WO2016014781A1 - Collagen iv replacement - Google Patents
Collagen iv replacement Download PDFInfo
- Publication number
- WO2016014781A1 WO2016014781A1 PCT/US2015/041712 US2015041712W WO2016014781A1 WO 2016014781 A1 WO2016014781 A1 WO 2016014781A1 US 2015041712 W US2015041712 W US 2015041712W WO 2016014781 A1 WO2016014781 A1 WO 2016014781A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- collagen
- chain
- protein
- chimeric
- alport syndrome
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
Definitions
- the present invention relates to collagen replacement for treating collagen associated diseases, in particular collagen IV and Alport syndrome.
- collagen associated diseases in particular collagen IV and Alport syndrome.
- Provided are recombinant collagen IV molecules, pharmaceutical compositions and methods for treating collagen IV associated disorders such as Alport syndrome.
- Alport Syndrome is an inherited disease that primarily affects the glomeruli, the tiny tufts of capillaries in the kidneys that filter wastes from the blood. The earliest symptom of the disease is blood in the urine (hematuria). Patients often present hearing loss and/or ocular complications as well. Fifty percent of Alport patients develop end stage renal disease (ESRD) by age 20 with a median time of death of 25 years of age and ninety percent by age 45. Without intervention progression to ESRD is inexorable. Alport syndrome has been reported worldwide without restriction to particular geographic areas. The prevalence is estimated to be about 1 in 5000 newborns in the United States.
- ESRD end stage renal disease
- Alport syndrome In UK, about 40 per million (including disease carriers) persons suffer Alport syndrome and Alport patients account for about 1% of patients on renal transplantation therapy. The incidence of Alport syndrome was found to be 1 :53,000 in Finland and 1 : 17,000 in southern Sweden (Pajari et al, Acta Paediatr, 1996, 85, 1300-1306; and Persson et al, Clin Nephrol, 2005, 64, 85-90). .
- the glomerular basement membrane is the site of the Alport lesion.
- Characteristic GBM ultrastructure changes in patients with Alport syndrome are irregular thickening of the GBM and multilamellation of the lamina densa forming a "basket weave" pattern. These changes are minimal in the early stages of the disease, but are widespread in adult patients. The widespread changes of the GBM are indicative of a tendency towards a progressive disease course. A good correlation between the severity of the GBM irregular thickening and the clinical course has been reported (Basta-Jovanovic et al, Am J Kid Dis, 1990, 16, 51-56). Young patients are likely the most amenable to therapy.
- Alport syndrome is caused by changes in genes (mutations) that affect type IV collagen, a protein that is important to the normal structure and function of glomerular basement membrane. This disease is mainly due to recessive mutations in the Collagen IV genes
- Collagen IV a3- a4-a5 is an important constituent of glomerular basement membranes in the kidney.
- Diagnosis of Alport Syndrome relies on careful evaluation of the patient's signs and symptoms, along with their family history. Sometimes hearing and vision tested. The evaluation can also include blood tests, urine tests, and a kidney biopsy to determine Alport syndrome. A genetic test can help confirm the diagnosis and determine the genetic type of Alport syndrome.
- the present invention relates to collagen replacement for treating collagen associated diseases, in particular collagen IV and Alport syndrome.
- collagen associated diseases in particular collagen IV and Alport syndrome.
- Provided are recombinant collagen IV proteins, pharmaceutical compositions and methods for treating collagen IV associated disorders such as Alport syndrome.
- the invention provides pharmaceutical compositions and formulations that include recombinant collagen IV protein and one or more pharmaceutically acceptable excipients which facilitate collagen IV stability, delivery, penetration and/or functionality.
- the recombinant collagen IV protein can be collagen IV protomers, dimers, tetramers, multimers and/or the mixture thereof.
- the collagen IV protomer may contain three polypeptides selected from the group consisting of al(IV), a2(IV), a3(IV), a4(IV), a5(IV) and a6(IV) chain polypeptides.
- the collagen IV protomer is a heterotrimer comprising an a3(IV) chain polypeptide, an a4(IV) chain polypeptide and an a5(IV) chain polypeptide, wherein the a3(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 3 and variants thereof; the a4(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 4 and variants thereof; and the a5(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO.5 and variants thereof.
- the collagen IV protomer is a heterotrimer comprising two copies of al(IV) chain polypeptides, and an a2(IV) chain polypeptide, wherein the al(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 1 and variants thereof; the a2(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 2 and variants thereof.
- said collagen IV protomer is a heterotrimer comprising one, two or three chimeric collagen IV a polypeptides selected from the chimeric a3(IV), a4(VI) and a5(IV) polypeptides.
- the chimeric a3(IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- the chimeric a4(IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the a4(IV) chain is replaced with all or part of the NCI domain of the l(IV) and/or a2(IV) chains.
- the chimeric ⁇ 5 (IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the ⁇ 5 (IV) chain is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- a collagen IV heterotrimeric protomer may consist of one chimeric a3(IV) chain polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced with all or part of the NCI domain of l(IV) or a2(IV) chains; one chimeric a4(IV) chain polypeptide in which all or part of the NC 1 domain of the a4(IV) chain is replaced with all or part of the NC 1 domain of l(IV) or a2(IV) chains; and one chimeric a5(IV) chain polypeptide in which all or part of the NCI domain of the a5(IV) chain is replaced with all or part of the NCI domain of l(IV) or a2(IV) chains.
- the NCI domains of al(IV), a2(IV), a3(IV), a4(IV), a5(IV) comprise the amino acid sequences of SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9, SEQ ID NO.10 and SEQ ID NO. l 1, respectively.
- said recombinant collagen IV protein is in the form of collagen IV dimers, which comprise two protomers that are dimerized non-covalently or covalently, wherein the protomers may be the heterotrimer a3(IV)-a4(IV)-a5(IV), or the heterotrimer comprising chimeric a3(IV), a4(IV) and/or a5(IV) chains.
- said recombinant collagen IV is recombinant human collagen IV, in particular human collagen IV ⁇ 3- ⁇ 4- ⁇ 5.
- collagen IV protein may be produced via the extraction and purification of human natural collagen IV from collagen IV containing tissues and organs, or through expression of recombinant collagen IV protein in mammalian cell lines, insects, plant cells and/or bacteria and yeast.
- the collagen IV protein is further modified to achieve a particular percentage of 3-hydroxyproline, 4-hydroxyproline and/or hydroxylysine, as compared to naturally occurring collagen IV protein.
- the collagen IV protein of the present invention contains about 6.5% to about 14% of 4- hydroxyprolines (i.e. between 65-140 3-hydroxyproline residues/1000 AA) and/or about 0.2% to about 1.6% of 3-hydroxyprolines (i.e. between 6-16 3-hydroxyproline residues/1000 AA).
- the collagen IV protein used in the present invention may contain modified amino acids and/or other amino acid substitutes. Such modifications and substitutes would not change the functionality of collagen IV protein, but may improve some chemical and physical features of collagen IV protein, such as increased stability, and reduced immunoreactivity.
- the pharmaceutical composition comprising recombinant human collagen IV protein may be used for improving glomerular structures and functions in a patient with Alport syndrome, wherein the recombinant human collagen IV protein comprises collagen IV protein protomers, dimers, tetramers, multimers and/or the mixture thereof, and one or more pharmaceutically acceptable excipients, wherein said collagen IV protein protomers, dimers, multimers consisting of three a chain polypeptides selected from the group consisting of ⁇ 3 (IV), a 4 (IV) and ⁇ 5 (IV) chain polypeptides.
- the pharmaceutically acceptable excipients comprise one or more antioxidants, one or more tonicity agents, one or more chelators, and agents that can assist in collagen IV assembly in the glomerular sites, such as bromine.
- the present inventions also include methods, vectors, chimeric cDNA constructs, cell lines and functional assays for producing normal and chimeric collagen IV a polypeptides of the present invention.
- the host cells may be genetically engineered to express prolyl 3-hydroxylase and/or prolyl 4-hydroxylase.
- the host cells may be further deficient in peroxidasin, lysyl oxidase, and/or native collagen IV protein or collagens other than native collagen IV.
- the present invention features methods for treating a condition characterized by one or more deficiencies of collagen IV protein in a subject in need thereof by administering to the subject in need thereof a pharmaceutical composition comprising
- recombinant collagen IV protein Said condition could be characterized by one or more deficiencies of the a3(IV) chain polypeptide; one or more deficiencies of the a4(IV) chain polypeptide; and/or one or more deficiencies of the a5(IV) chain polypeptide.
- deficiencies are due to genetic mutations in COL4A3, COL4A4 and/or COL4A5 genes.
- the condition characterized by deficiencies of collagen IV protein is selected from Alport syndrome, thin basement membrane nephropathy (TBMN), familial hematuria, end stage renal disease (ESRD), progressive renal insufficiency, glomerular hematuria, proteinuria, hereditary nephritis, diabetic nephropathy, perinatal cerebral hemorrhage and porencephaly, hemorrhagic stroke, and any diseases or disorder with defects in collagen IV protein.
- the disease is Alport syndrome.
- Alport syndrome may be X-linked Alport syndrome, autosomal recessive Alport syndrome, or autosomal dominant Alport syndrome.
- An X-linked Alport syndrome may be caused by any mutation in the COL4A5 gene encoding the a5(IV) chain polypeptide.
- An autosomal recessive Alport syndrome may be caused by any mutations in COL4A3 and/or COL4A4 genes encoding the a4(IV) chain polypeptide and a5(IV) chain polypeptide, respectively.
- An autosomal dominant Alport syndrome may be caused by any mutations in COL4A3 and/or COL4A4 genes encoding the a4(IV) chain polypeptide and a5(IV) chain polypeptide, respectively.
- the patient with Alport syndrome may be a patient without renal dysfunction findings who is diagnosed by family history or by genetic testing.
- the pharmaceutical compositions used in the present methods comprising recombinant collagen IV protomers, dimers, tetramers, multimers and the mixture thereof.
- the recombinant collagen IV consists of protomers.
- Collagen IV protomers are heterotrimers consisting of one a3(IV) chain, one a4(IV) chain and one a5(IV) chain, wherein the three chains form a triple helix and wherein the a3(IV) chain comprises the amino acid sequence of SEQ ID NO.3; the a4(IV) chain comprises the amino acid sequence of SEQ ID NO.4 and the a5(IV) chain comprises the amino acid sequence of SEQ ID NO.5.
- the recombinant collagen IV protomers are heterotrimers comprising one, two or three chimeric a(IV) chains selected from the chimeric a3(IV), a4(IV), a5(IV) chains, wherein the chimeric a3(IV) chain comprises a chimeric polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced with all or part of the NCI domain of the al(IV) or a2(IV) chains; the chimeric a4(IV) chain comprises a chimeric polypeptide in which all or part of the NCI domain of the a4(IV) chain is replaced with all or part of the NCI domain of the al(IV) or a2(IV) chains; and the chimeric a5(IV) chain comprises a chimeric polypeptide in which all or part of the NCI domain of the a5(IV) chain is replaced with all or part of the NCI domain of the l(IV) or
- said recombinant collagen IV are in the form of collagen IV dimers, wherein said dimers comprise two collagen IV protomers which may be recombinant collagen IV ⁇ 3- ⁇ 4- ⁇ 5 and/or chimeric collagen IV as disclosed herein.
- said collagen IV dimers are dimerized enzymatically or chemically in vitro prior to administering to the subject in need.
- the collagen IV protein is administered to a subject in need thereof by an intravenous injection, intraperitoneal injection, intramuscular injection, subcutaneous injection, intrathecal injection, intracerebral ventricular administration, intracranial delivery, intraocular delivery, intraaural delivery, and/or by an acute or chronically placed catheter.
- the collagen IV protein is administered to a subject in need thereof by intravenous injection.
- the effective dose is between about 100 ng/kg and about 100 mg/kg. In some aspects, the effective dose is between about 100 ng/kg and about 100 ⁇ g/kg. In other aspects, the effective dose is between about 1 ⁇ g/kg to aboutl mg/kg. In further other aspects, the effective dose is between about 1 mg/kg and about 100 mg/kg. In one embodiment, the effective dose is about 5 mg/kg.
- One or more prophylactic drugs may be co-administered with the collagen IV protein composition to a subject in need, said prophylactic drugs may be anti-thrombotic agents and/or anti-inflammatory drugs.
- Anti-thrombotic agents may be used to primarily prevent, or secondarily prevent acute thrombus formation induced by recombinant collagen IV replacement.
- An anti-thrombotic agent may be an antiplatelet drug, an anticoagulant, or a thrombolytic drug.
- Antiplatelet drugs may include, but are not limited to, irreversible cyclooxygenase inhibitors such as aspirin and triflusal; adenosine diphosphate (ADP) receptor inhibitors such as clopidogrel, prasugrel, ticagrelor and ticlopidine; phosphodiesterase inhibitors such as cilostazol; glycoprotein IIB/IIIA inhibitors such as abciximab, eptifibatide and tirofiban; adenosine reuptake inhibitors such as dipyridamole; thromboxane inhibitors such as thromboxane synthase inhibitors, thromboxane receptor antagonists and teruthroban.
- irreversible cyclooxygenase inhibitors such as aspirin and triflusal
- adenosine diphosphate (ADP) receptor inhibitors such as clopidogrel, prasugrel, ticagrelor and ticlopidine
- Anticoagulants may include, but are not limited to, warfarin, heparin, acenocoumarol, atromentin, brodifacoum and phenindione.
- Thrombolytic drugs may include, but are not limited to, tissue plasminogen activator t-PA such asreteplase, reteplase and tenecteplase; anistreplase; streptokinase and urokinase.
- Anti-inflammatory agents may include, but are not limited to, NSAIDS (non-steroidal anti-inflammatory drugs) such as aspirin, ibuprofen, naproxen; acetaminophen; and ImSAIDs (immune-selective anti-inflammatory drugs).
- NSAIDS non-steroidal anti-inflammatory drugs
- aspirin ibuprofen
- naproxen ibuprofen
- acetaminophen acetaminophen
- ImSAIDs immunoselective anti-inflammatory drugs
- the present invention features methods for preventing, ameliorating, reversing, slowing, halting and/or improving one or more abnormalities comprising thinning and splitting glomerular basement membrane (GBM), heavy proteinuria, mild proteinuria, hematuria, renal deficiency, progression to end stage renal disease, auditory dysfunction, ocular abnormalities, porencephaly, brain small vessel disease with hemorrhage, brain small vessel disease with Axenfeld-Rieger anomaly, hereditary angiopathy with nephropathy, aneurysms, and muscle, and/or intracerebral hemorrhage, by administering to a subject in need thereof a pharmaceutical composition that comprises recombinant collagen IV protein, such that administering collagen IV protein prevents, ameliorates, slows, halts and/or improves the phenotypic outcomes of the subject.
- GBM thinning and splitting glomerular basement membrane
- the collagen IV protein may be administered to a mammal.
- the mammal may be a mouse, a rat, a dog or a human.
- assays that may be used to detect recombinant collagen IV in basement membranes are provided in the present invention.
- Said assays may include receptor binding, cell migration, differentiation and/or adhesion, and biomarker measurement.
- Figure 1 is a representative denaturing/non-reducing SDS-PAGE gel image of Col4 ( ⁇ 1(2) ⁇ 2) protein which is immune blotted with anti-Col4 antibodies: sc70246 (1 : 100) (Lanes 4- 7), ab6586 (1 : 1000) (Lanes 8-11) and abl9808 (1 :1000) (Lanes 12-15). Lanes 1 and 2 are molecular weight markers from Novex. For each antibody, different amounts of Col4 ( ⁇ 1(2) ⁇ 2) protein (250ng, 125ng, 25ng, 12.5 ng) were loaded.
- FIG. 2 shows Col4 ( ⁇ xl(2) ⁇ x2) species in denaturing SDS-PAGE (4-15% gel) with or without disulfide reduction.
- Figure 2a is a representative denaturing SDS-PAGE gel image of Col4 ( ⁇ 1(2) ⁇ 2) preparation without disulfide reduction.
- Figure 2b a representative denaturing SDS-PAGE gel image of Col4 ( ⁇ 1(2) ⁇ 2) preparation with disulfide reduction.
- Lanes 13, 14 and 15 of Figures 2a and 2b are fully reduced LAM-111 and only the gamma 1 chain of LAM-111 is assayed by a gamma 1 specific antibody (Cat. No. sc5584).
- Figure 3 is a representative native PAGE gel image of Col4 ( ⁇ 1(2) ⁇ 2) proteins with charge shift using Direct Red 80 dye.
- LAM-111 was used as an independent molecular weight marker.
- Figure 4 is a histogram of ELISA assay for FITC- Col4 ( ⁇ 1(2) ⁇ 2) conjugate detection using various anti-FITC antibodies.
- Figure 5a is a representative gel image that shows the detection of FITC labeled and unlabeled Col4 ( ⁇ 1(2) ⁇ 2).
- Col4 (al(2)a2) is reduced in lanes A-C and unreduced in lanes D-F. The same amount of protein was loaded in each lane.
- Lanes A and D were loaded with unlabeled Col4 (al(2)(x2);
- Lanes B and E were loaded with FITC labeled Col4 ( ⁇ 1(2) ⁇ 2) but unpurified by a size exclusion column and Lanes C and F were loaded with FITC labeled Col4 ( ⁇ 1(2) ⁇ 2) and purified by a size exclusion column.
- Figure 5b is a representative gel image of immunoblot using anti-FITC antibody (abl9492, 1 :20,000 dilution) for detection of FITC- Col4 ( ⁇ xl(2) ⁇ x2).
- Figure 6a is a histogram of ELISA assay for FITC- LAM-111 conjugate detection using various anti-FITC antibodies.
- Figure 6b is a representative gel image that shows the detection of FITC labeled and unlabeled LAM-111.
- LAM-111 is reduced in lanes A-B and unreduced in lanes D-F. The same amount of protein was loaded in each lane.
- Lanes A and D were loaded with unlabeled LAM- 111;
- Lanes B and E were loaded with FITC labeled LAM-111 but unpurified by a size exclusion column and Lanes C and F were loaded with FITC labeled LAM-111 and purified by a size exclusion column.
- Figure 6c is a representative gel image of immunoblot using anti-FITC antibody (ab 19492, 1 :20,000 dilution) for detection of FITC-LAM-111.
- Figure 7 shows the localization of FITC-Col4 (a 1 ( 2 ) ⁇ x2) and FITC-LAM- 111 in the glomerular basement membrane (GBM) after 6 doses of intravenous injection.
- Figures 7a and 7b are representative confocal fluorescence microscopy images of kidneys of Heterozygous (Col4+/- (hybrid)) mouse that is un-injected (figure 7a) and Alport (Col4-/- (Hybrid)) mouse that is injected with 6 doses of FITC-Col4 ( ⁇ 1(2) ⁇ 2) ( Figure 7b) and.
- the top panel are images of anti-FITC antibody staining; the middle ones are images of anti-agrin staining and the bottom panel are overlap images of anti-FITC and anti-agrin staining with a DNA marker DAPI staining.
- Figures 7c and 7d are representative confocal fluorescence microscopy images of kidneys of Heterozygous (Col4+/- (B6)) mouse that is un-injected ( Figure 7c) and Alport (Col4- /- (B6)) mouse that is injected with 6 doses of FITC-LAM- 11 1 ( Figure 7d).
- the top panel are images of anti-FITC antibody staining; the middle ones are images of anti-agrin staining and the bottom panel are overlap images of anti-FITC and anti-agrin staining with a DNA marker DAPI staining.
- Figure 8a shows representative images of glomerular morphology in un-injected Alport mouse (Col4-/- 75 days old).
- Figure 8b shows representative images of glomerular morphology in Col4-(al(2)(x2) dosed Alport mouse (Col4-/-, 88days old).
- Figure 10 shows representative electron microscopy images of glomerular capillaries.
- Figure 10a are representative images of heterozygous mouse (Col4+/-) injected with vehicle only (day 70).
- Figure 10b are representative images of Alport mouse (Col4-/-) injected with vehicle (day 70).
- Figure 10c are representative images of Alport mouse (Col4-/-) injected with Col4- ( ⁇ 1(2) ⁇ 2) protein (day 70).
- Figure 11 is blood urea nitrogen (BUN) measurement in Col4-(al(2)(x2) dosed Alport mice (upper) and untreated/vehicle treated Alport mice (lower).
- Figure 12 is urine albumin/creatinine ratio of Col4-(al(2)(x2) dosed Alport mice (upper) and untreated/vehicle treated Alport mice (lower).
- the present invention relates to pharmaceutical compositions, medications and methods for treating collagen associated diseases, in particular, diseases characterized by one or more deficiencies of collagen IV protein, such as Alport syndrome caused by genetic mutations in the COL4A3, COL4A4 and COL4A5 genes that encode collagen IV a3, a4 and a5 chain polypeptides.
- the present invention aims to transport functional collagen IV protein back to the affected sites to restore collagen IV based structural support and other physiological functions.
- Collagen is the major structural constituent of mammals. Numerous diseases and conditions are associated with excess accumulation of collagen in tissue, mutations of collagen a chains, abnormal assembly, increased/decreased post-translational modifications, and/or interrupted collagen interaction with other structural proteins. Mutations in any of collagen a chain polypeptides cause a variety of rare diseases due to the absence of correct collagen structures, which provide support for tissues and organs, present signals for development, and/or support physiological functions. For example, the absence of collagen IV caused by mutations in COL4A3, COL4A4 and COL4A5 genes impairs the glomerular basement membranes, which may ultimately result in renal failure.
- the present invention provides novel pharmaceutical compositions, medications and methods for treating collagen mediated disorders, in particular the collagen IV mediated disorder Alport syndrome.
- Provided here are also methods for treating Alport syndrome, and/or preventing, slowing the process of renal failure.
- the rationale of the present invention is to transport recombinant human collagen IV protein back to the affected sites such as glomerular basement membrane to restore its normal structure and therefore its filtering function.
- glomerular basement membranes Endothelial fenestrae are about 100-150 nm, large enough to permit the passage of large proteins, such as ferritin, but it is not known whether elongated molecules, such as a collagen IV protomer, or an even more elongated collagen IV dimer, is capable of penetrating into the GBM.
- Nephrotic glomerular basement membrane is more permeable to ferritin than the normal glomerular basement membrane.
- the present invention develops pharmaceutical compositions and methods for treating Alport syndrome by administering to the affected patient recombinant collagen IV protein, in particular collagen IV protomers, dimers, tetramers or multimers by intravenous injection.
- collagen IV protomers, dimers, tetramers or multimers will penetrate into the glomerular basement membrane in the kidney and embed into the extracellular matrix network with other components.
- the pharmaceutical composition comprising recombinant collagen IV may also be used as part of regenerative medications.
- the recombinant collagen IV from the present invention may be incorporated into artificial scaffolds and/or natural, decellularized scaffolds; mixed with other extracellular matrix proteins; employed as substrates for the in vivo, ex vivo and/or in vitro growth, differentiation and selection of stem cells; or employed as a thrombosis enhancing patch for acute wound pair. Definitions
- protomer refers to a molecular structural subunit of a large macromolecule (i.e. oligomeric protein).
- the collagen protomers themselves are trimers, consisting of three a chain polypeptides.
- a collagen IV protomer is a heterotrimer of three a chain polypeptides.
- Collagen protomers will form dimers, tetramers, oligomers and multimers.
- the term “basement membrane”, also referred to as “basal lamina”, means the thin spread of fibrils.
- Basement membrane is composed of at least several identified proteins and peptide derivatives, including several specific types of collagen (e.g., Type IV and Types I-V), laminin, and various types of cell adhesion molecules (CAMs), proteoglycans, and fibronectin.
- the basement membrane forms a thin sheet of fibers that underlies cells in various tissues (e.g., skin).
- Basement membrane primarily serves as the anchoring system of cells, attaching it to the connective tissue below, or provides a protective barrier against foreign objects or malignant cells, or filters blood through the glomerulus in the kidneys.
- GBM glomerular basement membrane
- polypeptide “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues, and not to a specific length. Thus, peptides, oligopeptides and protein fragments are included within the definition of polypeptide.
- the terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
- Polypeptides can be modified, e.g., by the addition of carbohydrate residues to form glycoproteins. Another example of post-translation modification is hydroxylation of proline and lysine in many collagen polypeptides.
- polypeptide “peptide” and “protein” include glycoproteins, as well as non-glycoproteins.
- treating refers to administering a
- compositions of the present invention comprising collagen IV protein, for prophylactic and/or therapeutic purpose.
- prevent disease refers to prophylactic treatment of a patient who is not ill yet, but who is susceptible to, or otherwise at risk of developing a particular disease.
- a patient by genetic test, carries mutations in COL4A3, COL4A4 and/or COL4A5 genes.
- treat disease refers to administering to a patient who is already suffering from a disease to ameliorate the disease and improve the patient's condition, e.g., renal function.
- Collagen is the most abundant protein found in the mammals, constituting about 25% of total protein. It is the main fibrous component of skin, bone, tendon, cartilage and
- a typical collagen molecule is a long, rod-like, rigid structure with triple stranded helix. Collagen is further cross-linked to form polymeric collagen structure/networks, such as fibrils, sheets and filaments.
- the collagen superfamily of proteins plays a dominant role in maintaining the integrity of various tissues and also has a number of other important functions.
- collagen molecules are found throughout the body, their types and organization are dictated by the structural role collagen plays in a particular organ/tissue.
- collagen may be dispersed as a gel that gives support to the structure, as in the extracellular matrix or the vitreous humor of the eye.
- collagen may be bundled in tight, parallel fibers that provide great strength, as in tendons.
- the collagen fibers of bone may be arranged particularly so as to resist mechanical attack.
- Collagen is a large family of highly developed fibrous proteins comprising more than 25 collagen types (see Table 1) that form highly organized super molecular assemblies, as well as additional proteins that have collagen- like domains. Many genetically, chemically and immunologically distinct types of collagens have also been identified. Collagen variations may be due to differences in the assembly of basic polypeptide chains, different lengths of the helix, various interruptions in the helix, difference in the terminations of the helical domains and/or cleavage of the non-collagenous domains.
- Collagen can be organized into several groups, based on their locations and functions in the body.
- Collagen types I, II, III, V and XI are fibril-forming collagens, which form linear polymers of fibrils having characteristic banded patterns, reflecting the regular staggered packing of the individual collagen molecules in the fibrils.
- Collagen types IX, XII, XIV and XVI are fibril associated collagens that bind to the surface of collagen fibrils, linking these fibrils to one another and/or to other components in the extracellular matrix.
- Collagen types IV, VIII and X are network forming collagens, which form a three dimensional mesh, rather than fibrils. For example, collagen IV molecules assemble into a sheet that constitutes a major part of basement membranes.
- a fourth group of collagen includes all other collagens, such as collagen VI (beaded fibril forming collagen) and VII (anchoring fibrils).
- All collagen molecules consist of three polypeptides, referred to as a chains, which wind around one another for at least a portion of their length to form a triple a helix.
- the parts of collagen that do not form triple helices are called non-collagenous, or "NC" domains, and are numbered within each collagen e.g., NCI, NC2 etc.
- the individual a chain polypeptide has similar domain organization, containing a large central triple helix forming domain with numerous Gly-X-Y repeats (i.e. collagenous domain), flanked by small N- and C-terminal global domains (i.e. non-collagenous domains).
- Some types of triple helical collagen protomers contain three genetically identical a chains forming homotrimers, whereas others contain two or three different a chains forming heterotrimers.
- H bonds The three a chain polypeptides are held together and stabilized by hydrogen bonds between them. Unlike the more common a helix, the collagen helix has no intrachain hydrogen bonds.
- Amino acid sequences The collagen helical domain contains specific amino acids (glycine, proline and hydroxyproline) which are important in the formation of the triple helix. These amino acids have a regular arrangement in each a chain polypeptide. The sequence often follows the pattern Gly-X-Y, where X is frequently proline and Y is often hydroxyproline (it can also be hydroxy lysine). Thus, most of the helical part of the a chain can be regarded as a polytripeptide whose sequence can be represented as (-Gly-Pro-Hyp-)n. Proline or hydroxyproline constitute about 1/6 of the total sequence and Glycine accounts for 1/3 of the sequence.
- Proline facilitates the formation of helical orientation of each a chain because its ring structure causes "kinks" in the peptide chain.
- Glycine is found in every third position of the triple repeat. Because glycine is the smallest, nonpolar amino acid with no side chain, it plays a unique role in fibrous structural proteins.
- the side chain of glycine is a hydrogen atom and such a small side chain makes it easy to fit into places where no other amino acids can. For example, only glycine can be in the internal amino acid of a collagen helix.
- Collagens do not contain chemically reactive side groups like those in enzymes and transport proteins.
- Triple helical structure Unlike most globular proteins that are folded into compact structures, collagen, a fibrous protein, has an elongated, triple-helical structure that places many of its amino acid side chains on the surface of the triple-helical molecule. Each a chain forms a left-handed helix and they align together to form a triple right-handed helical protomer. The a chains each are shaped into a left handed symmetry because of the high content of proline and hydroxyproline rings, with their geometrically constrained carboxyl and (secondary) amino groups along with abundance of glycine. The left handed helices are formed without any intrachain hydrogen bonding.
- the triple helix may be continuous stretch or it may be interrupted by non collagenous elements.
- hydroxyproline and hydroxylysine Collagen contains hydroxyproline (Hyp) and hydroxylysine (Hyl), which are not present in most other proteins. These residues result from the post-translational hydroxylation of some of the proline and lysine residues. The hydroxylation reactions are catalyzed by enzymes (hydroxylase) and require ascorbic acid (vitamin C).
- Hydroxyproline is important in stabilizing the triple-helical structure of collagen because it maximizes interchain hydrogen bond formation.
- Glycosylation In some cases, the hydroxyl group of the hydroxylysine residues of collagen may be enzymatically glycosylated, making collagen a glycoprotein. Most commonly, glucose and galactose are sequentially attached to the polypeptide chain prior to triple-helix formation.
- Cross-linkage The tensile strength of collagen depends on the formation of covalent intermolecular cross-links between the individual protein subunits.
- the fibril containing collagens in higher vertebrates e.g., types I, II, III, V and XI
- the fibril containing collagens in higher vertebrates are cross-linked through a mechanism based on the reactions of aldehydes generated enzymatically from lysine (or hydroxylysine) side-chains by lysyl oxidase.
- Certain other collagen types e.g. collagen IX of cartilage
- collagen IX of cartilage are also cross-linked by the lysyl oxidase mechanism.
- the major sites for the synthesis of the polypeptide precursors of the collagen molecules are mesenchymal cells and their derivatives including fibroblasts, chondrocytes (in cartilage), osteoblasts (in bone), odontoblasts and cementoblasts.
- Other cells may include, but are not limited to, epithelial cells, endothelial cells, muscle cells and Schwann cells.
- the precursor polypeptides are formed inside cells through sequential events including translation of prepro-a chains from specific mRNAs, cleavage of signal peptide (pro-a chain), proline hydroxylation, lysine hydroxylation, hydroxylysine glycosylation and association of C- terminal peptides/disulphide bond formation/incorporation of C terminal propeptides
- collagen molecules are then secreted into the extracellular matrix. After enzymatic modification, the mature collagen monomers aggregate and become cross- linked to form collagen fibers.
- pro-a chains Like most proteins produced for export/secretion, the newly synthesized polypeptide precursors of a chains (prepro-a chains) contain a special signal sequence at their N-terminal ends.
- the signal sequence facilitates the binding of ribosomes to the rough endoplasmic reticulum (RER), and directs the passage of the prepro- ⁇ chain into the lumen of the RER.
- the signal sequence is rapidly cleaved in the RER to yield a precursor of collagen called a pro-a chain.
- Post-translational modification The pro-a chains are processed by a number of enzymes within the lumen of the RER while the polypeptides are still being synthesized.
- Proline and lysine residues found in the Y-position of the -Gly-X-Y- sequence can be hydroxylated to form hydroxyproline and hydroxylysine residues.
- These hydroxylation reactions require molecular oxygen, Fe 2+ , and the reducing agent ascorbic acid (vitamin C).
- Two hydroxylating enzymes, prolyl hydroxylase and lysyl hydroxylase, are usually involved. Lack of prolyl and lysyl hydroxylation can impair interchain H-bond formation, as is formation of a stable triple helix.
- Hydroxyproline may also prevent denaturation of collagen fibers in temperature changes. It has been shown that non hydroxylated triple helices undergo denaturation at temperature below 37°C. Some hydroxylysine residues are modified by glycosylation with glucose or glucosyl-galactose.
- Triple helix assembly After hydroxylation and glycosylation, three pro-a chains form a procollagen molecule (protomer) that has a central collagenous region of triple helix flanked by the nonhelical N- and C-terminal domains called propeptides.
- procollagen molecule begins with a series of noncovalent interactions between the C-terminal non-collagenous domains of the three pro a chains, which provide correct alignment for the nucleation of triple helix formation through the middle collagenous domains.
- This first recognition of C-terminal propeptides selects specific chains for the procollagen assembly.
- procollagen types I and III are assembled in a type specific manner despite both being synthesized in skin fibroblasts and having high levels of identity in their procollagen a chain sequences.
- collagen I exists as a heterotrimer of two pro l (I) and one pro ⁇ 2 (I) chains
- collagen III is an obligate homotrimer comprising three pro l (III) chains.
- Sequential biosynthetic events occur in the extracellular space through which procollagen is processed into mature collagen. Such events include N-terminal and C-terminal domain (propeptide) cleavage (by N- and C- proteinase), alignment of collagen molecules that form microfibril (lysine/hydroxylysine terminal NH2 oxidation (Cu 2+ -containing lysyl oxidase)), and final fibril formation (reducible cross-link formation and maturation of cross-links). The fibrils are immature and lack strength. These immature fibrils are cross linked and gradually form mature collagen fibers. Cross-linkage is a slow process and tensile strength of collagen steadily increases over a long period via growth and reorganization of fibers.
- propeptides Extracellular cleavage of propeptides: For most procollagen molecules, the terminal non-collagenous domains (propeptides) are cleaved off by N- and C-procollagen peptidases, after their release into the extracellular space. The cleaved tropocoUagen will cross link one another to form collagen fibers or other structures. [00089] Many of these propeptides have important functions that are distinct from those of the collagen domains. For example, endostatin, a fragment released from collagen type XVIII, potently inhibits angiogenesis and tumor growth.
- collagen fibers Individual tropocollagen molecules spontaneously associate to form collagen fibrils. They form an ordered, overlapping, parallel array, with adjacent collagen molecules arranged in a staggered pattern, each overlapping its neighbor by a length approximately three-quarters of a molecule.
- tropocollagen refers to the collagen subunit in which the N-terminal and C-terminal propeptides are cleaved.
- Cross-linkage is catalyzed by extracellular enzyme lysyl oxidase. This Cu 2+ -containing extra-cellular enzyme oxidatively deaminates some of lysyl and hydroxylysyl residues in collagen.
- the reactive aldehydes that result can condense with lysyl or hydroxylysyl residues in neighboring collagen molecules to form covalent cross-links and, thus, mature collagen fibers then the reactive aldehydes combine with collagen residues to form cross-links.
- collagenases which are part of a large family of matrix metalloproteinase (MMPs).
- MMPs matrix metalloproteinase
- Collagenases are specialized enzymes that have evolved specifically to hydrolyze collagens, because the triple helix structure is resistant to most of common proteinases. For example, the cleavage site of collagen I is specific, generating three- quarter and one-quarter length fragments. These fragments are further degraded by other matrix proteinases to their constituent amino acids.
- Collagen biosynthesis is tightly regulated during normal development and homeostasis in a cell and in a tissue specific manner. It has been shown that a variety of growth factors and cytokines regulate collagen production during development, inflammation, wound healing and other physiological conditions (e.g., PDGF, TGF-beta, FGF and IGF, IL-1, IFN-gamma, THF- alpha and glucocorticoids). Some of those post-translational enzymes may be attractive targets for the development of drugs to treat collagen accumulation in many fibrotic diseases.
- Collagen Diseases e.g., PDGF, TGF-beta, FGF and IGF, IL-1, IFN-gamma, THF- alpha and glucocorticoids.
- Some examples of collagen diseases include osteogenesis imperfecta, many chondrodysplasias, several subtypes of the Ehlers-Danlos syndrome, Alport syndrome, Bethlem myopathy, certain subtypes of epidermolysis bullosa, Knobloch syndrome and also some cases of osteoporosis, arterial aneurysms, osteoarthrosis, and intervertebral disc disease (See Table 1). The characterization of mutations in additional collagen genes will probably add further diseases to this list.
- COL1A2 abundant forming; reticular cells; imperfecta; Ehlers- collagen of the provide smooth Danlos Syndrome, human body; tensile muscle cells types 1,2, 7; Infantile mostly present strength cortical hyperostosis in scar tissue, (Caffey's disease) the end product
- cartilage makes forming; Hypochondrogenesis; up 50% of all provide Achondrogenesis cartilage tensile type 2; Stickler protein; vitreous strength syndrome; Marshall humor of the syndrome;
- COL3A1 This is the Fibril Fibroblasts; Ehlers-Danlos collagen of forming; Endothelial Syndrome (type IV) granulation fetal skin, cells; reticular
- COL4A3 lens Also serves interacts endothelial syndrome
- V COL5A1 Most interstitial Connector Fibroblasts; Ehlers-Danlos
- COL6A3 with type I attach cells Bethlem Myopathy collagen.
- microfibrils are tissues
- anchoring fibrils forming; bullosa dystrophica; in dermal mostly recessive dystrophic epidermal beneath epidermolysis junctions stratified bullosa; Bart
- IX COL9A1 FACIT collagen Fibril Epiphyseal dysplasia
- Collagen vascular diseases include, but are not limited to, ankylosing spondylitis, dermatomyositis, polyarteritis nodosa, psoriatic arthritis, rheumatoid arthritis, scleroderma and systemic lupus erythematosus.
- defects in any one of the many steps in collagen fiber synthesis can result in a genetic disease involving an inability of collagen to form fibers properly and, thus, provide tissues with the needed tensile strength normally provided by collagen.
- Collagen medical uses e.g., collagen modifying enzyme defects
- Collagen is widely used in the medical field. The most common use of collagen is in cosmetic surgery and as wound healing aids in burn patients. Collagen can be used in the construction of artificial skin substitutes used in the management of severe burns. Collagen is widely used as reconstruction of bone, and for a wide variety of dental, orthopedic and surgical purposes. Other uses include wound dressing and as matrices for tissue growth.
- collagen has been used in many other fields, such as applications in cell culture (for cell attachment, studying cell behavior and cellular interaction with the extracellular environment, etc.); as barrier films/sheets; for drug delivery such as collagen hydrogel, collagen-liposomes, collagen nanoparticles/nanosphere, and collagen tablets/pellets, biodegradable materials and substitutes.
- Collagen medical uses are widely discussed in the art, such as collagen sponges for drug delivery (see e.g., U.S. Pat Nos. 3,157,524; 4,412, 947; and 5,512,301); collagen film (see, e.g., U.S. Pat. No. 3,014,024); collagen hydrogel (see, e.g., U.S. Pat Nos.5, 108, 424; 5,213,701); collagen as wound healing agents (see, e.g., U.S. Pat Nos. 3,810,473; 4,841,962; 4,837,285; 4,925,924; 5,081,106; and 5,766,631); making contact lens (see, e.g., U.S.
- collagen implants for a variety of purposes such as cartilage repair, prosthetics, orthopedic grafts, tendon replacement implant, implant for soft tissue and bone implant (see, e.g., U.S. Pat. Nos. 3, 272,204; 4,424,208; 5,171,273; 5,523,291; 6,080,194; 7,544,212; and 7, 595,062; and U.S. patent publication Nos. 20080305517; 2010108945; and 20110264237);
- modified collagen for therapeutic and diagnostic uses (see, e.g., U.S. Pat. Nos. 7,183,383 and 8, 283,414; and U.S. patent publication No. 20130116405).
- bovine collagen from certified BSE (Bovine spongiform encephalopathy) free cattle. Other commonly used include porcine tissue and equine tissue. In some cases, a human patient's own fat, hyaluronic acid or polyacrylamide gel are also used. Human collagen may be extracted from donor cadavers, placentas and aborted fetuses, which has a low possibility of immune reactions.
- Many recombinant techniques have been developed for producing recombinant collagen proteins. Those methods for producing recombinant collagen proteins through bioengineering are well known to skilled in art. Some exemplary methods include production of human recombinant collagen in the milk of transgenic animals (see, e.g., U.S. Pat. No.
- recombinant collagen in mammalian cells, insects, and microorganisms such as bacteria and yeast see, e.g., U.S. Pat. Nos. 6,150,081; 7,932,353; 8,084,579; 8,188,230; and U.S. patent publication No. 20020142391; 20140107036
- production of recombinant chimeric triple helical collagen see, e.g., PCT patent publication No. WO2010071938
- fusion proteins with three a chain polypeptides see, e.g., U.S. patent publication No. 20130237486)
- stimulating fibroblast cells to express native collagen proteins see, e.g., U.S. patent publication No.
- mice with genetically engineered collagen mutations have proved valuable for defining the functions of various collagens and for studying many aspects of the related diseases and physiological functions of collagen.
- COL4A3 knock-out mice are used as models for Alport syndrome (Cosgrove et al, Genes Dev., 1996, 10, 1403-1413).
- studies are designed to inject collagen IV, either extracted from collagen IV containing tissues, or produced by recombinant methods,
- mice intravenously or by any other suitable delivery routes, to mouse models of Alport syndrome.
- a comprehensive analysis of collagen IV incorporation into glomerular basement membrane (GBM), histological features of GBM and other collagen IV function assays such as collagen IV receptor binding, interaction with other GBM components, cell migration and differentiation and/or biomarker measurement, are conducted after administering collagen IV to mice with Alport-like syndromes.
- mice treated with collagen IV replacement are analyzed for renal functions, such as urine analysis of hematuria, proteinuria, albumin-to- creatinine ratio, or estimated glomerular filtration rate.
- Collagen IV is the most abundant protein found in extracellular basement membranes.
- the amino acid sequence of each a chain polypeptide is listed in Table 2, including their UniProt accession numbers (where more than one isoform is known, isoform 1 is shown). It is understood to one skilled in the art that the representative sequences also include any variants and derivatives that do not substantially change each polypeptide.
- Each collagen IV alpha chain can be divided into three domains: the 7S domain, a small non-collagenous N-terminal domain; a major collagenous domain in the middle region (about 1400 amino acid residues); and the NCI domain, a non-collagenous globular domain constituting the C-terminal domain (about 230 residues).
- the collagenous domains of collagen IV chains contain numerous Gly-X-Y amino acid triplet repeats, where proline and hydroxyproline are frequently located at positions X and Y.
- the presence of glycine as each third amino acid is also essential, as it is the only amino acid small enough to fit into the center of the triple helix in collagenous proteins.
- the Gly-X-Y repeat region of collagen IV displays multiple interruptions (i.e. about 20 short non-collagenous sequences), imparting flexibility to the collagen IV protomer and to the network that it forms in basement membranes.
- the three a chains of collagen IV protomers are organized into triple helices in the 7S and the major collagenous domains, but in the NCI domain each chain is folded into a globular structure, stabilized by intrachain disulfide bonds.
- the NCI domains initiate a molecular interaction between three a chains, and protomer trimerization then proceeds in a zipper like format from the C-terminal end, resulting in a fully assembled protomer.
- the sulfimine bonds are located between pairs of trimeric NCI domains, driving the formation of the collagen IV network (Vanacore et al., Science, 2009, 325, 1230-1234). In humans, peroxidasin is expressed most highly in the endothelium.
- NC1 P0246 7 GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERA doma 2[144 HGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYS in 5- YWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVM
- collagen IV molecules undergo extensive post- translational modification prior to secretion and this modification consists of the hydroxylation of appropriate proline and lysine residues, and the glycosylation of certain hydroxylysine residues to galactosylhydroxylysme and glucosylgalactosylhydroxylysme (reviewed in Bornstein and Sage, Annu. Rev. Biochem., 1980, 49, 957-1004).
- Collagen IV molecules may also be modified by the addition of asparagine-linked oligosaccharide side chains (Cooper et al, 1981; and Kurkinen et al., 1982). The extent of intracellular modifications in collagen IV is the highest among all the collagen types. Abnormal modification of collagen IV may affect the secretion of collagen IV (Wang et al, J. Bio.Chem., 1989, 264, 15556-15564).
- Enzymes required for collagen IV modifications include prolyl-4 hydroxylase, prolyl- 3 -hydroxylase, lysyl hydroxylase, galactosyltransferase, glucosylgalactosyltransferase, and the asparagine-linked glycosylation machinery. Variants in the extent of modifications can also be found within the same type of collagen IV molecule, from different tissues, or even the same tissue in many physiological and pathological conditions (Kivirikko and Myllyla, Methods Enzymol, 1982, 82, 245-304).
- Properly modified collagen IV is important for cell differentiation (such as F9 stem cells) (Wang et al, J. Bio.Chem., 1989, 264, 15556-15564).
- Range of 3-hydroxyproline in Collagen IV is estimated to be between 6-16 3- hydroxyproline residues per 1000 amino acids (i.e. about 0.3% to 1.6% ).
- Range of 4- hydroxyproline in Collagen IV is estimated to be 65-140 4-hydroxyproline residues per 1000 amino acids (i.e. about 6.5 to 14%>) ( see, e.g., Pokidysheva et al, Proc Natl Acad Sci USA.
- 3-hydroxyproline residues are much less abundant, as compared to 4-hydroxyproline residues. Only 1-2 residues of 3Hyp occur per chain in collagen types I and II and 3-6 residues occur per chain in collagen types V and XI. The content is highest in type IV collagen of basement membranes in which 10% of the total hydroxyproline can be 3Hyp (Gryder et al, J. Biol. Chem., 1975, 250, 2470- 2474). It is also speculated that 3Hyp residues could be involved in fine-tuning of collagen triple helices through inter-triple-helical hydrogen bonds. Adequate 3-hydroxyprolination in collagen IV can reduce platelet aggregation.
- the non- fibrillar assembly of collagen IV serves as a scaffold for forming the thin, sheet- like basement membrane with other matrix molecules, including subtypes of laminin, nidogen, and perlecan, a heparan sulfate proteoglycan (Breitkreutz D et al., Biomed. Res Int, 2013, el79784), as well as for cell attachment.
- Collagen IV ⁇ 3- ⁇ 4- ⁇ 5 is mainly found in the basement membrane of kidney, inner ear and eye.
- Collagen IV l- l-a2 is the major
- laminin and collagen IV form distinct networks which become non-covalently interconnected by mono- or oligomeric nidogen and perlecan.
- the collagen IV molecules are covalently cross-linked by disulfide bridges via their noncollagenous C- and globular N-terminus, giving rise to a very stable
- basement membranes are important regulators for cell behavior, tissue compartmentalization, tissue remodeling and morphogenesis. Basement membranes are widely distributed extracellular matrices within cutaneous, muscle, ocular, vascular, neural tissue and kidney.
- Collagen IV is primarily found in the basement membranes (BMs) of the skin, which form a barrier against environmental impacts.
- BMs basement membranes
- collagen IV is synthesized by both epidermal keratinocytes and dermal fibroblasts.
- epidermal basement membrane only collagen IV ⁇ 1- ⁇ 2- ⁇ 2 and collagen IV ⁇ 5- ⁇ 5- ⁇ 6 heterotrimers can be found (Hasegawa et al, Arch. Histol. Cytol. 2007, 70, 255-265).
- the inactivation of COL4A1 and COL4A2 also is incompatible with life, although only at later stages of gestation.
- Collagen IV is also found in basement membrane of neurovascular bundles and other periodontium cells. It also plays role in maintaining the elastic system of the vasculature of the gums. For example, endothelial cells express collagen type IV for angiogenesis.
- GBMs Glomerular Basement Membranes
- GBMs are the central, non- cellular layers of the glomerular filtration barrier (GFB) that are situated between the two cellular components: endothelial cells and podocytes (unique epithelial cells).
- the GBM is composed primarily of four extracellular matrix macromolecules - laminin-521, collagen IV ⁇ 3- ⁇ 4- ⁇ 5, the heparan sulfate proteoglycan (primarily agrin), and nidogen which are secreted by the endothelial cells and podocytes.
- These extracellular matrix proteins in the GBMs produce an interwoven meshwork thought to impart both size- and charge-selective properties.
- collagen IV al-al-a2 the embryonic form of collagen IV present in the developing GBM, is normally replaced in the adult mature GBM by collagen IV ⁇ 3- ⁇ 4- ⁇ 5. This isoform substitution occurs coincidentally with the transition of laminin chains in the GBM. It is hypothesized that the collagen IV transition might be required to accommodate the increased blood pressure in the adult, since ⁇ 3- ⁇ 4- ⁇ 5 type IV collagen produces a more heavily cross-linked and more protease-resistant network compared to the al- al- a2 type IV collagen network.
- endothelial fenestrae are about 100-150 nm, large enough to foster transport of large proteins such as collagen IV protomers which are rod- like heterotrimers with a diameter of about 12 nm.
- GBM is permeable to other large molecules that are larger than 400 kDa, such as ferritin and large antigen-antibody complexes (Farquhar et al, J Exp Med., 1961, 113, 47-66; Vogt et al, Kidney Int. 1982, 22(1): 27-35; and Fujigaki et al, Am Jpathol., 1993, 142(3), 831-842).
- exogenous collagen protein such as recombinant collagen IV molecules
- exogenous collagen IV molecules could be successfully transported to the GBM in the kidney via in vivo delivery.
- exogenous collagen IV molecules can integrate into the GBM and form a correct basement network with other components of the GBM.
- the present invention will administer recombinant collagen IV protein, in particular collagen IV protomers, dimers, tetramers or multimers to the GBM sites that are impaired by collagen IV defects via systemic or local delivery.
- the collagen IV protomers, dimers, tetramers or multimers will then be embedded into the defective GBM and restore the normal matrix protein network in the GBM in the kidney.
- Deficiencies in collagen IV such as the absence of the ⁇ 3- ⁇ 4- ⁇ 5 type IV collagen network, caused by mutations in the COL4A3, COL4A4 and/or COL4A5 genes, often impair basement membranes (e.g. GBM), causing many diseases including Alport syndrome, as well as several rheumatologic and dermatological diseases such as acquired epidermolysis bullosa, and the vascular complications of nephropathy and retinopathy in diabetes.
- GBM basement membranes
- deficiencies in other components of the GBM e.g., laminin and agrin
- laminin and agrin can impair basement membranes, causing nephrotic disease.
- LAMB2 laminin beta2 gene
- Pierson syndrome a rare autosomal recessive disease characterized by renal failure from nephrotic syndrome and diffuse mesangial sclerosis (Bull et al, J Pathol., 2014, 233(1), 18-26).
- Laminin ⁇ 2 is one of the three chains of the heterotrimeric LAM-521 ( ⁇ 5 ⁇ 2 ⁇ 1), the major laminin heterotrimer in the mature GBM.
- Alport syndrome is an inherited disorder of glomerular basement membranes, resulting in progressive renal failure due to glomerulonephropathy. Alport syndrome typically presents in childhood as hematuria or proteinuria which may be associated with hearing loss and ocular dysfunction, and the disease gradually progresses to renal failure (such as end stage of renal disease (ESRD)) in adulthood. Renal biopsy test of patient's kidney confirms the absence of collagen IV alpha chains as well as pathological alterations of the GBM. Hearing loss and ESRD progress at near unity and the timing of stage of each symptom slightly varies per a genotype-phenotype correlation (see, e.g., Kashtan et al, J of Clinical Invest., 1999, 78, 1035- 1044).
- Ocular abnormalities have been observed in some Alport syndrome patients. Typical ocular associations are a dot-and-fleck retinopathy, which occurs in approximately 85% of affected adult males, anterior lenticonus, which occurs in approximately 25%, and rare posterior polymorphous corneal dystrophy. Govan et al described that anterior lenticonus (abnormal shape of lens) and retinal flecks in the macular and midperipheral retina as characteristic ophthalmic findings in Alport syndrome (Govan et al, Brit. J. Ophthal., 1983, 67: 493-503). The ocular manifestations were identical in the X-linked and autosomal forms of Alport syndrome. These abnormalities correlate with a defect in the collagen IV molecule.
- the ultrastructural features on kidney biopsy that are diagnostic of Alport syndrome consist of (i) irregular thickening and thinning of the glomerular basement membrane (GBM); (ii) splitting or lamellation of the GBM; (iii) 'basket weaving' of the GBM and (iv) foot process fusion in regions of an abnormal GBM.
- GBM glomerular basement membrane
- TBMN thin basement membrane nephropathy
- the collagen IV a3, a4, and a5 chains are absent biochemically from the GBM of patients with Alport syndrome.
- Alport Syndrome is genetically heterogeneous, caused by mutations in the genes encoding the a3, a4 or a5 chain of collagen IV (COL4A3, COL4A4 and/or COL4A5). Mutations in COL4A3 and COL4A4 cause autosomal recessive Alport syndrome which account for -15% of Alport syndrome, while the COL4A5 mutations cause X-linked Alport syndrome which account for the remaining 85%. Autosomal dominant inheritance is rare. Some examples of mutations in COL4A3, COL4A4 and COL4A5 that cause Alport syndrome are listed in Table 3. More mutations in COL4A5 may be found in the COL4A5 database
- Alport syndrome is also a feature of two other disorders caused by gene deletion involving COL4A5 gene: Alport syndrome and diffuse leiomyomatosis; and Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis.
- X-linked Alport syndrome eighty- five percent of Alport syndrome results from mutations in X-linked, COL4A5 gene encoding the a5-chain of collagen IV and is associated with hematuria, ocular abnormalities and high-tone sensorineural hearing loss. Nearly all affected males have decreased kidney function resulting in end-stage renal disease (ESRD) as early as the second decade of life. Affected females are too at risk for developing nephrotic syndrome, decreased kidney function and ESRD. Temporal macular thinning is also associated with XLAS (Ahmed et al, JAMA ophthalmol. 2013, 131(6), 777-782).
- GBM lamellation is usually widespread in men with XLAS.
- the GBM is initially thinned in boys, but there is focal lamellation that becomes more extensive with time.
- Immunostaining for the a3, a4 and a5 chains of collagen IV demonstrates the complete absence of these collagen chains in the GBM, distal tubular basement membrane (dTBM) and Bowman's capsule in essentially all males with XLAS, whereas women who are heterozygous carriers of XLAS demonstrate a segmental or 'mosaic' absence due to variable X- chromosome inactivation.
- These immunohistologic features help to distinguish XLAS from autosomal-recessive AS (ARAS), where expression of the a5 chain of collagen IV by immunostaining is negative in the GBM but positive in the dTBM and Bowman's capsule.
- the epidermal membrane of the skin also has no a5(IV) chain.
- deletions/insertions, rearrangements, nonsense mutations and other genetic changes are also reported.
- Some examples of the identified mutations include missense mutations (G123E, Guo et al, Mol Biol Rep. 2014, 4196, 3631-3635); G1205V); nonsense mutations (Q379X); missense mutations in the collagenous domain of COL4A5; hypomorphic mutations (G624D, P628L; Pierides A et al, Hippokratia, 2013, 17(3), 207-213); complex deletion/insertion mutations (c.359_363delGTATTinsATAC) in the COL4A5 gene (Wang et al, Gene, 2013, 512(2), 482- 485), mutations at splice sites; and deep intronic mutations in the COL4A5 gene (King K et al., Human Genet. 2002, 111, 548-554).
- Autosomal recessive Alport syndrome (ARAS): about fifteen percent of Alport syndrome results from autosomal recessive homozygous or compound heterozygous mutations in both copies (in trans) of COL4A3 or COL4A4 genes (Mochizuki T et al, Nat. Genet., 1994, 8, 77-81). Mutations in COL4A3 or COL4A4 genes include missense changes, frameshift changes, small deletions/insertions, duplications, intronic variants, splicing mutations and nonsense mutations.
- Autosomal dominant Alport Syndrome Autosomal dominant inheritance, resulting from heterozygous COL4A3 or COL4A4 variants, is very rare (van der Loop FT et al., Kidney to., 2000, 58, 1870-1875.)
- Treatments of Alport syndrome patients to date primarily address proteinuria, including calcineurin inhibition with cyclosporine (see, e.g., Sigmundsson et al, Scand J Urol Nephrol, 2006, 40, 522-525) and the blockage of the renin-angiotensin aldosterone system (RAAS) by angiotensin-converting enzyme (ACE) inhibitors, angiotensin receptor blockers (ARBs) and aldosterone inhibitors.
- ACE angiotensin-converting enzyme
- ARBs angiotensin receptor blockers
- aldosterone inhibitors Recent evidence has shown that it can significantly delay the time to onset of renal replacement therapy and ESRD (See e.g. Noone and Licht, Pediatr Nephrol 2013, 28, 1025-1036).
- ACE inhibitors that have been used to treat Alport Syndrome patients include, but are not limited to, enalapril, fosinopril, lisinopril, quinapril.
- ACE inhibitors are relatively well tolerated by most individuals. Nevertheless, they are not free of side effects, and some patients should not use ACE inhibitors. The most common side effects are cough, elevated blood potassium levels, low blood pressure, dizziness, headache, drowsiness, weakness, abnormal taste (metallic or salty taste), and rash.
- the most serious, but rare, side effects of ACE inhibitors are kidney failure, allergic reactions, a decrease in white blood cells, and swelling of tissues (angioedema).
- ARBs that have been used to treat Alport Syndrome patients include, but are not limited to, losartan and candesartan.
- vasopeptidase inhibitors e.g., AVE688
- HMG-CoA reductase inhibitors showed significant improvement in COL4A3-/- mice (Reviewed by Katayama et al., Searching for a treatment for Alport Syndrome using mouse models, World J Nephrol, 2014, 3(4): 230-236).
- chemokine receptor antagonists such as a CCR1 (chemokine (C-C motif) receptor 1) antagonist (e.g., BX471).
- microRNA regulation see, e.g., U.S. patent publication No. 20140100263; Gomez et al., Anti-microRNA-21 oligonucleotides prevent Alport nephropathy progression by stimulating metabolic pathways, J Clin Invest. 2015, 125(1): 141— 156); stem cells (see, e.g., U.S. patent publication No. 20090214488); collagen metalloprotease inhibitors (see, e.g., U.S. patent publication Nos. 20080187508; 20090318511; 20110112076; and 20110014186); targeted therapy such as RAC1/CDC42 inhibitors (see, e.g., PCT patent publication No. 2014028059) and collagen IV receptor integrin inhibitors (see, e.g., U.S. Pat No. 6,492,325); the content of each of which is herein incorporated by reference in their entirety.
- Some deficits in functional collagen IV protein may also be associated with, but not limited to, familial microhematuria with thin basement membranes; microhematuria; thin basement membrane nephropathy (TBMN); nephrotic-range proteinuria; progressive renal insufficiency; glomerular hematuria, heavy or mild proteinuria, and diabetic nephropathy (DN).
- TBMN thin basement membrane nephropathy
- DN diabetic nephropathy
- a rare autoimmune kidney disease called Goodpasture syndrome (also known as anti- glomerular basement antibody disease) is mediated by autoantibodies against the NC 1 domain of the a3(IV) chain.
- the binding of autoantibodies usually cause rapidly progressive
- nephritic GBM is more permeable to large molecules than the normal GBM (Farquhar and Palade, J Exp Med., 1061, 114, 699-716).
- a study (Schneeberger et al, J Exp Med., 1974, 139(5), 1283-1302) has shown that gamma globulin in the blood, injected horse radish peroxidase and catalase (about 240 kDa), and ferritin (480 kDa) can penetrate into renal glomerulus in a rat model of autologous immune complex (AIC) nephritis.
- AIC autologous immune complex
- Fujigaki also demonstrated that ferritin-anti-ferritin immune complexes can translocate across the GBM in nephritis rats (Fujigaki et al, Am Jpathol., 1993, 142(3), 831- 842). It is further shown that the penetrated ferritin can be retained in the GBM for about 3 days. The increased permeability of the GBM could enhance the penetration of large molecules through the GBM. Collagen IV ( ⁇ 3- ⁇ 4- ⁇ 5) protomers are about 480KDa and it is assumed that molecules around this size may be readily enter the nephritic GBM, such as the impaired GBM in Alport syndrome.
- recombinant collagen IV molecules are systemically or locally delivered to a subject with the defective GBM equivalent to that in Alport syndrome. It is found that recombinant collagen IV can be transported to the GBM, where they form correct networks and interact with other components of the GBM, restoring the structure of the GBM and virtually the filtering function of the GBM in the kidney.
- the present invention provides methods for treating diseases characterized by one or more collagen IV deficiencies by adding recombinant collagen IV protein back to the body, in particular, the glomerular basement membrane in the kidney.
- the collagen IV replacement will be embedded into affected GBM and restore their functions.
- the invention relates to Alport syndrome caused by mutations in COL4A3, COL4A4 and COL4A5 genes which encode the a3(IV), a4(IV) and a5(IV) chain polypeptides.
- the recombinant collagen IV protein may be protomers, dimers tetramers, and multimers, and the mixture thereof.
- a collagen IV protomer in accordance with the present invention is a heterotrimer of collagen IV ⁇ 3- ⁇ 4 - ⁇ 5, the heterotrimer mainly found in the glomerular basement membrane. Additionally a collagen IV protomer may be a heterotrimer of the chimeric a3(IV), a4(IV) and a5(IV) chains in each of which all or part of the NCI domain is replaced with all or part of the NCI domain of al(IV) and a2(IV) chains.
- the recombinant collagen IV protein of the present invention may be formulated as a pharmaceutical composition with other suitable excipients. Such pharmaceutical compositions are discussed below.
- the recombinant collagen IV is recombinant human collagen IV.
- compositions comprising recombinant collagen IV protomers, dimers, tetramers, multimers and/or the mixture thereof and pharmaceutically acceptable excipients.
- Such pharmaceutical compositions are suitable for administration and/or injection into a human patient in need thereof.
- Such compositions are often formulated as to permit the active ingredients (i.e. recombinant collagen IV) to be effective, and which contains no additional components which are toxic to the subjects to which the formulation would be administered.
- the active ingredients are collagen IV protomers, dimers, tetramers, multimers and/or the mixture thereof.
- the collagen IV is a procollagen comprising three a chain polypeptides selected from the group consisting of al(IV), a2(IV), a3(IV), a4(IV), a5(IV), and a6(IV), wherein each a chain is encoded by gene COL4A1, COL4A2, COL4A3, COL4A4, COL4A5, and COL4A6.
- said collagen IV protomer is a heterotrimer of one a3(IV) chain polypeptide, one a4(IV) chain polypeptide and one a5(IV) chain polypeptide, wherein the a3(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 3 and/or variants thereof; the a4(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 4 and/or variants thereof; and the a5(IV) chain polypeptide comprises the amino acid sequence of SEQ ID NO. 5 and/or variants thereof.
- the recombinant collagen IV may comprise chimeric a(IV) polypeptides, in particular, chimeric a3(IV), a4(IV) and a(5) polypeptides.
- APTN Alport post-transplant nephritis
- the alloantibodies in patients target alloepitopes within the NCI domain of the a3(IV) chain and/or alloepitopes that depend on the quaternary structure of the NCI hexamers of collage IV ⁇ 3- ⁇ 4- ⁇ 5 protomer (Olaru et al, J Am Soc Nephrol.
- NCI domains of collagen IV ⁇ 3- ⁇ 4- ⁇ 5 are the main autoantigens in Goodpasture syndrome, a rapidly progressive renal disease with lung hemorrhage. It is expected that the substitutes of the NCI domains of the a3(IV), a4(IV) and/or a(5) chains will reduce the autoimmune reaction induced by the administration of the recombinant collagen IV.
- said collagen IV protomer is a heterotrimer comprising one, two or three chimeric collagen IV a polypeptides selected from the chimeric a3(IV), a4(VI) and a5(IV) polypeptides.
- a chimeric a3(IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- a chimeric a4(IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the a4(IV) chain is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- a chimeric a5(IV) chain polypeptide is a chimeric polypeptide in which all or part of the NCI domain of the a5(IV) chain is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- a recombinant collagen IV protomer comprises one chimeric a3(IV) chain polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced by all or part of the NCI domain of the al(IV) chain polypeptide, one a4(IV) chain polypeptide and one a5(IV) chain polypeptide, wherein the three polypeptides form a triple helix.
- a recombinant collagen IV protomer may comprise one chimeric a3(IV) chain polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced by all or part of the NCI domain of the al(IV) chain polypeptide, one chimeric a4(IV) chain polypeptide in which all or part of the NCI domain of the a4(IV) chain is replaced by all or part of the NCI domain of the a2(IV) chain polypeptide, and one chimeric a5(IV) chain polypeptide in which all or part of the NCI domain of the a5(IV) chain is replaced by all or part of the NCI domain of the l(IV) chain polypeptide, wherein the three polypeptides form a triple helix.
- said collagen IV protein of the present invention may be a dimer comprising two collagen IV protomer as disclosed above.
- two collagen IV protomers disclosed in the present invention may be dimerized via enzymatic and/or chemical dimerization, or through non-covalent association.
- the collagen IV protein used for the present invention may contain certain percentage of 3-hydroxyproline, 4-hydroxyproline and/or lysyl hydroxylysine residues.
- the collagen IV protein may contain about 6.5% to about 14% of 4- hydroxyprolines (i.e. between 65-140 4-hydroxyproline residues/1000 AA) and/or about 0.3% to about 1.6% of 3-hydroxyprolines (i.e. between 6-16 3-hydroxyproline residues/1000 AA).
- said collagen IV protein is human collagen IV protein.
- Collagen IV used for treatment/replacement may be obtained from a variety of sources, including extraction and purification from tissues that contain collagen IV (e.g. human and other mammals). Collagen IV may also be produced via genetic engineering such as recombinant collagen IV, particularly human recombinant collagen IV.
- the collagen IV protein including collagen IV ⁇ 3- ⁇ 4- ⁇ 5 and/ or chimeric collagen IV protomers, dimers, tetramers, multimers and/or the mixture thereof, is formulated as pharmaceutical compositions.
- Said pharmaceutical compositions comprising recombinant collagen IV are suitable to administering to a subject in need, such as an Alport syndrome patient.
- Collagen IV protomers, dimers, multimers and/or the mixture thereof can be extracted from collagen IV containing tissues, such as basement membranes, placenta, eye lens, etc.
- collagen preparation methods involve extraction with diluted organic acids, precipitation with salts, optional gelation and/or lyophilization, tangential filtration and purification, etc. (see, e.g., U.S. Pat. Nos. 4,148,664; 5,028,695; 5,670,369; 5,814,328;
- collagen IV-containing tissues refers to any tissue that contains collagen IV, including but not limited to tendon, skin, cornea, bone, cartilage, teeth, intervertebral disc, fetal skin, cardiovascular system, basement membrane, placenta, eye lens and anchoring fibrils beneath any epithelia.
- Collagen IV is most abundantly in the epithelial and endothelial basal lamina, glomerular basement membranes, fetal membranes, blood vessels, placental basement membrane. It may also be found in small amounts in other tissues.
- U.S. Pat. No. 5,436,135 describes an extraction process of collagen IV from human and/or animal placenta. Said method combines enzymatic digestion (e.g. pepsin) and acid pH treatment, and can extract uncontaminated collagen type IV with very high efficiency; the content of which is herein incorporated by reference in its entirety.
- US Pat. No. 7,396,912 described a method for extracting collagen from tissues using fermentation.
- Microorganisms such as bacteria, yeast are provided to the collagen containing tissues to ferment the tissues.
- Collagens extracted via fermentation have an increased purity, comprising mostly of well-preserved collagen monomers with natural configurations; the content of which is incorporated by reference in its entirety.
- US Pat. No. 7,741,441 describes methods for extracting collagen IV from lens capsule without contamination by other proteins and without degradation or denaturation. Such methods involve in using aqueous acid solution to extract collagen IV content from lens capsule without using enzyme treatment, the content of which is hereby incorporated by reference in its entirety.
- collagen producing cells such as fibroblast cells may be used to express collagen IV. It is discussed in the art that collagen producing cells (e.g., fibroblast cells) may be stimulated with different agents to increase collagen expression/synthesis, including collagen IV. See, e.g., PCT patent publication No. WO1995031473; WO2008070893 and WO2008070892, the content of each of which is incorporated by reference in their entirety.
- Recombinant technologies may also be used to produce recombinant human collagen IV.
- Recombinant collagen IV may be produced by culturing suitable host cells to express the recombinant DNA encoding the same, which may be purified from culture media since collagen IV is secreted outside of cells.
- suitable host cells to express the recombinant DNA encoding the same, which may be purified from culture media since collagen IV is secreted outside of cells.
- Various mammalian cell lines may be employed to express recombinant collagen IV because mammalian secretory pathways are known to facilitate the assembly and folding of biologically active proteins.
- Other hosts such as yeast cells, plant cells, insect cells and/ or bacteria may also be used to produce recombinant collagen IV protein of the present invention.
- Nucleic acids that encode collagen IV a chain polypeptides may be cloned into any expression vectors that are suitable for expressing proteins.
- the general nature of the vectors is not crucial to collagen IV production in accordance with the present invention.
- suitable expression vectors and expression constructs will be apparent to those skilled in the art.
- Suitable expression vectors may be based on plasmid and phages which may be either host specific, or engineered for other hosts of interest.
- Other suitable vectors may include cosmids, retroviruses, and many other vehicles.
- Other control and regulatory sequences such as promoter, operators, inducer, terminator and other sequences will be apparent to those skilled in the art.
- the vectors and constructs for producing recombinant collagen IV may be modified and/or engineered in any suitable manner. Suitable vectors may be selected as a matter of course by those skilled in the art according to the desired expression system. [000170] Many methods well known in the art can be used to produce the collagen IV a chain polypeptides of the present invention. As a non-limiting example, one straightforward method may include steps of obtaining the nucleic acids encoding the collagen IV a chain polypeptides, inserting them into a suitable expression vector (e.g. plasmids), transforming a suitable host (e.g. mammalian cell lines), culturing the transformed host, and obtaining the polypeptide of the invention by any suitable means, such as fragmentation and centrifugation.
- a suitable expression vector e.g. plasmids
- transforming a suitable host e.g. mammalian cell lines
- culturing the transformed host e.g. mammalian cell lines
- said three collagen IV a chain polypeptides may be inserted into a common vector. In other aspects, said three collagen IV a chain polypeptides may be inserted to separate vectors and then co-transformed into a host to express simultaneously.
- recombinant collagen IV may be produced in eukaryotic expression system including mammalian cells and glycoengineered yeast cells.
- mammalian cells and glycoengineered yeast cells include mammalian cells and glycoengineered yeast cells.
- CHO cell lines are of choice because they offer well-characterized, selectable and amplifiable gene expression systems which facilitate high level protein
- CHO cells and recombinant proteins expressed in them have been extensively characterized and have been approved for use in clinical manufacturing by regulatory agencies.
- HEK293 cells human embryonic kidney cell line 293 (HEK293 cells), human fibroblasts.
- HEK 293 cells may be stably transfected with vectors that express a3(IV), a4(IV), and a5(IV) chain polypeptides.
- Cell extracts and culture media of these transfected cells may be used to detect the assembly of collagen heterotrimers, for example via co-immmunoprecipitation of a3(IV), a4(IV), and a5(IV) chain polypeptides (e.g., Kobayashi et al, Kidney International., 2003, 64(6), 1986-1996; and Kobayashi and Uchiyama, Biomed Res., 2010, 31(6), 371-377).
- cells cultured in a vitamin C-free medium produce the single-chain collagen IV a polypeptide in a much larger amount than that of the type IV collagen protein (see Yoshikawa, K. et al, J. Biochem., 2001, 129, 929-936).
- cells may be transfected with a single construct comprising a single a chain polypeptide such as a3 chain, and cultured in vitamin C free medium to produce a3 chain polypeptide only.
- a3 chain may be mixed with other two a chain polypeptides or chimeric polypeptides (i.e. a4 and a5) produced by the same way, to form the collagen IV heterotrimer.
- Cultures suitable for any living cells may be useful for cultures of the present invention.
- Culture system may vary from prokaryotic expression systems (e.g., E. coli cells) up to eukaryotic expression systems (e.g., CHO cells and HEK293 cells).
- Escherichia coli may be used to express recombinant expression of hydroxylated human collagen IV.
- the characterization of new prolyl and lysyl hydroxylase genes encoded by the giant virus mimivirus reveals a method for production of hydroxylated collagen.
- the coexpression of a human collagen type IV construct together with mimivirus prolyl and lysyl hydroxylases in Escherichia coli may produce hydroxylated collagen IV.
- the respective levels of prolyl and lysyl hydroxylation may be similar to the hydroxylation levels of native human collagen type IV.
- the distribution of hydroxyproline and hydroxylysine along recombinant collagen IV may also be similar to that of native collagen as determined by mass spectrometric analysis.
- host cells that are defective in native collagen IV expression, or expression of other collagens, either artificially or naturally, may be used to produce
- Collagen IV synthesis involves many unusual co-translational and post-translational modifications, as discussed above, including the formation of 4-hydroxyproline, 3- hydroxyproline, and hydroxylysine in - -Pro-Gly-, -Pro-4Hyp-Gly-, and -X-Lys-Gly-sequences, respectively.
- cells used to produce recombinant collagen IV protein may be engineered to express collagen prolyl 4-hydroxylases (P4Hs), prolyl 3 -hydroxylases (P3Hs), and/or lysyl hydroxylases (LHs).
- cells used to produce recombinant collagen IV may be co-transfected with constructs that contain nucleic acid sequences encoding prolyl-3 hydroxylase (P3H) and recombinant collagen IV a chains, respectively.
- the P3H will increase the content of 3- hydroxyproline of recombinant collagen IV, wherein the higher numbers of 3 -hydroxyproline residues of recombinant collagen IV can reduce platelet induced aggregation.
- cells used to produce recombinant collagen IV may be co-transfected with constructs that contain nucleic acid sequences encoding prolyl-4 hydroxylase (P4H) and recombinant collagen IV a chains, respectively.
- the P4H will increase the content of 4-hydroxyproline of recombinant collagen IV, wherein the higher content of 4-hydroxyproline residues of recombinant collagen IV will increase collagen thermal stability and/or decrease susceptibility to proteolytic digestion.
- cells used to produce recombinant collagen IV may be co- transfected with constructs that contain nucleic acid sequences encoding lysyl hydroxylases (LH) and recombinant collagen IV a chains, respectively.
- LH lysyl hydroxylases
- the LH will increase the content of lysyl hydroxylysine of recombinant collagen IV, wherein the higher content of lysyl hydroxylysine residues of recombinant collagen IV will further increase the stability and provide sites for glycosylation modification.
- Peroxidasin an enzyme found in basement membranes, catalyzes formation of the sulfilimine bond (Bhave et al, Nature Chem. Biol, 2012, 8, 784-790).
- collagen IV protomers may be used as the active ingredients of the pharmaceutical compositions given its relative small size.
- cells used to produce recombinant collagen IV may be engineered to deplete peroxidasin, therefore preventing dimerization of collagen IV protomers.
- a peroxidasin inhibitor may be applied to the host cells to prevent the formation of the sulfilimine bonds during recombinant collagen IV protomer synthesis.
- the peroxidasin inhibitor may be a nucleic acid such as a siRNA or antisense nucleic acid that inhibits synthesis of peroxidasin; an antibody that binds specifically to peroxidasin; a peptide that is a fragment of peroxidasin or a peroxidasin substrate, a small molecule, and/or an anion such as iodide or thiocyanate.
- Inhibition of peroxidasin may also occur by removal of bromide in cultured cells or by application of a neutralizer of hypochlorous acid and/or hypobromous acid such as taurine.
- such cell systems may be used to produce the chimeric a(IV) chain polypeptides selected from the chimeric a3(IV), a4(VI) and a5(IV) polypeptides.
- the chimeric a3(IV) chain polypeptide may be encoded by a chimeric cDNA in which a nucleic acid sequence that encodes the amino acid sequence of all or part of the NCI domain of the a3(IV) chain is replaced with a nucleic acid sequence that encodes the amino acid sequence of all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- the chimeric a4(IV) chain polypeptide may be encoded by a chimeric cDNA in which a nucleic acid sequence that encodes the amino acid sequence of all or part of the NC 1 domain of the a4(IV) chain is replaced with a nucleic acid sequence that encodes the amino acid sequence of all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- the chimeric a5(IV) chain polypeptide may be encoded by a chimeric cDNA in which a nucleic acid sequence that encodes the amino acid sequence of all or part of the NCI domain of the a5(IV) chain is replaced with a nucleic acid sequence that encodes the amino acid sequence of all or part of the NCI domain of the al(IV) and/or a2(IV) chains.
- said chimeric cDNAs encoding chimeric a(IV) polypeptides may be codon optimized for expression in mammalian cells, bacteria, insects, plant cells and/or yeast. Codon optimization is well known in the art for optimizing expression of recombinant polypeptides.
- Said chimeric cDNAs may be transfected into mammalian cells, bacteria, insect cells, plant cells and/or yeast to produce chimeric a(IV) polypeptides.
- transformed host cells, bacteria, insects, plant cells and/or yeasts that contain the chimeric cDNA encoding chimeric a(IV) polypeptides.
- the recombinant collagen IV protein of the present invention may further contain non-natural amino acids and/or other amino acid substitutes, such as those that may enhance the stability of a polypeptide.
- compositions of the present invention may further comprise other pharmaceutically acceptable excipients.
- pharmaceutically acceptable excipient refers to any ingredient having no therapeutic activity and having acceptable toxicity such as buffers, solvents, tonicity agents, stabilizers, antioxidants, surfactants or polymers used in formulating pharmaceutical products. They are generally safe for administering to humans according to established governmental standards, including those promulgated by the United States Food and Drug Administration.
- Buffers encompasses those agents which maintain the solution pH in an acceptable range.
- a buffer is an aqueous solution consisting of a mixture of a weak acid and its conjugate base or a weak base and its conjugate acid. Its pH changes very little when a small amount of strong acid or base is added to it and thus it is used to prevent any change in the pH of a solution. Buffer solutions are used in collagen IV protein formulations as a means of keeping proteins stable within a narrow pH range.
- a buffer can stabilize the pH of a pharmaceutical composition.
- Suitable buffers are well known in the art and can be found in the literature.
- Preferred pharmaceutically acceptable buffers comprise, but are not limited to, fiistidine-buffers, arginine-buffers, citrate-buffers, succinate-buffers, acetate-buffers and phosphate -buffers or mixtures thereof.
- Most preferred buffers comprise citrate, L-arginine, L-histidine or mixtures of L-histidine and L-histidine hydrochloride.
- Other preferred buffer is acetate buffer.
- the pH can be adjusted with an acid or a base known in the art, e.g. hydrochloric acid, acetic acid, phosphoric acid, sulfuric acid and citric acid, sodium hydroxide and potassium hydroxide. The pH is adjusted in range to provide acceptable stability, to maintain the solubility and
- the pH may be from about pH 4 to about pH 7.0, or about pH 5 to about pH 6, such as about pH 5, about pH 5.5, about pH 6, about pH 6.5, or about pH 7.0.
- Tonicity agents recites pharmaceutically acceptable excipient used to modulate the tonicity of a pharmaceutical composition and formulation.
- Tonicity in general relates to the osmotic pressure of a solution usually relative to that of human blood serum.
- Osmotic pressure is the pressure that must be applied to a solution to prevent the inward flow of water across a semi-permeable membrane.
- Osmotic pressure and tonicity are influenced only by solutes that cannot cross the membrane, as only these exert an osmotic pressure.
- a formulation can be hypotonic, isotonic or hypertonic, but is typically preferably isotonic.
- An isotonic formulation is liquid or liquid reconstituted from a solid form, e.g. from a lyophilized form and denotes a solution having the same tonicity as some other solution with which it is compared, such as physiologic salt solution and the blood serum.
- Tonicity agent excipients are added to injectable, ocular or nasal preparations to reduce local irritation by preventing osmotic shock at the site of application.
- many injectable dosage forms must have the same salt (isotonic) concentration as the normal cells of the body and the blood.
- Suitable tonicity agents include sugars, salts and amino acids.
- Some examples of tonicity agents include, but are not limited to, corn syrup, hydrous dextrose, anhydrous dextrose, trehalose, sucrose, glycerin, arginine, mannitol, potassium chloride and sodium chloride.
- sugar denotes a monosaccharide or an oligosaccharide, which is water soluble.
- a monosaccharide is a monomeric carbohydrate which is not
- oligosaccharide hydro lysable by acids, including simple sugars and their derivatives.
- monosaccharides include glucose, fructose, galactose, mannose, sorbose, ribose, deoxyribose, neuraminic acid.
- An oligosaccharide is a carbohydrate consisting of more than one monomeric saccharide unit connected via glycosidic bond(s) either branched or in a chain. The monomeric saccharide units within an oligosaccharide can be identical or different. Examples of
- oligosaccharides include sucrose, trehalose, lactose, maltose and raffinose.
- amino acid in context with tonicity agent or stabilizer, denotes a pharmaceutically acceptable organic molecule possessing an amino moiety located at an exposition to a carboxylic group.
- amino acids include arginine, glycine, ornithine, lysine, histidine, glutamic acid, asparagic acid, isoleucine, leucine, alanine, phenylalanine, tyrosine, tryptophane, methionine, serine, proline.
- Preferred amino acid in context with tonicity agent or stabilizer is arginine, tryptophane, methionine, histidine or glycine.
- arginine is a protein solubilizer and also a stabilizer that reduces collagen IV aggregation.
- Inorganic salts are effective tonicity agents and also commonly used as protein stabilizers.
- Inorganic salts may include, but are not limited to, sodium chloride (NaCl), sodium sulfate (Na 2 S0 4 ), sodium thiocyanate (NaSCN), magnesium chloride (MgCk), magnesium sulfate (MgS0 4 ), ammonium thiocyanate (NH 4 SCN), ammonium sulfate ((NH 4 ) 2 S0 4 ), ammonium chloride (NH 4 C1), calcium chloride (CaCk), calcium sulfate (CaS0 4 ), zinc chloride (ZnCk) and the like, or combinations thereof.
- the collagen IV formulations are non-salt formulations in which inorganic salts are substantially excluded from addition to the formulations described herein. These non-salt formulations may maintain the osmolality of the collagen IV formulations with increased stability, and reduced phase change, such as precipitation or aggregation. It will be understood by those skilled in the art that the presence of inorganic salts within the presently disclosed formulations that are introduced by pH adjustment are not considered to be added inorganic salts.
- the pharmaceutical compositions comprising collagen IV protein may be in any of a variety of physiologically acceptable salt forms, and/or with an acceptable pharmaceutical carrier and/or additives.
- Pharmaceutically acceptable salts include, e.g., acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esyiate, fumarate, gluceptate, gluconate, glutamate, glycollyiarsanilate, hexyiresorcinate, hydrabamine, hydrobromide, hydrochloride,
- Pharmaceutically acceptable salts also include those salts described in, e.g., Berge
- the collagen IV composition may further comprise mannitol as an isotonicity agent.
- the mannitol concentration is in the range of about 3.0 to about 6.3% w/v.
- Surfactant may be used to protect protein formulations against mechanical stresses like agitation and shearing without causing denaturation of the collagen IV protein, and also to reduce the adsorption on the surfaces during processing and storage.
- Surfactants may include, but are not limited to, poloxamers, polysorbates, polyoxyethylene alkyl ethers (Brij), alkylphenylpolyoxyethylene ethers (Triton-X) or sodium dodecyl sulphate (SDS).
- Preferred surfactants are polysorbates and poloxamers.
- Polysorbates are oleate esters of sorbitol and its anhydrides, typically copolymerized with ethylene oxide.
- Commonly used polysorbates including Polysorbate 20 (poly(ethylene oxide) (20) sorbitan monolaurate, Tween 20) or Polysorbate 80 (poly(ethylene oxide) (80) sorbitan monolaurate, Tween 80), and Pluronic® polyols, can stabilize protein during processing and storage by reducing interfacial interaction and prevent protein from adsorption.
- the collagen IV compositions may further comprise polysorbate-80 as a solubilizer and/or stabilizer.
- concentration of polysorbate-80 is in the range of about 0.01 to 0.05% (w/v) (or expressed in terms of mg/ml, about 0.1 to 0.5 mg/mL). This concentration of polysorbate-80 is determined in combination with the collagen IV protein and mannitol to minimize the formation of soluble aggregates and insoluble particles.
- Poloxamer means non-ionic triblock copolymers composed of a central hydrophobic chain of polypropylene oxide) (PPO) flanked by two hydrophilic chains of poly(ethylene oxide) (PEO), each PPO or PEO chain can be of different molecular weights.
- PPO polypropylene oxide
- PEO poly(ethylene oxide)
- Amounts of surfactants effective to provide stable high concentration collagen IV formulations are usually in the range of about 50 ppm to about 200 ppm.
- the collagen IV protein formulations of the present invention include, without limitation, formulations having one or more non-ionic surfactant(s) including, for example, one or more polysorbate(s), such as polysorbate 20 or 80; one or more polyoxamers, such as poloxamer 184 or 188; one or more Pluronic® polyol(s); and/or one or more ethylene/polypropylene block polymer(s).
- a polysorbate such as polysorbate 20 (Tween 20) or polysorbate 80 (Tween 80).
- Antioxidant may be used to prevent oxidation of the active
- chelating agents include, but are not limited to, EDTA, citric acid, ascorbic acid, butylated hydroxytoluene (BHT), butylated hydroxy anisole (BHA), sodium sulfite, /?-amino benzoic acid, glutathione, propyl gallate, cysteine, methionine, ethanol and N-acetyl cysteine.
- metal chelators such as EDTA, ALA, BAPTA, EGTA, DTP A and DMSA may be used to inhibit lysyl oxidase mediated collagen IV cross-linking among collagen IV protomers, dimers and/or multimers.
- Collagen IV proteins may be produced as powder, suitable for solution and infusion, or formulated as solutions suitable for injection and other administration routes of such collagen IV proteins.
- the pharmaceutical composition of the present invention may contain a high concentration of collagen IV protein without loss of the stability of recombinant protein.
- Standard pharmaceutical formulation techniques are well known to those skilled in the art ⁇ see, e.g., 2005, Physicians' Desk Reference®, Thomson Healthcare: Montvale, NJ, 2004; Remington: The Science and Practice of Pharmacy, 20th ed., Gennado et al., Eds. Lippincott Williams & Wilkins: Philadelphia, PA, 2000).
- Suitable pharmaceutical additives include those discussed above, e.g., mannitol, starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, and the like.
- the compositions may also contain pH buffering reagents and wetting or emulsifying agents.
- the compositions may or may not contain preservatives.
- compositions may vary depending on the intended routes of administration and other parameters (see, e.g., Rowe et al., Handbook of
- the composition may be a sterile, non-pyrogenic, white to off-white lyophilized cake or powder to be administered by intravenous injection upon reconstitution with sterile water for injection.
- the formulation itself may be a sterile, non-pyrogenic solution.
- Lyophilized formulation In some embodiments, the pharmaceutical composition of the present invention may be formulated as lyophilized mixture, in the presence of lyoprotectant.
- the pharmaceutical composition of the present invention may be encapsulated in biodegradable polymers.
- Aqueous formulation refers to a solution or liquid preparation that contains collagen IV protein in combination with one or more excipients (e.g., chemical additives) dissolved in a suitable solvent.
- the collagen IV composition may be formulated as stable aqueous formulation comprising an effective amount of soluble collagen IV protein, a buffer such as a citrate- phosphate or citrate buffer with a desired pH, sucrose or trehalose, sodium chloride and either L- histidine or L- aspartic acid.
- formulations of collagen IV protein may contain, among others, excipients which inhibit adsorption, prevent oxidation, maintain pH, stabilize the collagen IV protein and control the osmolality of the pharmaceutical composition.
- excipients that stabilize collagen IV can be chosen on the basis of the mechanisms by which they stabilize proteins against various chemical and physical stresses that could occur during a manufacturing process, under particular storage conditions, or associated with a particular mode of
- the concentration or amount of an excipient to use in a formulation will vary depending on, for example, the amount of collagen IV protein included in the formulation, the amount of other excipients included in the desired formulation, the amount or volume of other components in the formulation and the desired tonicity or osmolality that is desired to be achieved.
- different types of excipients can be combined in a single formulation.
- a single formulation can contain a single excipient, two, three or more different types of excipients.
- the use of excipients in liquid formulations is an established practice to stabilize proteins against degradation or aggregation processes attributed for instance, to stresses that occur during manufacturing, shipping, storage, pre-use preparation, or
- the presence of a particular excipient in a formulation may have more than one effect or purpose.
- the collagen IV protein formulation of the present invention comprises collagen IV protomer, dimer, tetramer, multimer and/or the mixture thereof, wherein the collagen IV protomer is a heterotrimer comprising three a chain polypeptides selected from collagen IV al, a2, a3, a4, a5 and a6 chains.
- said collagen IV protomer is a heterotrimer consisting of one a3 chain, one a4 chain and one a5 chain
- the collagen IV formulations contain recombinant collagen IV protein comprising ⁇ 3 (IV) chain polypeptide comprising the amino acid sequence of SEQ ID NO. 3 and/or variants thereof, ⁇ 4 (IV) chain polypeptide comprising the amino acid sequence of SEQ ID NO.4 and/or variants thereof, ⁇ 5 (IV) chain polypeptide comprising the amino acid sequence of SEQ ID NO. 5 and/or variants thereof.
- the collagen IV formulations contain collagen IV protein comprising chimeric ⁇ (IV) chain polypeptides selected from chimeric ⁇ 3 (IV) chain polypeptide, chimeric ⁇ 4 (IV) chain polypeptide and chimeric ⁇ 5 (IV) chain polypeptide.
- a collagen IV protein formulation in accordance with the present invention may contain a pharmaceutically effective amount of collagen IV protein (e.g. recombinant human collagen IV protein), suitable concentration of a non-ionic surfactant, one or more amino acids selected from histidine, arginine, lysine, glycine and alanine, polysorbate-80, and/or one or more sugars selected from selected from mannitol, dextrose, glucose, trehalose and sucrose, wherein the concentration of collagen IV protein is from about 10 ng/ml to about 10 mg/ml, and wherein said collagen IV protein formulation has a pH of pH 4.5 to pH 6.5 and wherein said collagen IV protein formulation contains substantially no inorganic salt.
- collagen IV protein e.g. recombinant human collagen IV protein
- suitable concentration of a non-ionic surfactant e.g. a non-ionic surfactant
- one or more amino acids selected from histidine, arginine, lysine,
- the collagen IV formulations may further include a metal chelator such as EDTA to inhibit cross linking of collagen IV protomers, dimers, multimers and the mixture thereof.
- a metal chelator such as EDTA to inhibit cross linking of collagen IV protomers, dimers, multimers and the mixture thereof.
- formulations may be administered to a patient in need by intravenous injection, and/or other systemic or local administrations, such as intramuscular, subcutaneous, intracerebral, intracerebral ventricular, intracranial, intraocular, intra-aural delivery and delivery by acutely or chronically placed catheters.
- intravenous injection and/or other systemic or local administrations, such as intramuscular, subcutaneous, intracerebral, intracerebral ventricular, intracranial, intraocular, intra-aural delivery and delivery by acutely or chronically placed catheters.
- the administration route of the pharmaceutical compositions of the present invention is preferably a parenteral route including intravenous, subcutaneous, intraperitoneal, and intramuscular routes. Intravenous administration is preferred.
- implants and transdermal patches may be used, or an active compound may be prepared using a controlled-release preparation (see Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson ed., Marcel Dekker, Inc., New York, 1978) including microcapsule delivery systems.
- a biodegradable or biocompatible polymer can be used, such as ethylene -vinyl acetate, polyethylene glycol (PEG), polyanhydride, polyglycolic acid, collagen, polyorthoester, or polylactic acid.
- the dosage form of the pharmaceutical composition is not particularly limited.
- the pharmaceutical drug is, for example, in any of liquid, semisolid, and solid dosage forms. Specific examples thereof include solutions (e.g., injectable solutions and insoluble solutions), dispersions, suspensions, tablets, pills, powders, liposomes, and nanoparticles.
- the dosage form is appropriately selected according to an administration route or indications.
- An injectable dosage form is preferred.
- Examples of preferable composition of the injectable dosage form include dosage forms of injectable solutions or insoluble solutions and specifically include those suitable for intravenous, subcutaneous, and intramuscular injection, preferably intravenous injection.
- compositions of the present invention can be in any of solution, microemulsion, dispersion, liposome forms and nanoparticles, and other forms suitable for administration without limitations as long as the pharmaceutical drug is sterile and stable under production and storage conditions.
- the collagen IV protomer, dimer, tetramer, multimer, and/or mixtures thereof, is incorporated in a necessary amount of an appropriate solvent, if necessary together with one or the combination of the ingredients listed above. Subsequently, the mixture can be sterilized by filtration to prepare an injectable sterile solution.
- the pharmaceutical compositions are incorporated in a sterile medium containing a basic dispersion medium and necessary additional ingredient(s) listed above to prepare a dispersion.
- a sterile powder for preparing the injectable sterile solution a preferable preparation method involves obtaining, by vacuum drying and freeze drying, a powder of an active ingredient with arbitrary desired additional ingredients from the solution already sterilized by filtration.
- a particle size necessary for a dispersion can be maintained by use of a coating agent such as lecithin, while the appropriate flowability of a solution can be maintained by use of a surfactant.
- Absorption-delaying agents such as mono-stearate and gelatin can be contained in the composition and thereby achieve the sustained absorption of the injectable composition.
- a single dose for administration is not particularly limited and can be selected appropriately according to the purpose.
- the single dose is usually about 10 ng/kg to about 250 mg/kg, more preferably about 10 ng/kg to about 1 ⁇ g/kg, or about 100 ng/kg to about 100 ⁇ g/kg, or about 1 ⁇ g/kg to about 1 mg/kg, or about 10 ng/kg to about 50 mg/kg, or about 1 mg/kg to about 100 mg/kg, or about 10 mg/kg to about 50 mg/kg, particularly preferably approximately about 5 mg/kg to about 10 mg/kg.
- the single dose is about 0.1 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 3.5 mg/kg, about 4 mg/kg, about 4.5mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, or about 20 mg/kg.
- the term "about" when referring to a measurable value such as a drug dose is meant to encompass variations of ⁇ 20% or ⁇ 10%, more preferably ⁇ 5%, even more preferably ⁇ 1 %, and still more preferably ⁇ 0.1 % from the specified amount, as such variations are appropriate to the disclosed compositions.
- the dose can be adjusted for each administration according to a symptom to be treated. Alternatively, a dose that falls outside this range may be applied in consideration of the symptom, general status, route of administration, etc. of a patient.
- the administration schedule of the pharmaceutical compositions may be any of single- dose administration and continuous administration.
- compositions of the present invention may be used in combination with one or more additional pharmaceutical medications.
- the pharmaceutical medications to be combined therewith are appropriately selected in consideration of symptoms or adverse reaction.
- such combined use also includes the administration of the
- composition of the present invention are appropriately selected according to symptoms.
- medications include, but are not limited to, anti-thrombotic agents, antiinflammatory agents, and/or histamine antagonist.
- the dosage form, administration route, dose, and administration schedule of the pharmaceutical medication used as a pharmaceutical drug or a pharmaceutical composition for prevention are the same as in use for treatment.
- the data obtained from in vitro assays and animal studies, for example, can be used in formulating a range of dosage for use in humans.
- the dosage of such compositions lies preferably within a range of circulating concentrations that include the ED50 with low, little, or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- the therapeutically effective dose of the pharmaceutical compositions can be estimated initially from in vitro assays.
- a dose may be formulated in mouse models to achieve a circulating plasma concentration range that includes that required to achieve a half-maximal inhibition of symptoms. Protein levels in plasma may be measured, for example, by ELISA, immuno-blot, mass spectrometry, etc.
- the effects of any particular dosage can be monitored by a suitable bioassay of endpoints.
- the pharmaceutical compositions of the present invention may be administered at a dose of approximately from about 1.0 ng/kg to about 500 mg/kg, depending on the severity of the symptoms and the progression of the renal pathology.
- the pharmaceutical compositions may be administered by slow intravenous infusion in an outpatient setting every, e.g., 1, 2, 3, 4, 5, or more days, or by, e.g., weekly, biweekly, monthly, or bimonthly administration.
- the appropriate therapeutically effective dose of a compound may range approximately from about 1 ng/kg to about 100 mg/kg, from about 1 ng/kg to about 50 mg/kg, from about 1 ng/kg to about 10 mg/kg, from about 1 ⁇ g/kg to about 1 mg/kg, from about 10 ⁇ g/kg to about 1 mg/kg, from about 10 ⁇ g/kg to about 100 ⁇ g/kg, from about 100 ⁇ g to about 1 mg/kg, and from about 500 ⁇ g/kg to about 5 mg/kg.
- ng/kg to about 100 mg/kg from about 1 ng/kg to about 50 mg/kg, from about 1 ng/kg to about 10 mg/kg, from about 1 ⁇ g/kg to about 1 mg/kg, from about 10 ⁇ g/kg to about 1 mg/kg, from about 10 ⁇ g/kg to about 100 ⁇ g/kg, from about 100 ⁇ g to about 1 mg/kg, and from about 500 ⁇ g/kg to about 5 mg/kg.
- the appropriate therapeutic dose is chosen from, e.g., about 0.1 mg/kg, about 0.25 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 30 mg/kg, about 40 mg/kg, about 50 mg/kg, about 60 mg/kg, about 70 mg/kg, and about 100 mg/kg.
- the pharmaceutical compositions of the present invention may be administered by intravenous injection at a dose of, e.g., 1.0 mg/kg body weight every two weeks or four weeks at an infusion rate of, e.g., less than or equal to 10, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, or 33 mg/hour.
- the pharmaceutical composition comprising collagen IV protein may be administered by intravenous injection at a dose of, e.g., 20 mg/kg or 40 mg/kg every two or four weeks, over approximately, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 hours.
- the present invention provides methods for treating a disease condition characterized by one or more deficiencies of collagen IV protein in a subject in need thereof by administering to the subject a pharmaceutical composition that contains an pharmaceutically effective amount of recombinant collagen IV protein .
- the condition may be associated with any deficiencies in any one of collagen IV a chain polypeptides selected from ⁇ , ⁇ 2, ⁇ 3, ⁇ 4, ⁇ 5, and ⁇ 6 chains.
- the deficiencies are related to collagen IV a3, a4 and a5 chains.
- the condition characterized by deficiencies of collagen IV protein is selected from Alport syndrome, thin basement membrane nephropathy (TBMN), familial hematuria, end stage renal disease (ESRD), progressive renal insufficiency, glomerular hematuria, proteinuria, hereditary nephritis, diabetic nephropathy, perinatal cerebral hemorrhage and porencephaly, hemorrhagic stroke, and any diseases or disorder with defects in collagen IV protein, and/or any diseases or disorder with defects in collagen IV protein
- the disease is Alport syndrome.
- Alport syndrome may be X-linked Alport syndrome, autosomal recessive Alport syndrome, or autosomal dominant Alport syndrome.
- An X-linked Alport syndrome may be caused by any mutation in COL4A5 gene encoding the a5(IV) chain polypeptide.
- An autosomal recessive Alport syndrome may be caused by any mutations in COL4A3 and/or COL4A4 genes encoding the a4(IV) chain polypeptide and a5(IV) chain polypeptide.
- An autosomal dominant Alport syndrome may be caused by any mutations in COL4A3 and/or COL4A4 genes encoding the a4(IV) chain polypeptide and a5(IV) chain polypeptide.
- the subject with Alport syndrome is diagnosed with Alport syndrome with heavy proteinuria, Alport syndrome with mild proteinuria, Alport syndrome with hematuria only, Alport syndrome without renal dysfunction findings who are diagnosed by family history and genetic screening, X-linked syndrome, autosomal recessive Alport syndrome, or autosomal dominant Alport syndrome.
- condition characterized by one or more deficiencies in COL4A3, COL4A4 and COL4A5 genes further include auditory dysfunction, ocular dysfunction, brain small vessel disease with hemorrhage, brain small vessel disease with Axenfeld-Rieger anomaly or intracerebral hemorrhage.
- compositions used in the present methods comprise recombinant collagen IV protomers, dimers, tetramers, multimers and/or a mixture thereof.
- compositions comprise recombinant collagen IV protomers, wherein protomers are heterotrimers comprising three a(IV) chains selected from the group consisting of the a3(IV), a4(IV) and a5(IV) chains, wherein the three chains form a triple helix.
- compositions comprise recombinant collagen IV heterotrimers with one a3(IV) chain, one a4(IV) chain and one a5(IV) chain, wherein the a3(IV) chain comprises the amino acid sequence of SEQ ID NO.3 and variants thereof; the a4(IV) chain comprises the amino acid sequence of SEQ ID NO.4 and variants thereof, and the a5(IV) chain comprises the amino acid sequence of SEQ ID NO.5 and variants thereof.
- recombinant collagen IV protomers may be heterotrimers comprising one, two or three chimeric a chains selected from the chimeric a3(IV), a4(IV), a5(IV) chains, wherein the chimeric a3(IV) chain comprises a chimeric polypeptide in which all or part of the NCI domain of the a3(IV) chain is replaced with all or part of the NCI domain of the l(IV) or a2(IV) chains; the chimeric a4(IV) chain comprises a chimeric polypeptide in which all or part of the NC 1 domain of the a4(IV) chain is replaced with all or part of the NC 1 domain of the al(IV) or a2(IV) chains; and the chimeric a5(IV) chain comprises a chimeric polypeptide in which all or part of the NCI domain of the a5(IV) chain is replaced with all or part of the NCI domain of the l(IV) or
- compositions comprise recombinant collagen IV dimers, wherein said dimers comprise two collagen IV protomers which may be recombinant collagen IV ⁇ 3- ⁇ 4- ⁇ 5 and/or chimeric collagen IV as disclosed herein.
- collagen IV dimers are dimerized enzymatically or chemically in vitro prior to administering to the subject in need.
- the pharmaceutical composition comprising collagen IV protein is administered to a subject in need thereof by an intravenous injection, intraperitoneal injection, intramuscular injection, subcutaneous injection, intrathecal injection, intracerebral ventricular administration, intracranial delivery, intraocular delivery, intraaural delivery, and/or by an acute or chronically placed catheter.
- the recombinant collagen IV protein is administered to a subject in need thereof by intravenous injection.
- the pharmaceutical composition comprising collagen IV protein may be co-administered to a subject in need with one or more prophylactic agents to void thrombosis and inflammatory, and/or other anaphylactic reactions induced by the administration of recombinant collage IV protein to the subject.
- prophylactic agents may include antithrombotic agents and/or anti-inflammatories.
- Anti-thrombotic agents are drugs that reduce thrombus formation. As described herein, anti-thrombotic agents may be used to primarily prevent, or secondarily prevent acute thrombus formation induced by collagen IV replacement.
- An anti-thrombotic agent may be an antiplatelet drug which limits the aggregation of platelets, an anticoagulant that limits the ability of the blood to clot, or a thrombolytic drug that acts to dissolve clots after they have formed.
- Antiplatelet drugs may include, but are not limited to, irreversible cyclooxygenase inhibitors such as aspirin and triflusal; adenosine diphosphate (ADP) receptor inhibitors such as clopidogrel, prasugrel, ticagrelor and ticlopidine; phosphodiesterase inhibitors such as cilostazol; glycoprotein IIB/IIIA inhibitors such as abciximab, eptifibatide and tirofiban; adenosine reuptake inhibitors such as dipyridamole; thromboxane inhibitors such as thromboxane synthase inhibitors, thromboxane receptor antagonists and teruthroban.
- Anticoagulants may include, but are not limited to, warfarin, heparin, acenocoumarol, atromentin, brodifacoum and phenindione.
- Thrombolytic drugs may include, but are not limited to, tissue plasminogen activator t-PA such asreteplase, reteplase and tenecteplase; anistreplase; streptokinase and urokinase.
- the pharmaceutical composition comprising collagen IV protein may be co-administered to a subject in need with one or more anti-inflammatory agents.
- Anti-inflammatory agents may include, but are not limited to, NSAIDS (non-steroidal antiinflammatory drugs) such as aspirin, ibuprofen, naproxen; acetaminophen; ImSAIDs (immune- selective anti-inflammatory drugs); phosphorylated dendrimers (see, e.g., U.S. Patent application publication No. 20100173871). Many other NSAIDS are disclosed in U.S. Pat. No.
- some health/food supplements which are antiinflammatory may also be used together with the pharmaceutical composition of the present invention, for example, food that create anti-inflammatory prostaglandins (PGE1 and PGE3).
- Herbs and health supplements having anti-inflammatory qualities may include ginger, turmeric, arnica montana, willow bark, green tea, pineapple bromelain and indian olibanum.
- the anti-thrombotic agents and/or anti-inflammatories may be administered to the subject in need concomitantly, substantially concomitantly, or sequentially, substantially sequentially with the recombinant human collagen IV protein of the present invention.
- the method for treating collagen IV deficiencies further comprise a step of administering to the subject in need one or more agents that promote intravenous extravasation, said agents including hyaluronidase and histamine agonist.
- bromine is ubiquitously present in animals as ionic bromide (Br) and is a required cofactor for peroxidasin-catalyzed formation of sulfilimine crosslinks, a posttranslational modification essential for tissue development and architecture found within the collagen IV scaffold of basement membranes (BMs).
- BMs basement membranes
- Bromine is an essential trace element for animals and bromine dietary supplement can facilitate collagen IV network formation in the GBM.
- one or more cofactors of peroxidasin may be administered to the subject after or substantially after the administration of the recombinant human collagen IV protomers.
- the patient may have a special diet containing bromide.
- the present invention features methods for preventing, ameliorating one or more abnormalities comprising thinning and splitting glomerular basement membrane (GBM), heavy proteinuria, mild proteinuria, hematuria, renal deficiency, progression to end stage renal disease, auditory dysfunction, ocular abnormalities, porencephaly, brain small vessel disease with hemorrhage, brain small vessel disease with Axenfeld-Rieger anomaly, hereditary angiopathy with nephropathy, aneurysms, and muscle, and/or intracerebral hemorrhage, by administering to a subject in need thereof a pharmaceutical composition that comprises collagen IV protein, such that administering collagen IV protein prevents and/or ameliorates the phenotypic outcomes of the subject.
- GBM thinning and splitting glomerular basement membrane
- the collagen IV protein may be administered to a mammal.
- the mammal may be a mouse, a rat, a dog or a human.
- the host cells that express chimeric a(IV) polypeptides and/or chimeric cDNA constructs that encode chimeric a(IV) polypeptides may be used in the present methods.
- Said chimeric a(IV) polypeptides may be selected from chimeric a3(IV), a4(IV), and a5(IV) polypeptides in which all or part of the NCI domain of each of a3(IV), a4(IV), and a5(IV) polypeptides is replaced with all or part of the NCI domain of the al(IV) and/or a2(IV) polypeptides.
- ELISA will be used to test the concentration of recombinant collagen IV in the serum or tissues.
- Collagen IV levels in serum or tissues are altered in many conditions.
- Serum collagen IV may be indicative of collagen IV degradation in the tissue and may correlate with collagen IV in basement membranes, including GBM.
- the quantitative measurement of collagen IV may assist in the monitoring of the effectiveness of recombinant collagen IV treatment.
- An ELISA analysis such as Echelon's collagen IV ELISA Kit may be used for this purpose.
- the user simply adds the provided standard curve and their samples to a collagen IV capture plate, following an incubation and plate wash, then adds an HRP labeled detection reagent. After an additional incubation and plate wash, TMB substrate is added to the plate and the colorimetric reaction stopped by the addition of IN sulfuric acid. The absorbance at 450 nm is measured and the concentration of samples determined by comparison to the standard curve.
- endogenous molecules present within the blood, tissues and urine may be used to measure the effectiveness of collagen IV replacement.
- blood and urine samples obtained from the recombinant human collagen IV treated patients are used to test the presence and/or concentrations of biomarkers such as albumin, immunoglobulins A, E, G and M, DBP, RBP, l microglubulin, ⁇ 2 microglubulin, cubulin, apolipoprotein A-l and megalin.
- Integrins are major receptors for extracellular matrix proteins including collagens. Integrin receptors are heterodimers composed of an a and ⁇ transmembrane subunit, which are noncovalently bound. Collagen binding is primarily provided by integrins ⁇ , ⁇ 2 ⁇ 1, ⁇ and ⁇ 1 ⁇ 1. Integrin ⁇ preferentially binds collagen IV, but also binds collagen VI and II. Cells may also express other collagen receptors such as discoidin domain receptor type 1 (DDR1), discoidin domain receptor type 2 (DDR2), glycoprotein VI (GPVI) and/or mannose receptors. Cells are engineered to present collagen IV receptor integrin (e.g. integrin ⁇ ) with any techniques well known in the art. Collagen IV proteins at different concentrations are added into the culture media of integrin positive cells, the kinetics of integrin-collagen IV binding, cell migration, adherent morphology of treated cells, and differentiation are analyzed.
- DDR1 discoidin domain receptor type 1
- blood cells obtained from the subject being treated with recombinant collagen IV may also be used for cell adhesion assays such as focal adhesion kinase (FAK) cell assays.
- FAK focal adhesion kinase
- other cells may be used for cell adhesion assays including human pulmonary fibroblasts.
- human pulmonary fibroblasts are transfected with vectors expressing a collagen IV integrin receptor and cultured in the collagen IV pre-coated 48 well plates. Cells are cultured in the pre-coated wells for a desired period of time, then unbounded cells are washed away, and the adhered cells are fixed and stained, followed by an extraction step which leads to dye elution from stained cells into supernatant.
- FAM focal adhesion kinase
- Monoclonal antibodies (mAbs) against collagen IV may be used to detect collagen IV protein.
- Such as mAbs may include those disclosed in U.S. Pat. No. 5,741,652.
- a collagen IV immunoreactive peptide disclosed in US pat No. 8,420,331 may also be used to detect collagen IV.
- Blood cells may be obtained from the subject being treated with recombinant collagen IV protein.
- the intracellular signaling cascades that relates to collagen IV interaction, and gene expression induced by collagen IV protein may be used to test collagen IV incorporation in the basement membrane.
- Such assays could include ELISA based methods in which laminin- 111, collagen VI and biglycan are coated onto a plate, followed by incubation of recombinant collagen IV, followed by detection of collagen IV using an anti-collagen IV antibody chemically conjugated to HRP or other reporter molecule.
- Other assays such BiaCore could measure the affinities of laminin-111, collagen VI and biglycan to recombinant collagen IV.
- Example 1 Administration of collagen IV protein to collagen IV deficiency animal models
- Cosgrove et al produced a mouse model for the autosomal form of Alport syndrome by a COL4A3 knockout (Cosgrove et al, Genes Dev., 1996, 10, 2981-2992).
- the mice developed progressive glomerulonephritis with microhematuria and proteinuria.
- End-stage renal disease developed at about 14 weeks of age.
- Transmission electron microscopy (TEM) of glomerular basement membranes (GBM) during development of renal pathology revealed focal multilaminated thickening and thinning beginning in the external capillary loops at 4 weeks and spreading throughout the GBM by 8 weeks. By 14 weeks, half of the glomeruli were fibrotic with collapsed capillaries.
- TEM Transmission electron microscopy
- GBM glomerular basement membranes
- Immunofluorescence analysis of the GBM showed the absence of type IV collagen a3, a4, and a5 chains and a persistence of al and a2 chains, which are normally localized to the mesangial matrix.
- Northern blot analysis using probes specific for the collagen chains demonstrated the absence of COL4A3 in the knockout, whereas mRNAs for the remaining chains were unchanged.
- the progression of Alport renal disease was correlated in time and space with the accumulation of fibronectin, heparan sulfate proteoglycan, laminin-1, and entactin in the GBM of the affected animals.
- COL4 A3 -deficient mice had normal expression of podocyte- and slit diaphragm- associated proteins until 4 weeks after birth, despite significant structural defects in the glomerular basement membrane.
- week 5 there were alterations within the slit diaphragm, podocyte effacement, and altered expression of nephrin, a slit diaphragm-associated protein.
- Canine X-linked hereditary nephritis is an animal model for human X-linked Alport syndrome characterized by the presence of a premature stop codon in the ⁇ 5 (IV) chain polypeptide (Zheng et al, Proc. Nat. Acad. Sci., 1994, 91, 3989-3993).
- the expression of the canine collagen type IV genes in the kidney indicates that, in addition to a significantly reduced level of COL4A5 gene expression (approximately 10% of normal), expression of the COL4A3 and COL4A4 genes was also decreased to 14-23% and 11-17%), respectively.
- the canine X-linked Alport syndrome and control animals are purchased and are injected intravenously with collagen IV at various concentrations from 1 ng/kg to 100 mg/kg every day, every other day, weekly or biweekly until a urinalysis demonstrates reduced progression of proteinuria, stabilized proteinuria, or reduced proteinuria, or as long as animal lifespan is maintained.
- Urinary albumin and creatinine concentration are estimated using colorimetric assay using commercially available assay kits (e.g., Sigma, St. Louis, MO). Urine albumin excretion is estimated as the quotient of urine albumin and urine creatinine as previously described
- Kidney tissues are fixed and stained with Hematoxylin-Eosin (H&E). The extent of renal pathology is assessed by morphometry of the glomerular diseases, tubular atrophy and interstitial fibrosis as previously described. Transmission electron microscopy (TEM) and scanning electron microscopy (SEM) are used to examine the structure of glomerular basement membrane. It is anticipated that improvements in proteinuria may not be coincident with normalization of the GBM architecture and morphology; such as decreased splitting or decreased thickening of the GBM, or reestablishment of foot processes of podocytes, yet the amelioration of such morphological phenotypes in Alport syndrome provide a measure of efficacy. It is anticipated that early treatment of Alport syndrome with recombinant collagen IV will result in normalization of GBM architecture.
- Immunofluorescent staining is performed as described previously (Cosgrove et al, Genes Dev., 1996, 10, 2981-2992). Antibodies specific to either a3(IV), a4(IV) or a5(IV) chain are used to stain collagen IV protein in mice administered with collagen IV. Mice are perfused with 2% PBS buffered formalin before organs are harvested. Cryosectioned tissue specimens are stained with primary antibodies against either a3(IV), a4(IV) or a5(IV) chain for lh at room temperature and sections are reacted with fluorescent (e.g., FITC, GFP) conjugated secondary antibodies. Recombinant collagen IV proteins presented in the GBM are fluorescently labeled and analyzed.
- fluorescent e.g., FITC, GFP
- collagen isoform (al) 2 /a2(IV) network exists in the subendothelial region of the GBM and plays an important role in GBM development and function. It is hypothesized that the defect in Alport GBM is because there is not enough isoform ( l) 2 /a2(IV) present to provide the needed stability of collagen network. Experiments are designed to test the hypothesis that infusing isoform ( l) 2 /a2(IV) intravenously can increase collagen ( l) 2 /a2(IV) levels in the GBM and prevent further development and progression of lesions, and will significantly slow kidney disease progression to kidney failure.
- Wild type, Collagen IV a3 chain knockout mice (COL4A3-/-) and/or Collagen IV a4 chain knockout mice (COL4A4-/-) are obtained and maintained under standard conditions, and fed standard mouse chow and water ad libitum. Additionally, mice may be either on the
- Kidney dysfunction progresses rapidly on the 129S1 background (about 10 weeks), slowly on the B6 background (about 8 months) and intermediately on the 129S1/B6 hybrid background (about 4 months).
- Col4a3-l- Alport mice on the 129Sl/SvImJ strand background are divided into 3 treatment groups of 7 to 10 mice in each group. Each group is treated by intravenous injection with vehicle only, collagen isoform (al) 2 /a2(IV) at low dose and collagen isoform ( l) 2 /a2(IV) at high dose, respectively. Treatment begins at 3 to 4 weeks of age and continues weekly until at least 10 weeks of age, or longer if the treatment proves to be effective at slowing kidney disease progression.
- Urine is analyzed every 1 to 2 weeks for protein and creatinine beginning at 4 weeks of age. Animal weights are determined every 7 to 10 days beginning at 6 weeks of age as a general measure of overall health, as weight loss usually precedes kidney failure. Treated mice are sacrificed at various ages (depending on the results of urine and weight analyses) or at the time of renal failure so that kidney histology and glomerular ultrastructure can be investigated and the effects of the treatments on fibrosis and glomerular basement membrane architecture can be determined.
- Collagen type IV proteins (Col4 (al( 2 )a2)) were purified and prepared from mouse tissues. To test species and the relative ratio of protomers, dimers, tetramers and aggregates within the Col4 (al( 2 )a2) preparation, denaturing and native gel electrophoresis was used and the size of each band was analyzed.
- sc-29010 were diluted in acidic solution (50mM HC1, pH ⁇ 2.0), neutral TBS (20mM Tris-HCl and 500mM NaCl, pH ⁇ 7.5) and basic Tris-HCl (lOOmM Tris-HCl, pH ⁇ 9.0), respectively, and were analyzed by denaturing SDS-PAGE with or without disulfide reduction. All preparations were assembled for 17 minutes at room temperature before adding the loading sample buffer. The separate bands were visualized by silverstain or immunoblotting using antibody sc6586. No or very little aggregation was observed in all three (acidic, neutral and basic) conditions with or without disulfide reduction.
- Example 4 Platelets aggregation In Vitro
- Mouse platelet-rich plasma was prepared as described previously (Hoffmeister et al., the clearance mechanism of chilled blood platelets. Cell 2003; 10(l):87-97). All centrifuge steps included prostaglandin El to prevent platelet activation. Mouse stain CD-I was used for the preparation of resting platelets.
- Platelets aggregation begins minutes after activation, and occurs as a result of turning on the GPIIa/b receptor, which allows these receptors to bind the von Willebrand Factor (vWF) or fibrinogen.
- vWF von Willebrand Factor
- Activation of platelets change their shapes from curved to straight, and such activation can be detected using Aggregometer (BIO/DATA Corp. Horsham, PA, USA)
- Col4 ( ⁇ 1(2) ⁇ 2) does not activate platelets or induce the aggregations. Furthermore, The Col4 ( ⁇ 1(2) ⁇ 2) preparation does not inhibit platelet aggregation induced by agonists TRAP or ADP.
- Col4 ( ⁇ 1(2) ⁇ 2) In particular the high molecule weigh species of Col4 ( ⁇ 1(2) ⁇ 2) (about 900KDa) in the GBM in vivo, Col4 ( ⁇ 1(2) ⁇ 2) and LAM- 111 proteins were first labeled with fluorescein (FITC).
- FITC fluorescein
- 5(6)-SFX (6- (Fluorescein-5-(and-6)-Carboxamido) HexanoicAcid, SuccinimidylEster), mixed isomers (Cat. No. F2181, Molecular Probes), which contains a hexanoic acid spacer, was used for labeling Col4 ( ⁇ 1(2) ⁇ 2) and LAM-111.
- lOmg/ml of 5(6)-SFX was dissolved in 1ml anhydrous Dimethyl Formamide (lOmg/ml).
- 2.5mg Col4 (al(2)a2) and 1.2mg LAM-111 was first buffer exchanged to 0.2M Carbonate (pH 8.3) using ZebaSpin Desalting 2 ml Columns (Cat No. 89890, Thermo, USA).
- 5(6)-SFX solution was then added to 10% (Volume/Volume) and the mixture was stirred at room temperature for 1 hour for the reaction.
- the mixture was then buffer exchanged to lx PBS using ZebaSpin Desalting 2 ml Columns.
- FITC labeled Col4 ( ⁇ l(2) ⁇ x2) and FITC-LAM-111 conjugates were tested for the stability using ELISA assay.
- a rabbit or goat polyclonal anti-FITC-HRP antibody was used to detect FITC- Col4 ( ⁇ 1(2) ⁇ 2) and FITC-LAM-111 conjugates, whereas a rabbit anti Col4
- FIG. 4 illustrates that the tested anti-FITC antibodies ab 19492 (rabbit) and ab6656 (goat) from Abeam only detect FITC- Col4 ( ⁇ 1(2) ⁇ 2) conjugates.
- the comparison of the staining of anti-FITC and anti- Col4 ( ⁇ 1(2) ⁇ 2) antibodies indicates that FITC labeled Col4 ( ⁇ 1(2) ⁇ 2) is diminished, suggesting that extensive FITC labeling may have either masked Col4 ( ⁇ 1(2) ⁇ 2) epitopes or reduced Col4 (al(2)a2) stability.
- FITC -LAM-111 conjugates are similar to FITC-Col4 ( ⁇ 1(2) ⁇ 2) conjugates when tested by ELISA assays and immunoblot ( Figures 6a-6c).
- Example 6 In vivo administration of Col4-al(2 ) (x2 and detection in the GBM
- FITC- Col4 ( ⁇ l(2) ⁇ x2) and FITC-LAM-111 conjugates, prepared as described in previous examples, were systemically administrated to the wild type, heterogeneous and Alport mice, and the localization of FITC- Col4 ( ⁇ 1(2) ⁇ 2) and FITC-LAM-111 conjugates in the GBM of kidney was examined.
- Such deposition of FITC- Col4-al( 2 )a2 and FITC-LAM-111 in the GBM can be further investigated to examine if the deposited Col4-al( 2 )a2 proteins can integrate into the collagen network in the GBM and rescue the functionality of Alport GBM. Evaluation of whether chronic repeat dosing of Col4-al( 2 )a2 is therapeutic in the Alport mouse model will be studied, such as described in Examples 1 and 2.
- FITC-LAM-111 Deposition of FITC-LAM-111 into the GBM indicates that other laminin iso forms, such as LAM-521, may be therapeutic for other kidney diseases such as Pierson Syndrome.
- Example 7 chronic repeat dosing of Col4-al(2)(x2 and therapeutic effect in Alport mice
- Col4-al(2)(x2 and agrin a known GBM protein in kidney
- mice after repeat dosing of Col4- ⁇ 1(2) ⁇ 2 or control vehicle for at least six weeks.
- Col4-al(2)(x2 proteins deposit into the glomeruli in kidney and co-localize with other proteins of the GBM (e.g., agrin).
- Col4-al(2)(x2 treated Alport mice (Col4-/-) have 61% of non-sclerotic glomeruli
- untreated Alport mice col4-/-
- vehicle treated Alport mice Col4-/-
- Urine albumin to creatinine ratio (UACR) analysis
- Urine NO benefit NO benefit Improvements See albumin/ Creatinine (See detailed (See detailed detailed measurements ratio measurements measurements in in Table 8) in Table 8) Table 8)
- articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
- the invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
- the invention includes embodiments in which more than one, or the entire group members are present in, employed in, or otherwise relevant to a given product or process.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2017525311A JP2017532365A (ja) | 2014-07-25 | 2015-07-23 | コラーゲンivの置き換え |
| CA2955481A CA2955481A1 (en) | 2014-07-25 | 2015-07-23 | Collagen iv replacement |
| US15/328,215 US20180207240A1 (en) | 2014-07-25 | 2015-07-23 | Collagen iv replacement |
| EP15824092.9A EP3171889A4 (en) | 2014-07-25 | 2015-07-23 | Collagen iv replacement |
| AU2015292582A AU2015292582A1 (en) | 2014-07-25 | 2015-07-23 | Collagen IV replacement |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462029135P | 2014-07-25 | 2014-07-25 | |
| US62/029,135 | 2014-07-25 | ||
| US201462072490P | 2014-10-30 | 2014-10-30 | |
| US62/072,490 | 2014-10-30 | ||
| US201562128729P | 2015-03-05 | 2015-03-05 | |
| US62/128,729 | 2015-03-05 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016014781A1 true WO2016014781A1 (en) | 2016-01-28 |
Family
ID=55163752
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/041712 Ceased WO2016014781A1 (en) | 2014-07-25 | 2015-07-23 | Collagen iv replacement |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20180207240A1 (enExample) |
| EP (1) | EP3171889A4 (enExample) |
| JP (1) | JP2017532365A (enExample) |
| AU (1) | AU2015292582A1 (enExample) |
| CA (1) | CA2955481A1 (enExample) |
| WO (1) | WO2016014781A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018031845A1 (en) * | 2016-08-11 | 2018-02-15 | Sulfilatec, Inc. | Compositions and methods for treating disease |
| WO2020020896A1 (en) * | 2018-07-25 | 2020-01-30 | Boehringer Ingelheim International Gmbh | Empagliflozin for use in treating alport syndrome |
| CN111602056A (zh) * | 2017-10-20 | 2020-08-28 | 北欧生物科技公司 | Xvi型胶原蛋白测定 |
| CN114761033A (zh) * | 2019-09-11 | 2022-07-15 | 国立大学法人熊本大学 | 用于难治性遗传性肾病奥尔波特综合征的根治性疗法的药剂 |
| US12589167B2 (en) | 2020-03-12 | 2026-03-31 | The University Of Bristol | AAV gene therapy vector with podocyte-specific promoter |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12164185B2 (en) * | 2020-02-14 | 2024-12-10 | Tdk Corporation | Optical modulation element |
| EP4255427B1 (en) * | 2020-12-03 | 2024-11-06 | Delta 4 GmbH | Clopidogrel for use in the treatment of focal segmental glomerulosclerosis (fsgs) |
| CN114149502A (zh) * | 2021-12-23 | 2022-03-08 | 杭州百凌生物科技有限公司 | 一种四型胶原蛋白ɑ3的抗体、检测试剂盒及其应用 |
| CN115960211B (zh) * | 2022-12-23 | 2023-11-21 | 江苏创健医疗科技股份有限公司 | 一种重组人源ⅵ型胶原蛋白及其制备方法和应用 |
| WO2025193938A1 (en) * | 2024-03-13 | 2025-09-18 | Oregon Health & Science University | Delivery of type iv collagen alpha chain using a split intein dual aav vector |
| CN119286901B (zh) * | 2024-11-21 | 2025-09-09 | 西安巨子生物基因技术股份有限公司 | 一种重组iv型胶原蛋白及其制备方法和应用 |
| CN120731923B (zh) * | 2025-09-05 | 2025-11-04 | 内蒙古医科大学附属医院(内蒙古自治区心血管研究所) | 一种Alport综合征小鼠NMD逃逸模型的构建方法及其应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040132662A1 (en) * | 1995-06-30 | 2004-07-08 | Kansas University Medical Center | Use of isolated domains of type IV collagen to modify cell and tissue interaction |
| US6812339B1 (en) * | 2000-09-08 | 2004-11-02 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
| US20070042965A1 (en) * | 2001-07-27 | 2007-02-22 | Kansas University Medical Center | Crystallized structure of type IV collagen NC1 domain hexamer |
| US7608413B1 (en) * | 2005-03-25 | 2009-10-27 | Celera Corporation | Kidney disease targets and uses thereof |
| US20130116412A1 (en) * | 2010-04-02 | 2013-05-09 | Daniel M. Pinkas | Production of Post-Translationally Hydroxylated Recombinant Proteins in Bacteria |
| US20140100263A1 (en) * | 2012-10-09 | 2014-04-10 | Regulus Therapeutics Inc. | Methods for treatment of alport syndrome |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PT1064018E (pt) * | 1998-03-27 | 2004-12-31 | Univ Kansas Medical Center | Utilizacao de dominios isolados de colagenio de tipo iv para modificar interaccoes celulares e teciduais |
| US7183383B2 (en) * | 2002-03-20 | 2007-02-27 | The University Of Arkansas For Medical Sciences | Uses of collagen IV |
| US20180055913A1 (en) * | 2014-07-29 | 2018-03-01 | Vanderbilt University | Recombinant collagen iv surrogates and uses thereof |
-
2015
- 2015-07-23 WO PCT/US2015/041712 patent/WO2016014781A1/en not_active Ceased
- 2015-07-23 EP EP15824092.9A patent/EP3171889A4/en not_active Withdrawn
- 2015-07-23 AU AU2015292582A patent/AU2015292582A1/en not_active Abandoned
- 2015-07-23 CA CA2955481A patent/CA2955481A1/en not_active Abandoned
- 2015-07-23 US US15/328,215 patent/US20180207240A1/en not_active Abandoned
- 2015-07-23 JP JP2017525311A patent/JP2017532365A/ja active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040132662A1 (en) * | 1995-06-30 | 2004-07-08 | Kansas University Medical Center | Use of isolated domains of type IV collagen to modify cell and tissue interaction |
| US6812339B1 (en) * | 2000-09-08 | 2004-11-02 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
| US20070042965A1 (en) * | 2001-07-27 | 2007-02-22 | Kansas University Medical Center | Crystallized structure of type IV collagen NC1 domain hexamer |
| US7608413B1 (en) * | 2005-03-25 | 2009-10-27 | Celera Corporation | Kidney disease targets and uses thereof |
| US20130116412A1 (en) * | 2010-04-02 | 2013-05-09 | Daniel M. Pinkas | Production of Post-Translationally Hydroxylated Recombinant Proteins in Bacteria |
| US20140100263A1 (en) * | 2012-10-09 | 2014-04-10 | Regulus Therapeutics Inc. | Methods for treatment of alport syndrome |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3171889A4 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018031845A1 (en) * | 2016-08-11 | 2018-02-15 | Sulfilatec, Inc. | Compositions and methods for treating disease |
| US11376278B2 (en) | 2016-08-11 | 2022-07-05 | Sulfilatec, Inc. | Compositions and methods for treating disease |
| CN111602056A (zh) * | 2017-10-20 | 2020-08-28 | 北欧生物科技公司 | Xvi型胶原蛋白测定 |
| CN111602056B (zh) * | 2017-10-20 | 2024-04-23 | 北欧生物科技公司 | Xvi型胶原蛋白测定 |
| WO2020020896A1 (en) * | 2018-07-25 | 2020-01-30 | Boehringer Ingelheim International Gmbh | Empagliflozin for use in treating alport syndrome |
| CN114761033A (zh) * | 2019-09-11 | 2022-07-15 | 国立大学法人熊本大学 | 用于难治性遗传性肾病奥尔波特综合征的根治性疗法的药剂 |
| US12589167B2 (en) | 2020-03-12 | 2026-03-31 | The University Of Bristol | AAV gene therapy vector with podocyte-specific promoter |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2955481A1 (en) | 2016-01-28 |
| EP3171889A1 (en) | 2017-05-31 |
| EP3171889A4 (en) | 2018-03-14 |
| US20180207240A1 (en) | 2018-07-26 |
| JP2017532365A (ja) | 2017-11-02 |
| AU2015292582A1 (en) | 2017-02-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20180207240A1 (en) | Collagen iv replacement | |
| US20220313830A1 (en) | Heparin-peptide bioconjugates and uses thereof | |
| Wesche-Soldato et al. | The apoptotic pathway as a therapeutic target in sepsis | |
| US11529424B2 (en) | Synthetic bioconjugates | |
| JP5917437B2 (ja) | Adpリボシルトランスフェラーゼ融合バリアントタンパク質 | |
| AU4004799A (en) | Use of alpha1beta1 integrin receptor inhibitors and tgf-beta1 inhibitors in the treatment of kidney disease | |
| CA2329757C (en) | Use of .alpha.1.beta.1 integrin receptor inhibitors and tgf-.beta.1 inhibitors in the treatment of kidney disease | |
| CA3117723A1 (en) | Methods of cellular reprogramming | |
| HK1257236A1 (zh) | 预防和治疗高脂血症的药物及其用途 | |
| AU2018298226A1 (en) | Biconjugates with chemically modified backbones | |
| AU2013202269A1 (en) | Compositions and methods for the treatment of fibrosis and fibrotic diseases | |
| US7498299B2 (en) | Procollagen (III) propeptides and related substances for treating fibrotic diseases | |
| US20030220253A1 (en) | Inhibitors for use in hemostasis | |
| CN108210908A (zh) | 预防和治疗药物性肾损伤的药物及其用途 | |
| US12576138B2 (en) | Compounds and methods for the immobilization of myostatin-inhibitors on the extracellular matrix by transglutaminase | |
| JP2017526746A (ja) | 組織または器官の癒着を予防または治療するための組換え融合タンパク質 | |
| WO2021117754A1 (ja) | Dna損傷の抑制又は修復剤 | |
| MXPA00011409A (en) | Use of alpha 1 beta 1 integrin receptor inhibitors and tgf-bgr;1 inhibitors in the treatment of kidney disease | |
| IL139687A (en) | Use of ß11α integrin receptor inhibitors and TGF β1 inhibitors for the preparation of medicinal preparations for the treatment of kidney disease |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15824092 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2955481 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017525311 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2015292582 Country of ref document: AU Date of ref document: 20150723 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015824092 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015824092 Country of ref document: EP |