에 과도하고 존재하는 C5a는 면역 반응을 과도하게 일으켜 비정상적인 염증 반응을 유발하며, 이러한 현상은 천식, 류마티스 관절염, 루푸스, 패혈증 등과 같은 다양한 질환에서 발견되고 있다.
본 발명에서는, 보체 단백질 C5a와 특이적으로 결합할 수 있는 신규한 폴리펩타이드를 개발하기 위하여, 인터날린 B(Internalin B) 단백질의 -말단, 가변 림프구 수용체(Variable Lymphocyte Receptor, VLR) 의 LRR(Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩타이드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다. 상기 라이브러리에 포함된 폴리펩타이드는 본 발명자의 선행특허(KR2012-0019927)에 기술된 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 해당 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다. 또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다.
본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로 부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드르를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 상기 선행특허(KR2012-0019927)의 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명에서는, 상기 파지미드를 포함하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백질 C5a에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩타이드(서열번호 1)를 선별하였다 (도 1). 그러나, 이들 선별된 폴리펩타이드는 자연계에 존재하는 보체 단백질 C5a의 수용체(complement component 5a recpetor) 보다도 보체 단백질 C5a에 대한 결합력이 낮은 수준이어서(도 2), 상기 선별된 폴리펩타이드에 돌연변이를 가하여 보체 단백질 C5a에 대한 결합력이 향상된 변이 폴리펩타이드를 제작하고자 하였다. 이를 위하여, 우선 상기 선별된 서열번호 1 폴리펩타이드의 C-말단 부분의 루프(loop)가 리피바디와 보체 단백질 C5a의 결합을 방해할 수 있다고 판단하여 루프에 해당하는 239번 아미노산인 아르지닌부터 246번 아미노산인 알라닌까지 총 8개의 아미노산을 제거한 후 글라이신 2개를 삽입하였다(도 3). 또한 상기 선별된 서열번호 1을 대상으로 LRRV5 모듈에 위치한 아미노산 잔기 4개와 LRRVe 모듈에 위치한 아미노산 잔기 3개를 돌연변이 시킨 두 번째 라이브러리를 구축하고(도 4), 상기 두 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백질 C5a에 대한 결합력이 증대된 신규한 폴리펩타이드(서열번호 2)를 2차 선별하였다. 다음으로, 선별된 클론인 서열번호 2의 폴리펩타이드를 바탕으로 동일한 방식으로 LRRV4 모듈에 돌연변이를 수행하여 세 번째 라이브러리를 구축하고(도 7), 상기 세 번째 라이브러리로부터 파지 디스플레이 방법을 사용하여 보체 단백질 C5a에 대한 결합력이 더욱 증대된 리피바디 형태의 신규한 폴리펩타이드(서열번호 3 내지 6)를 3차 선별하였다. 선별된 각 클론에 대하여 등온열량적정기(Isothermal titration calorimetry)를 이용하여 보체 단백질 C5a에 대한 결합력을 측정하였으며(도 9), 이 중 서열번호 6의 폴리펩타이드가 보체 단백질 C5a에 대한 결합력이 1.9 nM로써 가장 높은 클론임이 확인되었다. 그러나, 선별된 보체 단백질 C5a에 결합하는 폴리펩타이드는 자연계에 존재하는 보체 단백질 C5a 수용체보다 낮은 결합력을 가지기 때문에 생물학적 효능이 낮을 것으로 예상된다. 이에, 본 발명자들은 보체 단백질 C5a와의 결합능이 더욱 개선됨과 동시에 생물학적 효능을 갖는 리피바디를 확보하기 위하여, 서열번호 6을 기반으로 하여 LRR1과 LRRV1 모듈에 존재하는 총 4 개의 아미노산 잔기를 돌연변이 시킨 네 번째 라이브러리를 구축하였다. 상기 네 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백질 C5a에 대한 결합력이 약 78 pM로 더욱 증대된 리피바디 형태의 신규한 폴리펩타이드(서열번호 7)를 최종적으로 선별하였다.
이후, C-말단 루프가 리피바디와 보체 단백질 C5a의 결합을 방해하는지 확인하기 위하여 서열번호 2의 폴리펩타이드에 C-말단 루프를 본래의 위치에 다시 삽입한 폴리펩타이드(서열번호 8)의 결합력을 측정하였다 (도 13). 그 결과, 약 76 nM의 결합력을 가지는 것을 확인하였으며 이는 C-말단 루프가 없는 리피바디보다 약 20 nM 정도 결합력이 감소하였음을 알 수 있다.
본 발명의 용어 "인터날린 B 단백질"이란, 리스테리아(Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 다른 유형의 N-말단 구조 때문에 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘 (Folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐 아니라 그 형태가 알파 나선을 포함하는 더욱 안정적인 구조를 포함하므로, 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명의 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프 (capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단은 제한 없이 포함되나, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" 및 반복 모듈을 포함할 수 있다. 바람직하게 반복 모듈 패턴은 "LxxLxxLxLxxN"을 포함할 수 있다. 상기 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어 "가변 림프구 수용체(VLR)"란, 먹장어와 칠성 장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성 장어에서 면역 기능을 수행하는 단백질로서 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩타이드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규한 단백질 치료제의 제조에 사용될 수 있다.
본 발명의 용어 "LRR(Leucine rich repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 쓰레오닌을, x는 임의의 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖는 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것 뿐 아니라, 컨센서스 디자인 (Consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명의 용어 "리피바디"란, LRR 구조를 갖는 상기 인터날린의 N-말단과 상기 VLR의 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리 폴리펩타이드이다. 리피바디 단백질은 구조상 오목한 지역(Concave) 와 볼록한 지역(Convex) 으로 나누어 질 수 있다(도 4). 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 모든 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터 및 상기 재조합 벡터가 도입된 재조합 미생물 제공에 관한 것이다.
본 발명에서 제공하는 상기 폴리뉴클레오티드는 특별히 이에 제한되지 않으나, 상기 서열번호 1 내지 8중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오티드가 될 수 있고, 상기 폴리뉴클레오티드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기서열을 가지는 폴리뉴클레오티드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오티드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주세포로 사용할 수 있다.
본 발명에서 용어 "재조합"이란, 표적 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 숙주세포 내에 도입하여 숙주세포 내에서 상기 폴리뉴클레오티드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 재조합된 폴리뉴클레오티드는 숙주세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오티드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오티드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 또 다른 관점에서, (a) 상기 재조합 미생물을 배양하여 배양물을 수득하는 단계; 및 (b) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 보체 단백질 C5a에 특이적으로 결합하는 폴리펩타이드의 생산방법에 관한 것이다.
본 발명에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45, 바람직하게는 25 내지 40를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지중으로 분비되거나 세포내에 잔류할 수 있다.
본 발명에서, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩타이드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 폴리펩타이드를 수집할 수 있다.
본 발명은 또 다른 관점에서, 상기 폴리펩타이드를 유효성분으로 함유하는 면역질환 또는 패혈증 치료용 의약 조성물에 관한 것이다.
본 발명에 있어서, 상기 면역질환은 천식, 류마티스, 관절염 및 루프스를 포함한다.
본 발명의 폴리펩타이드를 포함하는 치료용 의약 조성물은 약학적 조성물의 제조에 통상적으로 사용하는 적절한 부형제 및 희석제를 더 포함할 수 있다. 또한, 본 발명에 따른 폴리펩타이드를 포함하는 치료용 의약 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다.
상기 폴리펩타이드를 포함하는 조성물에 포함될 수 있는 담체, 부형제, 희석제로는 락토즈, 덱스트로스, 슈크로스, 솔비톨, 만니톨, 자일리톨, 말티톨, 전분, 글리세린, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다.
제제화할 경우에는 보통 사용되는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제할 수 있다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 폴리펩타이드에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(calciumcarbonate), 슈크로스(sucrose) 또는 락토오스 (lactose), 젤라틴 등을 섞어 조제할 수 있다. 또한 단순한 부형제 이 외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용할 수 있다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비 경구투여를 위한 제제에는 멸균된 수용액, 비수용성제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수용성제제, 현탁제로는 프로필렌글리콜 (propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(Tween) 61, 카카오지, 라우리지, 글리세로제라틴 등이 사용될 수 있다. 또한, 착색제로서는 의약품에 첨가하는 것이 허가되어 있는 것이, 교미교취제로서는 예를 들면 코코아 분말, 박하뇌, 방향산, 박하유, 용뇌, 계피 분말 등이 사용된다. 이들의 정제에는 과립제의 경우 당, 젤라틴, 기타 필요에 따라 적절하게 코팅하는 것을 배제하는 것은 아니다.
또한, 본 발명의 조성물을 주사제로 조제하는 경우에는 필요에 따라, pH 조정제, 완충제, 안정화제, 보존제 등을 첨가하고, 통상적인 방법에 의해 피하, 근육내, 정맥 주사제로 한다.
본 발명의 폴리펩타이드 함유 조성물의 사용량은 환자의 나이, 성별, 체중에 따라 달라질 수 있으나, 일반적으로 5~500mg/kg의 양, 바람직하게는 100~250mg/kg의 양을 1일 1~3회로 나누어 투여할 수 있고, 그 투여량은 투여경로, 질병의 정도, 성별, 체중, 나이 등에 따라서 증감될 수 있다. 따라서, 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다
이하 본 발명을 실시예에 의하여 더욱 상세하게 설명한다. 이들 실시예는 단지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 국한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 무작위적인 파지 라이브러리를 통한 보체 단백질 C5a와 특이적으로 결합하는 폴리펩타이드 선별
실시예 1-1: 단백질 구조 기반의 리피바디 라이브러리 구축
리피바디는 자연계에 존재하는 LRR 단백질들과 마찬가지로 보존된 류신 서열을 갖는 반복 단위체(Repeat unit)가 연속적으로 연결되어 전체 단백질 구조를 유지하는 모듈성과 전체 구조의 모양의 곡률로 인한 오목한 지역(Concave region)과 볼록한 지역(Convex region)으로 구별되는 구조적 특징을 갖는다. 또한, 리피바디는 생체 분자를 인식하는 Concave와 구조 유지에 중요한 Convex지역으로 구분된다. 오목한 지역에는 항체의 상보성결정지역(complementarity determining region, CDR)처럼 초가변영역(Hypervariable region)이 위치하여, 단백질-단백질 상호작용을 매개한다. 또한, 볼록한 지역은 잘 보존되어 있는 서열을 바탕으로 LRR의 전체구조의 유지하는데 중요한 역할을 한다. 이러한 리피바디의 단백질 구조를 분석하여 하기의 같은 방식으로 무작위적인 라이브러리를 설계하였다.
구체적으로, 설계되지 않은 카르복시말단의 고리구조(C-term loop)에 의한 입체 장해(Steric hinderance)에서 벗어나기 위해 아민기말단 방향에 위치한 연속적인 두개의 변이 모듈(LRRV module 2 와 3)의 오목한 지역에 위치하는 여섯 아미노산 잔기 91, 93, 94, 115, 117, 그리고 118번을 선택하였다. 그런 다음, 상기 선택한 아미노산을 NNK 동의코돈(Degenerate codon)으로 치환하고, 나머지 볼록한 지역의 염기서열을 잠재성 돌연변이(Silent mutation)를 포함하도록 구성하여, 라이브러리를 구축하기 위한 돌연변이 유발프라이머(Mutagenic primer)를 합성하였다.
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄반응(Overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 상기 파지미드 pBEL118M에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법(electroporation)으로 대장균 XL1-Blue에 도입하여 재조합 미생물을 수득함으로써, 1.8x108 수준의 합성적 다양성을 갖는 라이브러리를 구축하였다.
실시예 1-2: 리피바디 라이브러리의 패닝 과정을 통한 보체 단백질 C5a와 결합하는 폴리펩타이드 선별
실시예 1-1에서 구축한 라이브러리를 사용하여 보체 단백질 C5a에 결합할 수 있는 폴리펩타이드를 선별하여 정제하였다. 보체 단백질 C5a와 결합할 수 있는 후보를 선별하기 위하여, 보체 단백질 C5a를 면역튜브 (Immuno-tube)에 100 /의 농도로 가하고, 4 에서 12시간동안 코팅하였다. 상기 코팅된 면역튜브를 PBS로 3회 세척하고, 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액 (TPBSA)으로 4 에서 2시간동안 블로킹(Blocking) 하였다. 그런 다음, 상기 정제된 파지를 1012 cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 및 PBS로 2번 세척하였다. 마지막으로, 1 ml 0.2 M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 13분간 반응시킴으로써, 보체 단백질 C5a와 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 60 의 1.0 M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 10 ml 대장균 XL1-Blue 용액(OD600 = 0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝(Bio-panning) 과정을 동일하게 4회 반복하여 수행하였다. 그 결과, 각 패닝 과정을 통해 보체 단백질 C5a와 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 보체 단백질 C5a와 결합하는 라이브러리 파지가 특이적으로 증가함을 의미하는 것으로 분석되었다.
실시예 1-3: 선별된 리피바디의 보체 단백질 C5a에 대한 특이적인 결합여부 확인 및 서열 분석
실시예 1-2의 방법을 통하여 선별된 파지를 보체 단백질 C5a와 BSA가 코팅된 96-웰 플레이트를 이용하여 ELISA를 수행함으로써, BSA 대비 보체 단백질 C5a의 흡광도(OD450)가 10배 이상 높은 9개의 리피바디 후보들을 선별하고 (도 1), 이들 각각의 아미노산 서열을 확인한 후, 동일한 아미노산 서열을 갖는 클론을 제외 하였다. 그 결과, 상기 선별된 파지에서 총 3 종류의 리피바디 서열을 확인하였으며, 세 종류의 리피바디에 대하여 등온열량측정기를 이용하여 보체 단백질 C5a에 대한 해리상수를 측정한 결과, 클론 G7만이 보체 단백질 C5a에 특이적으로 결합하는 것을 확인하였다(도 2). G7은 91번 아미노산인 이소류신이 페닐알라닌으로 치환되고, 93번 아미노산인 트레오닌이 아스파라긴산으로 치환되며, 94번 아미노산인 글리신이 페닐알리닌으로 치환되고, 115번 아미노산인 발린이 타이로신으로 치환되고, 117번 아미노산인 발린이 세린으로 치환되며, 118번 아미노산인 글루탐산이 프롤린으로 치환되었음을 확인하였다(서열번호 1).
상기 결과는 보체 단백질 C5a와 결합하는데 중요한 역할을 수행하는 잔기가 존재함을 의미하는 것으로 분석되었다.
실시예 2: 모듈 기반 방법을 이용한 리피바디의 보체 단백질 C5a에 대한 결합력 증대 수행
본 발명에서 기술된 모듈 기반 친화력 증대 방식은 선행특허(KR2012-0019927)에 따라 수행하였다. 해당 방법은 반복 모듈을 갖는 단백질에 대해 보편적으로 사용할 수 있는 기술로써, 본 특허에서 성공적으로 재현되어 높은 수준의 친화력을 갖는 단백질 설계를 가능하게 하였다.
실시예 2-1: 모듈을 이용한 추가적인 라이브러리 구축 및 결합력 증가 확인
실시예 1-3의 결과에서 보체 단백질 C5a에 특이적으로 결합하는 것이 확인된 클론인 G7의 보체 단백질 C5a에 대한 해리상수는 2.8 M이지만(도 2), 자연적으로 존재하는 보체 단백질 C5a 수용체의 보체 단백질 C5a에 대한 해리상수는 1.0 nM 수준이다. 따라서, 본 발명의 리피바디 후보로는 보체 단백질 C5a의 활성을 충분히 억제할 수 없을 것으로 예상되었다.
이러한 문제점을 해결하고자, 상기 선행특허(KR2012-0019927)에서 사용한 모듈을 이용한 추가적인 라이브러리 구축방법을 이용하여 결합력이 향상된 돌연변이체를 개발하고자 하였다.
구체적으로, 첫 번째 모듈 기반 친화력 증대를 위한 라이브러리는 LRRV5와 LRRVe 모듈의 총 7개 아미노산 잔기를 돌연변이 시켜(도 4), 총 4번의 패닝과정을 거쳐서 결합력이 증대된 F5(서열번호 2)를 확보하였으며, 등온열량측정기를 이용하여 해리 상수를 측정한 결과, 보체 단백질 C5a에 대해 56 nM의 결합력을 가지는 것을 확인하였다(도 6).
한편, 더욱 향상된 결합력을 나타내는 돌연변이체를 개발하기 위해서 F5를 기본 폴리펩타이드로 하여 LRRV4 모듈의 네 개의 잔기를 돌연변이 시킨 후(도 7), 동일한 패닝과정을 거쳐, E8(서열번호 6)을 선별하였으며, 등온열량측정기를 이용하여 해리 상수를 측정한 결과, 보체 단백질 C5a에 대해 1.9 nM의 결합력을 가지는 것을 확인하였다(도 9). 이는 기본 폴리펩타이드로 사용한 F5와 비교 했을 때 약 29배 향상된 결과이다.
세 번째 친화력 증대 과정에서는 E8을 기반으로 LRR1과 LRRV1 모듈의 총 네 개의 잔기에 라이브러리르 구축한 결과(도 10), D5라는 클론을 선별하였다(서열번호 7). 보체 단백질 C5a에 대한 결합력을 등온열량측정기로 확인한 결과(도 12), 최종 클론인 D5의 보체 단백질 C5a에 대한 해리상수가 73 pM로 매우 강하게 결합할 수 있음을 확인하고 최종적인 클론으로 확보하였다.
이러한 결과를 통해 본 발명자들은, 자연적으로 존재하는 보체 단백질 C5a의 수용체보다 높은 결합력을 갖는 리피바디를 성공적으로 확보하였으며, 이는 보체 단백질 C5a에 특이적인 결합력을 갖는 폴리펩타이드임을 확인하였다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시태양일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명의 폴리펩타이드는 자연계에 존재하는 보체 단백질 C5a 수용체보다도 높은 친화력으로 보체 단백질 C5a에 결합하여 그의 활성을 억제할 수 있으므로, 보체 단백질 C5a 관련 질환의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있을 것이다.
전자파일 첨부하였음.
Claims (12)
- 인터날린 B 단백질의 N-말단, VLR (Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합된, 보체 단백질 C5a에 특이적으로 결합하는 폴리펩타이드.
- 제1항에 있어서, 상기 폴리펩타이드는 서열번호 1 내지 8 중 어느 하나의 아미노산 서열로 구성되는 폴리펩타이드.
- 제1항에 있어서, 상기 폴리펩타이드는 보체 단백질 C5a에 결합하여 그의 활성을 저해하는 것인 폴리펩타이드.
- 제1항에 있어서, 상기 VLR 단백질의 변형된 반복모듈은 하기의 반복 모듈 패턴을 포함하는 폴리펩타이드:(a) LxxLxxLxLxxN 패턴에서, L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판이고;(b) LxxLxxLxLxxN 패턴에서, N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌이며; 및(c) LxxLxxLxLxxN 패턴에서, x는 모든 종류의 20개의 아미노산.
- 제1항에 있어서, 상기 폴리펩타이드는 비 항체 단백질 골격인 리피바디로 구성되는 폴리펩타이드.
- 제5항에 있어서, 상기 리피바디는 LRR 구조를 갖는 인터날린의 N-말단과 상기 VLR 구조의 유사성을 바탕으로 융합하여 컨세서스 디자인으로 최적화시킨 폴리펩타이드.
- 제1항의 폴리펩타이드를 코딩하는 폴리뉴클레오티드.
- 제7항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제7항의 폴리뉴클레오티드 또는 제8항의 재조합 벡터가 도입된 재조합 미생물.
- 다음 단계를 포함하는 보체 단백질 C5a에 특이적으로 결합하는 폴리펩타이드의 생산방법.(a) 제9항의 재조합 미생물을 배양하여 배양물을 수득하는 단계; 및(b) 상기 배양된 재조합 미생물 또는 배양물로부터 제1항의 폴리펩타이드를 회수하는 단계.
- 제1항 내지 제6항 중 어느 한 항의 폴리펩타이드를 유효성분으로 함유하는 면역질환 또는 패혈증 치료용 의약 조성물.
- 제11항에 있어서, 상기 면역질환은 천식, 류마티스, 관절염 및 루프스로 구성된 군에서 선택되는 것을 특징으로 하는 의약 조성물.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/500,921 US10287342B2 (en) | 2014-08-01 | 2015-08-03 | Polypeptide for binding to complement protein C5A, and use of same |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020140098833A KR101624702B1 (ko) | 2014-08-01 | 2014-08-01 | 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 |
| KR10-2014-0098833 | 2014-08-01 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016018133A1 true WO2016018133A1 (ko) | 2016-02-04 |
| WO2016018133A9 WO2016018133A9 (ko) | 2016-04-28 |
Family
ID=55217906
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2015/008094 Ceased WO2016018133A1 (ko) | 2014-08-01 | 2015-08-03 | 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US10287342B2 (ko) |
| KR (1) | KR101624702B1 (ko) |
| WO (1) | WO2016018133A1 (ko) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101972894B1 (ko) * | 2017-05-18 | 2019-04-29 | 경상대학교산학협력단 | 소수성 테일 도메인이 제거된 먹장어 유래 vlrb 단백질에 칠성장어 유래 vlrb 단백질의 c 말단 서열이 연결된 융합 단백질 및 이의 용도 |
| KR102390931B1 (ko) * | 2020-02-07 | 2022-04-26 | 한국과학기술원 | 보체 단백 분해 산물 C3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 |
| KR102690857B1 (ko) * | 2021-04-30 | 2024-08-05 | 한국과학기술원 | 제2형 중증급성호흡기증후군 코로나바이러스의 수용체 결합 도메인 (SARS-CoV2 RBD)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20120022453A (ko) * | 2010-09-02 | 2012-03-12 | 한국과학기술원 | 신규한 md-2 결합 폴리펩타이드 및 이의 용도 |
| EP2647706A1 (en) * | 2010-11-30 | 2013-10-09 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
| KR101356075B1 (ko) * | 2012-02-27 | 2014-02-12 | 한국과학기술원 | 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101219628B1 (ko) | 2010-03-02 | 2013-01-10 | 한국과학기술원 | 인터날린 단백질의 n-말단 및 lrr 패밀리 단백질이 융합된 수용성 융합 폴리펩타이드 및 이의 제조 방법 |
-
2014
- 2014-08-01 KR KR1020140098833A patent/KR101624702B1/ko not_active Expired - Fee Related
-
2015
- 2015-08-03 US US15/500,921 patent/US10287342B2/en active Active
- 2015-08-03 WO PCT/KR2015/008094 patent/WO2016018133A1/ko not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20120022453A (ko) * | 2010-09-02 | 2012-03-12 | 한국과학기술원 | 신규한 md-2 결합 폴리펩타이드 및 이의 용도 |
| EP2647706A1 (en) * | 2010-11-30 | 2013-10-09 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
| KR101356075B1 (ko) * | 2012-02-27 | 2014-02-12 | 한국과학기술원 | 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드 |
Non-Patent Citations (1)
| Title |
|---|
| LEE S-C ET AL.: "Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering", PROC. NATL. ACAD, SCI., vol. 109, no. 9, 28 February 2012 (2012-02-28), pages 3299 - 3304, XP055200364, DOI: doi:10.1073/pnas.1113193109 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2016018133A9 (ko) | 2016-04-28 |
| US20170218060A1 (en) | 2017-08-03 |
| KR20160015891A (ko) | 2016-02-15 |
| KR101624702B1 (ko) | 2016-05-27 |
| US10287342B2 (en) | 2019-05-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2583009C (en) | Ubiquitin or gamma-crystalline conjugates for use in therapy, diagnosis and chromatography | |
| US7691970B2 (en) | Muteins of a bilin-binding protein with affinity for a given target | |
| KR101782790B1 (ko) | 혈청 알부민에 결합하는 설계된 반복 단백질 | |
| EP2867360B1 (en) | Designed ankyrin repeat proteins binding to platelet-derived growth factor | |
| JP2009509535A (ja) | タンパク様薬剤およびその使用 | |
| Kalichuk et al. | A novel, smaller scaffold for Affitins: Showcase with binders specific for EpCAM | |
| WO2015178689A1 (ko) | 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드 | |
| WO2016018133A9 (ko) | 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 | |
| CN117904060B (zh) | 一种基于parkin的靶向蛋白泛素化降解剂及其制备方法和应用 | |
| CN103059117A (zh) | 日本血吸虫重要抗原的高通量筛选及其在血吸虫病诊断中的应用 | |
| US10738092B2 (en) | Muteins of a1m lipocalin and method of production therefor | |
| KR102582417B1 (ko) | 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도 | |
| WO2012033382A2 (ko) | 신규한 rna 결합 단백질 및 이를 이용한 무표지 마이크로 rna 검출방법 | |
| CN101113982A (zh) | 体外筛选胰高血糖素样肽-1受体的多肽类激动剂的方法 | |
| WO2016204341A1 (ko) | 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도 | |
| KR102056386B1 (ko) | 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| CA2443719A1 (en) | Human fibroblast growth factor-related compositions | |
| CN120136979B (zh) | 一种靶向结合PCNA蛋白的binder、融合蛋白及其应用 | |
| WO2017135545A1 (ko) | 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| CN110066337B (zh) | 一种抗TNF-α抗体 | |
| WO2022010254A1 (ko) | 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 | |
| WO2021158092A2 (ko) | 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 | |
| Yang et al. | The discovery of a freezing-induced peptide ligation during the total chemical synthesis of human interferon-ε | |
| CN121873217A (zh) | 一种靶向乙肝表面抗原的纳米抗体及其应用 | |
| Huang et al. | Development of single-domain recombinant antibodies to reverse transcriptase domain of human hTERT |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15827101 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15500921 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 15827101 Country of ref document: EP Kind code of ref document: A1 |