WO2016007929A2 - Paenibacillus and bacillus spp. mannanases - Google Patents
Paenibacillus and bacillus spp. mannanases Download PDFInfo
- Publication number
- WO2016007929A2 WO2016007929A2 PCT/US2015/040057 US2015040057W WO2016007929A2 WO 2016007929 A2 WO2016007929 A2 WO 2016007929A2 US 2015040057 W US2015040057 W US 2015040057W WO 2016007929 A2 WO2016007929 A2 WO 2016007929A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- active fragment
- amino acid
- seq
- mannanase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 NCC(C(C(**[C@](N=O)S)O)I)N Chemical compound NCC(C(C(**[C@](N=O)S)O)I)N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2477—Hemicellulases not provided in a preceding group
- C12N9/2488—Mannanases
- C12N9/2494—Mannan endo-1,4-beta-mannosidase (3.2.1.78), i.e. endo-beta-mannanase
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/189—Enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
- A23L29/00—Foods or foodstuffs containing additives; Preparation or treatment thereof
- A23L29/06—Enzymes
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38636—Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38681—Chemically modified or immobilised enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12C—BEER; PREPARATION OF BEER BY FERMENTATION; PREPARATION OF MALT FOR MAKING BEER; PREPARATION OF HOPS FOR MAKING BEER
- C12C5/00—Other raw materials for the preparation of beer
- C12C5/004—Enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2477—Hemicellulases not provided in a preceding group
- C12N9/2488—Mannanases
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01078—Mannan endo-1,4-beta-mannosidase (3.2.1.78), i.e. endo-beta-mannanase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/17—Metallocarboxypeptidases (3.4.17)
- C12Y304/17023—Angiotensin-converting enzyme 2 (3.4.17.23)
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Definitions
- the present disclosure relates to endo-P-mannanases from Paenibacillus or Bacillus spp, polynucleotides encoding such endo-P-mannanases, compositions containing such mannanases, and methods of use thereof.
- Compositions containing such endo-P-mannanases are suitable for use as detergents and cleaning fabrics and hard surfaces, as well as a variety of other industrial applications.
- Mannanase enzymes including endo-P-mannanases, have been employed in detergent cleaning compositions for the removal of gum stains by hydrolyzing mannans.
- a variety of mannans are found in nature, such as, for example, linear mannan, glucomannan, galactomannan, and glucogalactomannan.
- Each such mannan is comprised of polysaccharides that containa P-l,4-linked backbone of mannose residues that may be substituted up to 33% with glucose residues (Yeoman et al., Adv Appl Microbiol, Elsivier).
- galactomannans or glucogalactomannnans galactose residues are linked in alpha- 1,6-linkages to the mannan backbone (Moreira and Filho, Appl Microbiol Biotechnol, 79: 165, 2008). Therefore, hydrolysis of mannan to its component sugars requires endo-l,4-P-mannanases that hydrolyze the backbone linkages to generate short chain manno-oligosaccharides that are further degraded to
- endo-P-mannanases have been known in the art of industrial enzymes, there remains a need for further endo-P-mannanases that are suitable for particular conditions and uses.
- the present disclosure provides a recombinant polypeptide or active fragment thereof comprising an NDL-Clade.
- One embodiment is directed to an NDL-Clade comprising a polypeptide or fragment, active fragment, or variant thereof, described herein.
- Another embodiment is directed to an NDL-Clade comprising a recombinant polypeptide or fragment, active fragment, or variant thereof, described herein.
- the polypeptide or fragment, active fragment, or variant thereof is an endo-P-mannanase.
- the recombinant polypeptide or fragment, active fragment, or variant thereof is an endo-P-mannanase.
- the polypeptide or fragment, active fragment, or variant thereof described herein comprises Asn33-Asp-34-Leu35 (NDL), wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on conserved linear sequence numbering.
- the recombinant polypeptide or active fragment thereof of any of the above contains Asn33-Asp-34-Leu35 (NDL), wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on conserved linear sequence numbering.
- the NDL-Clade comprises a WXaKNDLXXAI motif at positions 30-38, wherein X a is F or Y and X is any amino acid, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on conserved linear sequence numbering.
- the polypeptide or fragment, active fragment, or variant thereof described herein contains a WX a KNDLX b X c AI motif at positions 30-38, wherein X a is F or Y, X is N, Y or A, and X c is A or T, and wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on conserved linear sequence numbering.
- the recombinant polypeptide or fragment, active fragment, or variant thereof described herein contains a
- the NDL-Clade comprises a
- the NDL-Clade comprises a
- One more embodiment is directed to an NDL-Clade 1 comprising a LDM/LATGPA/NGS/TLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- a still further emobidment is directd to an NDL-Clade 2 comprising a LDLA/VA/TGPS/NGNLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- Another embodiment is directed to an NDL-Clade 3 comprising a LDL/VS/AT/NGPSGNLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has at least 70% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has at least 70% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, and 60.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has mannanase activity, such as activity on locust bean gum galactomannan or konjac glucomannan.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has mannanase activity in the presence of a surfactant. In some embodiments, the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein retains at least 70% of its maximal mannanase activity at a pH range of 4.5-9.0. In some embodiments, the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein retains at least 70% of its maximal mannanase activity at a temperature range of 40°C to 70°C.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has cleaning activity in a detergent composition. In some embodiments, the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein has mannanase activity in the presence of a protease. In some embodiments, the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein is capable of hydrolyzing a substrate selected from the group consisting of guar gum, locust bean gum, and combinations thereof.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein does not further comprise a carbohydrate-binding module.
- Another embodiment is directd to cleaning compositions comprising at least one polypeptide of the preceding paragraph.
- cleaning compositions comprising at least one recombinant polypeptide of the preceding paragraph.
- the composition further comprises a surfactant.
- the surfactant is an ionic surfactant.
- the ionic surfactant is selected from the group consisting of an anionic surfactant, a cationic surfactant, a zwitterionic surfactant, and a combination thereof.
- the composition further comprises an enzyme selected from the group consisting of acyl transferases, amylases, alpha- amylases, beta-amylases, alpha-galactosidases, arabinases, arabinosidases, aryl esterases, beta- galactosidases, beta-glucanases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, exo-beta- mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipolytic enzymes, lipoxygenases,
- the composition further comprises a protease and an amylase.
- the detergent is selected from the group consisting of a laundry detergent, a fabric softening detergent, a dishwashing detergent, and a hard- surface cleaning detergent.
- the composition is a granular, powder, solid, bar, liquid, tablet, gel, paste, foam, sheet, or unit dose composition.
- the detergent is in a form selected from the group consisting of a liquid, a powder, a granulated solid, and a tablet.
- the present disclosure provides nucleic acids or isolated nucleic acids encoding the polypeptide of the preceding paragraphs. Additionally, the present disclosure provides nucleic acids or isolated nucleic acids encoding the recombinant polypeptide of the preceding paragraphs. Further provided is an expression vector comprising a nucleic acid described herein operably linked to a regulatory sequence. Also provided is an expression vector comprising an isolated nucleic acid described herein in operable combination to a regulatory sequence. Additionally, host cells comprising an expression vector describe herein are provided. Another embodiment provides host cells comprising nucleic acids encoding a recombinant polypeptide described herein. In some embodiments, the host cell is a bacterial cell or a fungal cell.
- the present disclosure further provides methods of producing an endo-P-mannanase of the present invention, comprising: culturing the host cell in a culture medium under suitable conditions to produce a culture comprising the endo-P-mannanase of the present invention.
- the methods further comprise removing the host cells from the culture by centrifugation, and removing debris of less than 10 kDa by filtration to produce an endo- ⁇ - mannanase-enriched supernatant.
- the present disclosure further provides methods for hydrolyzing a polysaccharide comprising: contacting a polysaccharide comprising mannose with the supernatant to produce oligosaccharides comprising mannose.
- the polysaccharide is selected from the group consisting of mannan, glucomannan, galactomannan, galactoglucomannan, and combinations thereof.
- Figure 1 provides a plasmid map of p2JM-PspMan4.
- Figures 2A-B show the cleaning performance of Paenibacillus and Bacillus spp. mannanases on Locust bean gum (CS-73) at pH 8, 20 minutes.
- Figures 3A-C show the CLUSTAL W ( 1.83) multiple sequence alignment of mannanases including BciManl, BciMan3, BciMan4, PamMan2, PpaMan2, PpoManl,
- PpoMan2 PspMan4, PspMan5, PspMan9, and PtuMan2.
- Figure 4 shows a phylogenetic tree of mannanases including BciManl, BciMan3, BciMan4, PamMan2, PpaMan2, PpoManl, PpoMan2, PspMan4, PspMan5, PspMan9, and PtuMan2 showing the branching of the NDL-Clade mannanases from other mannanases and the differentiation of NDL-Clade 1 and NDL-Clade 2.
- Figure 5 shows the motif of the NDL-Clade mannanases at positions 30-38, using the conserved linear sequence numbering.
- Figure 6 shows the motif of the NDL-Clade mannanases, including the NDL-Clade 1 and NDL-Clade 2 mannanases, that is between the conserved Leu262-Asp263 (LD) and conserved Leu272-Thr273 (LT) residues, using the conserved linear sequence numbering.
- LD conserved Leu262-Asp263
- LT Leu272-Thr273
- Figure 7 shows the potential structural consequences of motif changes found in the NDL-Clade mannanases.
- the closest known mannanase structure from Bacillus sp. JAMB-602 (1WKY) is shown in black while modelled structures of PspMan4, PspMan9 and PpaMan2 are shown in gray.
- the location of the deletion motif is highlighted by an arrow.
- the deletion motif is postulated to impact the structure of the loop in which it is located.
- Figure 8 shows the cleaning performance of PamMan3 and benchmank mannanases on Locust bean gum (CS-73) at pH 7.2, 30 minutes.
- Figures 9A-9F show the alignment of multiple sequences of the mature forms of various mannanases that was created using CLUSTALW software.
- Figure 10 shows a phylogenetic tree for amino acid sequences of the mature forms of the various mannanases created using the Neighbor Joining method, and visualized using The Geneious Tree Builder program.
- Figure 1 lA-11C show the sequence alignment of the mature forms of the NDL-Clade mannanases that was created using CLUSTALW software.
- endo-P-mannanases from Paenibacillus or Bacillus spp, polynucleotides encoding such endo-P-mannanases, compositions containing such mannanases, and methods of use thereof.
- the Paenibacillus and Bacillus spp. endo- ⁇ - mannanases described herein have glycosyl hydrolase activity in the presence of detergent compositions. This feature of the endo-P-mannanases described herein makes them well suited for use in a variety of cleaning and other industrial applications, for example, where the enzyme can hydrolyze mannans in the presence of surfactants and other components found in detergent compositions.
- Endo-l,4 ⁇ -mannanases are members of several families of glycosyl hydrolases, including GH26 and GH5.
- endo- ⁇ - mannanases constitute a group of polysaccharases that degrade mannans and denote enzymes that are capable of cleaving polyose chains containing mannose units (i.e., are capable of cleaving glycosidic bonds in mannans, glucomannans, galactomannans and galactogluco- mannans).
- endo-P-mannanases may possess additional enzymatic activities (e.g., endo-l,4-P-glucanase, 1,4- ⁇ -mannosidase, cellodextrinase activities, etc.).
- a "mannanase,” “mannosidic enzyme,” “mannolytic enzyme,” “mannanase enzyme,” “mannanase polypeptides,” or “mannanase proteins” refers to an enzyme, polypeptide, or protein exhibiting a mannan degrading capability.
- the mannanase enzyme may be, for example, an endo-P-mannanase, an ⁇ - ⁇ -mannanase, or a glycosyl hydrolase.
- mannanase activity may be determined according to any procedure known in the art (See, e.g., Lever, Anal. Biochem, 47:248, 1972; U.S. Pat. No. 6, 602, 842; and International Publication No. WO 95/35362A1).
- mannans are polysaccharides having a backbone composed of ⁇ - 1,4-linked mannose
- glucomannans are polysaccharides having a backbone of more or less regularly alternating ⁇ -1,4 linked mannose and glucose
- galactomannans and
- galactoglucomannans are mannans and glucomannans with alpha- 1,6 linked galactose sidebranches. These compounds may be acetylated. The degradation of galactomannans and galactoglucomannans is facilitated by full or partial removal of the galactose sidebranches. Further the degradation of the acetylated mannans, glucomannans, galactomannans and galactoglucomannans is facilitated by full or partial deacetylation. Acetyl groups can be removed by alkali or by mannan acetylesterases.
- oligomers that are released from the mannanases or by a combination of mannanases and alpha-galactosidase and/or mannan acetyl esterases can be further degraded to release free maltose by ⁇ -mannosidase and/or ⁇ -glucosidase
- catalytic activity or “activity” describes quantitatively the conversion of a given substrate under defined reaction conditions.
- residual activity is defined as the ratio of the catalytic activity of the enzyme under a certain set of conditions to the catalytic activity under a different set of conditions.
- specific activity describes quantitatively the catalytic activity per amount of enzyme under defined reaction conditions.
- pH-stability describes the property of a protein to withstand a limited exposure to pH-values significantly deviating from the pH where its stability is optimal (e.g., more than one pH-unit above or below the pH-optimum, without losing its activity under conditions where its activity is measurable).
- detergent stability refers to the stability of a specified detergent composition component (such as a hydrolytic enzyme) in a detergent composition mixture.
- a “perhydrolase” is an enzyme capable of catalyzing a reaction that results in the formation of a peracid suitable for applications such as cleaning, bleaching, and disinfecting.
- aqueous refers to a composition that is made up of at least 50% water.
- An aqueous composition may contain at least 50% water, at least 60% water, at least 70% water, at least 80% water, at least 90% water, at least 95% water, at least 97% water, at least 99% water, or even at least 99% water.
- surfactant refers to any compound generally recognized in the art as having surface active qualities. Surfactants generally include anionic, cationic, nonionic, and zwitterionic compounds, which are further described, herein.
- surface property is used in reference to electrostatic charge, as well as properties such as the hydrophobicity and hydrophilicity exhibited by the surface of a protein.
- oxidation stability refers to endo-P-mannanases of the present disclosure that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the mannosidic, hydrolyzing, cleaning, or other process disclosed herein, for example while exposed to or contacted with bleaching agents or oxidizing agents.
- the endo-P-mannanases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% endo-P-mannanase activity after contact with a bleaching or oxidizing agent over a given time period, for example, at least about 1 minute, about 3 minutes, about 5 minutes, about 8 minutes, about 12 minutes, about 16 minutes, about 20 minutes, etc.
- chelator stability refers to endo-P-mannanases of the present disclosure that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the mannosidic, hydrolyzing, cleaning, or other process disclosed herein, for example while exposed to or contacted with chelating agents.
- the endo- P-mannanases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% endo-P-mannanase activity after contact with a chelating agent over a given time period, for example, at least about 10 minutes, about 20 minutes, about 40 minutes, about 60 minutes, about 100 minutes, etc.
- thermo stability and “thermostable” refer to endo-P-mannanases of the present disclosure that retain a specified amount of enzymatic activity after exposure to identified temperatures over a given period of time under conditions prevailing during the mannosidic, hydrolyzing, cleaning, or other process disclosed herein, for example, while exposed to altered temperatures. Altered temperatures include increased or decreased temperatures.
- the endo-P-mannanases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% endo-P-mannanase activity after exposure to altered temperatures over a given time period, for example, at least about 60 minutes, about 120 minutes, about 180 minutes, about 240 minutes, about 300 minutes, etc.
- cleaning activity refers to the cleaning performance achieved by the endo-P-mannanase under conditions prevailing during the mannosidic, hydrolyzing, cleaning, or other process disclosed herein.
- cleaning performance is determined by the application of various cleaning assays concerning enzyme sensitive stains arising from food products, household agents or personal care products.
- Some of these stains include, for example, ice cream, ketchup, BBQ sauce, mayonnaise, soups, chocolate milk, chocolate pudding, frozen desserts, shampoo, body lotion, sun protection products, toothpaste, locust bean gum, or guar gum as determined by various chromatographic, spectrophotometric or other quantitative methodologies after subjection of the stains to standard wash conditions.
- Exemplary assays include, but are not limited to those described in WO 99/34011, U.S. Pat. No. 6,605,458, and U.S. Pat. No. 6,566,114 (all of which are herein incorporated by reference), as well as those methods included in the Examples.
- cleaning surface and “clean textile” refer to a surface or textile respectively that has a percent stain removal of at least 10%, preferably at least 15%, 20%, 25%, 30%, 35%, or 40% of a soiled surface or textile.
- cleaning effective amount of an endo-P-mannanase refers to the quantity of endo-P-mannanase described herein that achieves a desired level of enzymatic activity in a specific cleaning composition. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular endo-P-mannanase used, the cleaning application, the specific composition of the cleaning composition, and whether a liquid or dry (e.g. , granular, bar, powder, solid, liquid, tablet, gel, paste, foam, sheet, or unit dose) composition is required, etc.
- a liquid or dry composition e.g. , granular, bar, powder, solid, liquid, tablet, gel, paste, foam, sheet, or unit dose
- cleaning adjunct materials means any liquid, solid or gaseous material selected for the particular type of cleaning composition desired and the form of the product (e.g. , liquid, granule, powder, bar, paste, spray, tablet, gel, unit dose, sheet, or foam composition), which materials are also preferably compatible with the endo-P-mannanase enzyme used in the composition.
- granular compositions are in
- cleaning compositions and “cleaning formulations” refer to admixtures of chemical ingredients that find use in the removal of undesired compounds (e.g. , soil or stains) from items to be cleaned, such as fabric, dishes, contact lenses, other solid surfaces, hair, skin, teeth, and the like.
- the compositions or formulations may be in the form of a liquid, gel, granule, powder, bar, paste, spray tablet, gel, unit dose, sheet, or foam, depending on the surface, item or fabric to be cleaned and the desired form of the composition or formulation.
- the terms "detergent composition” and “detergent formulation” refer to mixtures of chemical ingredients intended for use in a wash medium for the cleaning of soiled objects.
- Detergent compositions/formulations generally include at least one surfactant, and may optionally include hydrolytic enzymes, oxido-reductases, builders, bleaching agents, bleach activators, bluing agents and fluorescent dyes, caking inhibitors, masking agents, enzyme activators, antioxidants, and solubilizers.
- dishwashing composition refers to all forms of compositions for cleaning dishware, including cutlery, including but not limited to granular and liquid forms.
- the dishwashing composition is an "automatic dishwashing" composition that finds use in automatic dish washing machines. It is not intended that the present disclosure be limited to any particular type or dishware composition. Indeed, the present disclosure finds use in cleaning dishware (e.g.
- dishes including, but not limited to plates, cups, glasses, bowls, etc.
- cutlery e.g., utensils including, but not limited to spoons, knives, forks, serving utensils, etc.
- utensils including, but not limited to spoons, knives, forks, serving utensils, etc.
- the term "dishware" is used herein in reference to both dishes and cutlery.
- bleaching refers to the treatment of a material (e.g., fabric, laundry, pulp, etc.) or surface for a sufficient length of time and under appropriate pH and temperature conditions to effect a brightening (i.e. , whitening) and/or cleaning of the material.
- a material e.g., fabric, laundry, pulp, etc.
- chemicals suitable for bleaching include but are not limited to C10 2 , H 2 0 2 , peracids, N0 2 , etc.
- wash performance of a variant endo-P-mannanase refers to the contribution of a variant endo-P-mannanase to washing that provides additional cleaning performance to the detergent composition. Wash performance is compared under relevant washing conditions.
- relevant washing conditions is used herein to indicate the conditions, particularly washing temperature, time, washing mechanics, sud concentration, type of detergent, and water hardness, actually used in households in a dish or laundry detergent market segment.
- the term "disinfecting” refers to the removal of contaminants from the surfaces, as well as the inhibition or killing of microbes on the surfaces of items. It is not intended that the present disclosure be limited to any particular surface, item, or contaminant(s) or microbes to be removed.
- inorganic filler salts are conventional ingredients of detergent compositions in powder form.
- the filler salts are present in substantial amounts, typically about 17 to about 35% by weight of the total composition.
- the filler salt is present in amounts not exceeding about 15% of the total composition.
- the filler salt is present in amounts that do not exceed about 10%, or more preferably, about 5%, by weight of the composition.
- the inorganic filler salts are selected from the alkali and alkaline-earth-metal salts of sulfates and chlorides.
- a preferred filler salt is sodium sulfate.
- textile or “textile material” refer to woven fabrics, as well as staple fibers and filaments suitable for conversion to or use as yarns, woven, knit, and non-woven fabrics.
- the term encompasses yarns made from natural, as well as synthetic (e.g.,
- a nucleic acid or polynucleotide is “isolated” when it is at least partially or completely separated from other components, including but not limited to for example, other proteins, nucleic acids, cells, etc.
- a polypeptide, protein or peptide is “isolated” when it is at least partially or completely separated from other components, including but not limited to for example, other proteins, nucleic acids, cells, etc.
- an isolated species is more abundant than are other species in a composition.
- an isolated species may comprise at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% (on a molar basis) of all macromolecular species present.
- the species of interest is purified to essential homogeneity (i.e., contaminant species cannot be detected in the composition by conventional detection methods).
- Purity and homogeneity can be determined using a number of techniques well known in the art, such as agarose or polyacrylamide gel electrophoresis of a nucleic acid or a protein sample, respectively, followed by visualization upon staining.
- a high-resolution technique such as high performance liquid chromatography (HPLC) or a similar means can be utilized for purification of the material.
- HPLC high performance liquid chromatography
- nucleic acids or polypeptides generally denotes a nucleic acid or polypeptide that is essentially free from other components as determined by analytical techniques well known in the art (e.g., a purified polypeptide or polynucleotide forms a discrete band in an electrophoretic gel, chromatographic eluate, and/or a media subjected to density gradient centrifugation).
- a nucleic acid or polypeptide that gives rise to essentially one band in an electrophoretic gel is "purified.”
- a purified nucleic acid or polypeptide is at least about 50% pure, usually at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 99.6%, about 99.7%, about 99.8% or more pure (e.g., percent by weight on a molar basis).
- a composition is enriched for a molecule when there is a substantial increase in the concentration of the molecule after application of a purification or enrichment technique.
- enriched refers to a compound, polypeptide, cell, nucleic acid, amino acid, or other specified material or component that is present in a composition at a relative or absolute concentration that is higher than a starting composition.
- polypeptide refers to a molecule comprising a plurality of amino acids linked through peptide bonds.
- polypeptide refers to a molecule comprising a plurality of amino acids linked through peptide bonds.
- proteins may optionally be modified (e.g., glycosylated, phosphorylated, acylated, farnesylated, prenylated, sulfonated, and the like) to add functionality. Where such amino acid sequences exhibit activity, they may be referred to as an "enzyme.”
- the conventional one-letter or three-letter codes for amino acid residues are used, with amino acid sequences being presented in the standard amino-to-carboxy terminal orientation (i.e., N ⁇ C).
- polynucleotide encompasses DNA, RNA, heteroduplexes, and synthetic molecules capable of encoding a polypeptide. Nucleic acids may be single-stranded or double- stranded, and may have chemical modifications. The terms “nucleic acid” and “polynucleotide” are used interchangeably. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the present compositions and methods encompass nucleotide sequences which encode a particular amino acid sequence. Unless otherwise indicated, nucleic acid sequences are presented in a 5'-to-3' orientation.
- wild- type and “native” refer to polypeptides or polynucleotides that are found in nature.
- wild-type refers to a naturally- occurring polypeptide that does not include a man-made substitution, insertion, or deletion at one or more amino acid positions.
- wild-type refers to a naturally-occurring polynucleotide that does not include a man-made nucleoside change.
- a polynucleotide encoding a wild-type, parental, or reference polypeptide is not limited to a naturally-occurring polynucleotide, and encompasses any polynucleotide encoding the wild- type, parental, or reference polypeptide.
- a "variant polypeptide” refers to a polypeptide that is derived from a parent (or reference) polypeptide by the substitution, addition, or deletion, of one or more amino acids, typically by recombinant DNA techniques. Variant polypeptides may differ from a parent polypeptide by a small number of amino acid residues and may be defined by their level of primary amino acid sequence homology/identity with a parent polypeptide.
- variant polypeptides have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99% amino acid sequence identity with a parent polypeptide.
- Sequence identity may be determined using known programs such as BLAST, ALIGN, and CLUSTAL using standard parameters. (See, e.g., Altschul et al. [1990] J. Mol. Biol. 215:403-410; Henikoff et al. [1989] Proc. Natl. Acad. Sci. USA 89: 10915; Karin et al.
- polypeptides are substantially identical.
- the first polypeptide is immunologically cross-reactive with the second polypeptide.
- polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive.
- a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution. .
- a variant polynucleotide encodes a variant polypeptide, has a specified degree of homology/identity with a parent polynucleotide, or hybridizes under stringent conditions to a parent polynucleotide or the complement, thereof.
- a variant polynucleotide has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99% nucleotide sequence identity with a parent polynucleotide. Methods for determining percent identity are known in the art and described immediately above.
- derived from encompasses the terms “originated from,” “obtained from,” “obtainable from,” “isolated from,” and “created from,” and generally indicates that one specified material find its origin in another specified material or has features that can be described with reference to the another specified material.
- hybridization refers to the process by which a strand of nucleic acid joins with a complementary strand through base pairing, as known in the art.
- hybridization conditions refers to the conditions under which hybridization reactions are conducted. These conditions are typically classified by degree of “stringency” of the conditions under which hybridization is measured.
- the degree of stringency can be based, for example, on the melting temperature (Tm) of the nucleic acid binding complex or probe.
- Tm melting temperature
- maximum stringency typically occurs at about Tm-5 °C (5° below the Tm of the probe); “high stringency” at about 5-10° below the Tm;
- maximum stringency conditions may be used to identify nucleic acid sequences having strict identity or near-strict identity with the hybridization probe; while high stringency conditions are used to identify nucleic acid sequences having about 80% or more sequence identity with the probe.
- phrases "substantially similar” and “substantially identical” in the context of at least two nucleic acids or polypeptides means that a polynucleotide or polypeptide comprises a sequence that has at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identical to a parent or reference sequence, or does not include amino acid substitutions, insertions, deletions, or modifications made only to circumvent the present description without adding functionality.
- an "expression vector” refers to a DNA construct containing a DNA sequence that encodes a specified polypeptide and is operably linked to a suitable control sequence capable of effecting the expression of the polypeptides in a suitable host.
- control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites and sequences which control termination of transcription and translation.
- the vector may be a plasmid, a phage particle, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself.
- recombinant refers to genetic material (i.e., nucleic acids, the
- nucleic acids, polypeptides, and cells based thereon have been manipulated by man such that they are not identical to related nucleic acids, polypeptides, and cells found in nature.
- a "signal sequence” refers to a sequence of amino acids bound to the N-terminal portion of a polypeptide, and which facilitates the secretion of the mature form of the protein from the cell.
- the mature form of the extracellular protein lacks the signal sequence which is cleaved off during the secretion process.
- selectable marker refers to a gene capable of expression in a host cell that allows for ease of selection of those hosts containing an introduced nucleic acid or vector. Examples of selectable markers include but are not limited to
- antimicrobial substances e.g., hygromycin, bleomycin, or chloramphenicol
- genes that confer a metabolic advantage such as a nutritional advantage, on the host cell.
- selectable marker or “selectable gene product” as used herein refer to the use of a gene, which encodes an enzymatic activity that confers resistance to an antibiotic or drug upon the cell in which the selectable marker is expressed.
- regulatory element refers to a genetic element that controls some aspect of the expression of nucleic acid sequences.
- a promoter is a regulatory element which facilitates the initiation of transcription of an operably linked coding region. Additional regulatory elements include splicing signals, polyadenylation signals and termination signals.
- host cells are generally prokaryotic or eukaryotic hosts which are transformed or transfected with vectors constructed using recombinant DNA techniques known in the art. Transformed host cells are capable of either replicating vectors encoding the protein variants or expressing the desired protein variant. In the case of vectors which encode the pre- or pro-form of the protein variant, such variants, when expressed, are typically secreted from the host cell into the host cell medium.
- the term "introduced" in the context of inserting a nucleic acid sequence into a cell means transformation, transduction or transfection.
- Means of transformation include protoplast transformation, calcium chloride precipitation, electroporation, naked DNA, and the like as known in the art. (See, Chang and Cohen [1979] Mol. Gen. Genet. 168: 111-115; Smith et al.
- One embodiment is directed to an NDL-Clade comprising a polypeptide or fragment, active fragment, or variant thereof, described herein.
- Another embodiment is directed to an NDL-Clade comprising a recombinant polypeptide or fragment, active fragment, or variant thereof, described herein.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof is an endo-P-mannanase.
- polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof, described herein contains Asn33-Asp-34-Leu35 (NDL), wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on conserved linear sequence numbering.
- NDL Asn33-Asp-34-Leu35
- composition or method described herein comprise a polypepetide or recombinant polypeptide or fragment, active fragment, or variant thereof, in the NDL-Clade.
- a polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof described herein is used in the methods or compsitions described herein.
- the present compositions and methods provide a recombinant endo- ⁇ - mannanase polypeptide or fragment, active fragment, or variant thereof, in the NDL-Clade.
- the present compositions and methods comprise a recombinant endo- ⁇ - mannanase polypeptide or fragment, active fragment, or variant thereof, in the NDL-Clade.
- the present compositions and methods comprise a endo-P-mannanase polypeptide or fragment, active fragment, or variant thereof, in the NDL-Clade.
- a still further aspect is directed to a polypeptide or recombinant polypeptide endo-P-mannanase.
- NDL-Clade or fragment, active fragment, or variant thereof, in the NDL-Clade.
- One embodiment is directed to an NDL- Clade of endo-P-mannanase polypeptides.
- Another embodiment is directed to an NDL-Clade 1 of endo-P-mannanase polypeptides.
- Yet another embodiment is directed to an NDL-Clade 2 of endo-P-mannanase polypeptides.
- NDL-Clade 3 of endo-P-mannanase polypeptides.
- the NDL-Clade comprises an Asn33-Asp-34-Leu35, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- the NDL-Clade comprises a WXaKNDLXXAI motif at positions 30-38, wherein X a is F or Y and X is any amino acid, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- the NDL-Clade comprises a WX a KNDLX b X c AI motif at positions 30-38, wherein X a is F or Y, X is N, Y or A, and X c is A or T, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- the NDL-Clade comprises a L 262 D 263 XXXGPXGXL 272 T 273 , motif at positions 262-273, where X is any amino acid and wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- the NDL-Clade comprises a L 262 D 263 M/LV/AT/AGPX 1 GX 2 L 272 T 273 motif at positions 262-273, where is N, A or S and X2 is S, T or N, and wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- NDL-Clade 1 comprises a LDM/LATGPN/AGS/TLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- NDL-Clade 2 comprises an LDLA/VA/TGPS/NGNLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- NDL-Clade 3 comprises an LDL/VS/AT/NGPSGNLT motif at positions 262-273, wherein the amino acid positions of the polypeptide are numbered by correspondence with the amino sequence set forth in SEQ ID NO:32 and are based on the conserved linear sequence numbering.
- compositions and methods provide a Paenibacillus or Bacillus spp. endo-P-mannanase polypeptide or fragment, active fragment, or variant thereof described herein.
- Exemplary Paenibacillus or Bacillus spp. polypeptides include BciManl (SEQ ID NO:2) isolated from B. circulans K-l, BciMan3 (SEQ ID NO:4) isolated from B. circulans 196, BciMan4 (SEQ ID NO:6) isolated from B.
- PspMan4 polypeptides are encompassed by the present compositions and methods.
- polypeptide or a recombinant polypeptide or fragment, active fragment, or variant thereof described herein comprising an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- Another embodiment is directed a recombinant polypeptide or fragment, active fragment, or variant thereof described herein comprising an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- SEQ ID NO: 2 amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, comprising an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, and 60.
- SEQ ID NO: 2 amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14,
- an NDL-Clade polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade 1 recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 1 polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 2 polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 2 recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 3 polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- an NDL-Clade 3 recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above has at least 70% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprises an amino acid sequence having at least 70% identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade 1 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 70% identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 2 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprises an amino acid sequence having at least 70% identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 3 polyppeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprises an amino acid sequence having at least 70% identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above has at least 80% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 80% identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade 1 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 80% identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 2 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 80% identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 3 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 80% identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above has at least 90% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 90% identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade 1 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 90% identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 2 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 90% identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 3 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 90% identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- the polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above has at least 95% identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 95% identity to an amino acid sequence selected from SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- an NDL-Clade 1 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 95% identity to an amino acid sequence selected from SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- an NDL-Clade 2 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 95% identity to an amino acid sequence selected from SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- an NDL-Clade 3 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof further comprises an amino acid sequence having at least 95% identity to an amino acid sequence selected from SEQ ID NO: 74 and 81.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, and 60.
- the invention is a polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- the invention is an NDL-Clade polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- the invention is an NDL-Clade 1 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71.
- the invention is an NDL-Clade 2 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73.
- the invention is an NDL-Clade 3 polypeptide or recombinant polypeptide or fragment, active fragment, or variant thereof comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 74 and 81.
- Sequence identity can be determined by amino acid sequence alignment, e.g., using a program such as BLAST, ALIGN, or CLUSTAL, as described herein.
- the polypeptides of the present invention are isolated polypeptides.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has mannanase activity.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has mannanase activity.
- the mannanase activity is activity on mannan gum.
- the mannanase activity is activity on locust bean gum galactomannan.
- the mannanase activity is activity on konjac glucomannan.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the mannanase activity is in the presence of a surfactant.
- the invention is a recombinant polypeptide or an active fragment thereof of any of the above described embodiments, wherein the mannanase activity is in the presence of a surfactant.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 4.5-9.0.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 4.5-9.0.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 5.5-8.5.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 5.5-8.5.
- the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 6.0-7.5.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH range of 6.0-7.5. In some embodiments, the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH above 3.0, 3.5, 4.0 or 4.5.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH above 3.0, 3.5, 4.0 or 4.5.
- the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH below 10.0, 9.5, or 9.0.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a pH below 10.0, 9.5, or 9.0.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature range of 40°C to 70°C. In some embodiments, the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature range of 45 °C to 65 °C.
- the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature range of 50°C to 60°C. In some embodiments, the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature above 20°C, 25°C, 30°C, 35°C, or 40°C.
- the invention is a polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature below 90°C, 85°C, 80°C, 75°C, or 70°C.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the
- polypeptide retains at least 70% of its maximal protease activity at a temperature range of 40°C to 70°C.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature range of 45°C to 65°C.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature range of 50°C to 60°C.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature above 20°C, 25°C, 30°C, 35°C, or 40°C.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereofof any of the above described embodiments, wherein the polypeptide retains at least 70% of its maximal protease activity at a temperature below 90°C, 85°C, 80°C, 75°C, or 70°C.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has cleaning activity in a detergent composition.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has cleaning activity in a detergent
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has cleaning activity in a detergent composition.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has mannanase activity in the presence of a protease.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide is capable of hydrolyzing a substrate selected from the group consisting of guar gum, locust bean gum, and combinations thereof.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has cleaning activity in a detergent composition.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide has mannanase activity in the presence of a protease.
- the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide is capable of hydrolyzing a substrate selected from the group consisting of guar gum, locust bean gum, and combinations thereof.
- the invention is a polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide does not further comprise a carbohydrate-binding module. In some embodiments, the invention is a recombinant polypeptide or fragment, active fragment, or variant thereof of any of the above described embodiments, wherein the polypeptide does not further comprise a carbohydrate- binding module.
- polypeptides of the present invention are produced recombinantly, while in others the polypeptides of the present invention are produced synthetically, or are purified from a native source.
- the polypeptide of the present invention includes substitutions that do not substantially affect the structure and/or function of the polypeptide.
- Exemplary substitutions are conservative mutations, as summarized in Table I.
- Substitutions involving naturally occurring amino acids are generally made by mutating a nucleic acid encoding a recombinant a polypeptide of the present invention, and then expressing the variant polypeptide in an organism.
- Substitutions involving non-naturally occurring amino acids or chemical modifications to amino acids are generally made by chemically modifying a recombinant a polypeptide of the present invention after it has been synthesized by an organism.
- variant isolated polypeptides of the present invention are substantially identical to SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, or 60, meaning that they do not include amino acid substitutions, insertions, or deletions that do not significantly affect the structure, function, or expression of the polypeptide.
- variant isolated polypeptides of the present invention are substantially identical to SEQ ID NO: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81, meaning that they do not include amino acid substitutions, insertions, or deletions that do not significantly affect the structure, function, or expression of the polypeptide.
- variant isolated polypeptides of the present invention are substantially identical to SEQ ID NO: SEQ ID NO: SEQ ID NO: 6, 12, 14, 16, 17, 19, 21, 23, 24, 34, 35, 36, 38, 39, 40, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, and 71, meaning that they do not include amino acid substitutions, insertions, or deletions that do not significantly affect the structure, function, or expression of the polypeptide.
- variant isolated polypeptides of the present invention are substantially identical to SEQ ID NO: 4, 8, 10, 30, 31, 32, 42, 43, 44, 46, 47, 48, 72, and 73, meaning that they do not include amino acid substitutions, insertions, or deletions that do not significantly affect the structure, function, or expression of the polypeptide.
- variant isolated polypeptides of the present invention are substantially identical to SEQ ID NO: 74 and 81, meaning that they do not include amino acid substitutions, insertions, or deletions that do not significantly affect the structure, function, or expression of the polypeptide.
- Such variant isolated a polypeptide of the present inventions include those designed only to circumvent the present description.
- a polypeptide of the present invention (including a variant thereof) has l,4-P-D-mannosidic hydrolase activity, which includes mannanase, endo- l,4-P-D- mannanase, exo- l,4-P-D-mannanasegalactomannanase, and/or glucomannanase activity.
- 1,4- ⁇ - D-mannosidic hydrolase activity can be determined and measured using the assays described herein, or by other assays known in the art.
- a polypeptide of the present invention has activity in the presence of a detergent composition.
- a polypeptide of the present invention include fragments of "full-length" polypeptides that retain l ,4-P-D-mannosidic hydrolase activity. Such fragments preferably retain the active site of the full-length polypeptides but may have deletions of non-critical amino acid residues. The activity of fragments can readily be determined using the assays described, herein, or by other assays known in the art. In some embodiments, the fragments of a polypeptide of the present invention retain l,4-P-D-mannosidic hydrolase activity in the presence of a detergent composition.
- a polypeptide of the present invention's amino acid sequences and derivatives are produced as a N- and/or C-terminal fusion protein, for example to aid in extraction, detection and/or purification and/or to add functional properties to a polypeptide of the present invention.
- fusion protein partners include, but are not limited to, glutathione-S-transferase (GST), 6XHis, GAL4 (DNA binding and/or transcriptional activation domains), FLAG, MYC, BCE103 (WO 2010/044786), or other tags well known to anyone skilled in the art.
- GST glutathione-S-transferase
- 6XHis DNA binding and/or transcriptional activation domains
- FLAG FLAG
- MYC MYC
- BCE103 WO 2010/044786
- a proteolytic cleavage site is provided between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences.
- the fusion protein does not hinder the activity of
- a polypeptide of the present invention is fused to a functional domain including a leader peptide, propeptide, one or more binding domain (modules) and/or catalytic domain.
- Suitable binding domains include, but are not limited to, carbohydrate-binding modules (e.g. , CBM) of various specificities, providing increased affinity to carbohydrate components present during the application of a polypeptide of the present invention.
- CBM carbohydrate-binding modules
- the CBM and catalytic domain of a polypeptide of the present invention are operably linked.
- a carbohydrate-binding module is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity.
- CBMs in cellulosomal scaffoldin proteins and rare instances of independent putative CBMs.
- the requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins.
- CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose (Tomme et al., Eur J Biochem, 170:575-581, 1988; and Gilkes et al., J Biol
- Types Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or
- Type II CBDs In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII (Tomme et al., in Enzymatic Degradation of Insoluble Polysaccharides (Saddler, J.N. & Penner, M., eds.), Cellulose-binding domains: classification and properties, pp. 142-163, American Chemical Society, Washington, 1995). A detailed review on the structure and binding modes of CBMs can be found in (Boraston et al., Biochem J, 382:769-81, 2004).
- CBMs The family classification of CBMs is expected to: aid in the identification of CBMs, in some cases, predict binding specificity, aid in identifying functional residues, reveal evolutionary relationships and possibly be predictive of polypeptide folds. Because the fold of proteins is better conserved than their sequences, some of the CBM families can be grouped into superfamilies or clans. The current CBM families are 1-63. CBMs/CBDs have also been found in algae, e.g., the red alga Porphyra purpurea as a non-hydrolytic polysaccharide-binding protein. However, most of the CBDs are from cellullases and xylanases. CBDs are found at the N-and C-termini of proteins or are internal.
- Enzyme hybrids are known in the art (See e.g., WO 90/00609 and WO 95/16782) and may be prepared by transforming into a host cell a DNA construct comprising at least a fragment of DNA encoding the cellulose-binding domain ligated, with or without a linker, to a DNA sequence encoding a disclosed polypeptide of the present invention and growing the host cell to express the fused gene.
- Enzyme hybrids may be described by the following formula: CBM-MR-X or X-MR-CBM
- the CBM is the N-terminal or the C-terminal region of an amino acid sequence corresponding to at least the carbohydrate-binding module;
- MR is the middle region (the linker), and may be a bond, or a short linking group preferably of from about 2 to about 100 carbon atoms, more preferably of from 2 to 40 carbon atoms; or is preferably from about 2 to about 100 amino acids, more preferably from 2 to 40 amino acids;
- X is an N-terminal or C-terminal region of a polypeptide of the present invention having mannanase catalytic activity.
- a mannanase may contain more than one CBM or other module(s)/domain(s) of non-glycolytic function.
- module and “domain” are used interchangeably in the present disclosure.
- Suitable enzymatically active domains possess an activity that supports the action of a polypeptide of the present invention in producing the desired product.
- catalytic domains include: cellulases, hemicellulases such as xylanase, exo-mannanases, glucanases, arabinases, galactosidases, pectinases, and/or other activities such as proteases, lipases, acid phosphatases and/or others or functional fragments thereof.
- Fusion proteins are optionally linked to a polypeptide of the present invention through a linker sequence that simply joins a polypeptide of the present invention and the fusion domain without significantly affecting the properties of either component, or the linker optionally has a functional importance for the intended application.
- polypeptides of the present invention described herein are used in conjunction with one or more additional proteins of interest.
- proteins of interest include: acyl transferases, amylases, alpha-amylases, beta-amylases, alpha- galactosidases, arabinases, arabinosidases, aryl esterases, beta-galactosidases, beta-glucanases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, exo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, lign
- rhamnogalacturonases beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, xylosidases, metalloproteases and/or other enzymes.
- a polypeptide of the present invention is fused to a signal peptide for directing the extracellular secretion of a polypeptide of the present invention.
- the signal peptide is the native signal peptide of a polypeptide of the present invention.
- the signal peptide is a non-native signal peptide such as the B. subtilis AprE signal peptide.
- a polypeptide of the present invention has an N-terminal extension of Ala-Gly-Lys between the mature form and the signal peptide.
- a polypeptide of the present invention is expressed in a heterologous organism, i.e., an organism other than Paenibacillus and Bacillus spp.
- exemplary heterologous organisms are Gram(+) bacteria such as Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus (formerly Bacillus) stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulans, Bacillus lautus, Bacillus megaterium, Bacillus thuringiensis, Streptomyces lividans, or Streptomyces murinus; Gram(-) bacteria such as Escherichia coli.; yeast such as Saccharomyces spp.
- Schizosaccharomyces spp. e.g. Saccharomyces cerevisiae
- filamentous fungi such as Aspergillus spp., e.g., Aspergillus oryzae or Aspergillus niger, and Trichoderma reesei.
- a polypeptide of the present invention is expressed in a heterologous organism as a secreted polypeptide, in which case, the compositions and method encompass a method for expressing a polypeptide of the present invention as a secreted polypeptide in a heterologous organism.
- polynucleotide that encodes a polypeptide of the present invention (including variants and fragments thereof).
- the polynucleotide is provided in the context of an expression vector for directing the expression of a polypeptide of the present invention in a heterologous organism, such as those identified, herein.
- the polynucleotide that encodes a polypeptide of the present invention may be operably-linked to regulatory elements (e.g., a promoter, terminator, enhancer, and the like) to assist in expressing the encoded polypeptides.
- Exemplary polynucleotide sequences encoding a polypeptide of the present invention has the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61 or 64.
- Exemplary polynucleotide sequences encoding a polypeptide of the present invention has the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, or 57.
- Similar, including substantially identical, polynucleotides encoding a polypeptide of the present invention and variants may occur in nature, e.g., in other strains or isolates of B.
- polynucleotides having different nucleotide sequences may encode the same a polypeptide of the present inventions, variants, or fragments.
- polynucleotides encoding a polypeptide of the present invention have a specified degree of amino acid sequence identity to the exemplified
- polynucleotide encoding a polypeptide of the present invention e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to the amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 60, 62, 63, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, and 81.
- polynucleotides encoding a polypeptide of the present invention have a specified degree of amino acid sequence identity to the exemplified polynucleotide encoding a
- polypeptide of the present invention e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 34, 35, 36, 38, 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, and 60.
- Homology can be determined by amino acid sequence alignment, e.g., using a program such as BLAST, ALIGN, or CLUSTAL, as described herein.
- polynucleotides can have a specified degree of nucleotide sequence identity to the exemplified polynucleotides of the present invention, e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61 or 64.
- polynucleotides can have a specified degree of nucleotide sequence identity to the exemplified polynucleotides of the present invention, e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, or 57.
- Homology can be determined by amino acid sequence alignment, e.g., using a program such as BLAST, ALIGN, or CLUSTAL, as described herein.
- the polynucleotide that encodes a polypeptide of the present invention is fused in frame behind ⁇ i.e., downstream of) a coding sequence for a signal peptide for directing the extracellular secretion of a polypeptide of the present invention.
- Heterologous signal sequences include those from bacterial cellulase genes.
- Expression vectors may be provided in a heterologous host cell suitable for expressing a polypeptide of the present invention, or suitable for propagating the expression vector prior to introducing it into a suitable host cell.
- polynucleotides encoding a polypeptide of the present invention hybridize to the exemplary polynucleotide of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61 or 64 (or the complement thereof) under specified hybridization conditions.
- polynucleotides encoding a polypeptide of the present invention hybridize to the exemplary polynucleotide of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 18, 20, 22, 25, 29, 33, 37, 41, 45, 49, 53, or 57 (or the complement thereof) under specified hybridization conditions.
- Exemplary conditions are stringent condition and highly stringent conditions, which are described, herein.
- a polynucleotide of the present invention may be naturally occurring or synthetic (i.e., man-made), and may be codon-optimized for expression in a different host, mutated to introduce cloning sites, or otherwise altered to add functionality.
- the DNA encoding the polypeptide can be chemically synthesized from published sequences or obtained directly from host cells harboring the gene (e.g., by cDNA library screening or PCR
- a polynucleotide of the present invention is included in an expression cassette and/or cloned into a suitable expression vector by standard molecular cloning techniques.
- Such expression cassettes or vectors contain sequences that assist initiation and termination of transcription (e.g., promoters and terminators), and generally contain a selectable marker.
- the expression cassette or vector is introduced in a suitable expression host cell, which then expresses the corresponding polynucleotide of the present invention.
- suitable expression hosts are bacterial expression host genera including Escherichia (e.g., Escherichia coli), Pseudomonas (e.g., P. fluorescens or P. stutzerei), Proteus (e.g., Proteus mirabilis), Ralstonia (e.g., Ralstonia eutropha), Streptomyces, Staphylococcus (e.g., S.
- yeast expression hosts such as Saccharomyces cerevisiae,
- Schizosaccharomyces pombe, Yarrowia lipolytica, Hansenula polymorpha, Kluyveromyces lactis or Pichia pastoris Especially suited are fungal expression hosts such as Aspergillus niger, Chrysosporium lucknowense, Aspergillus (e.g., A. oryzae, A. niger, A. nidulans, etc.) or Trichoderma reesei.
- mammalian expression hosts such as mouse (e.g., NSO), Chinese Hamster Ovary (CHO) or Baby Hamster Kidney (BHK) cell lines.
- eukaryotic hosts such as insect cells or viral expression systems (e.g., bacteriophages such as M13, T7 phage or Lambda, or viruses such as Baculovirus) are also suitable for producing a polypeptide of the present invention.
- viral expression systems e.g., bacteriophages such as M13, T7 phage or Lambda, or viruses such as Baculovirus
- Promoters and/or signal sequences associated with secreted proteins in a particular host of interest are candidates for use in the heterologous production and secretion of endo- ⁇ - mannanases in that host or in other hosts.
- the promoters that drive the genes for cellobiohydrolase I (cbhl), glucoamylase A (glaA), TAKA- amylase (amyA), xylanase (exlA), the gpd-promoter cbhl, cbhll, endoglucanase genes EGI- EGV, Cel61B, Cel74A, egll-egl5, gpd promoter, Pgkl, pkil, EF-1 alpha, tefl, cDNAl and hexl are particularly suitable and can be derived from a number of different organisms (e.g., A.
- a polynucleotide of the present invention is recombinantly associated with a polynucleotide encoding a suitable homologous or heterologous signal sequence that leads to secretion of a polypeptide of the present invention into the extracellular (or periplasmic) space, thereby allowing direct detection of enzyme activity in the cell supernatant (or periplasmic space or lysate).
- Particularly suitable signal sequences for Escherichia coli, other Gram negative bacteria and other organisms known in the art include those that drive expression of the HlyA, DsbA, Pbp, PhoA, PelB, OmpA, OmpT or Ml 3 phage Gill genes.
- particularly suitable signal sequences further include those that drive expression of the AprE, NprB, Mpr, AmyA, AmyE, Blac, SacB, and for S. cerevisiae or other yeast, include the killer toxin, Barl, Suc2, Mating factor alpha, InulA or Ggplp signal sequence.
- Signal sequences can be cleaved by a number of signal peptidases, thus removing them from the rest of the expressed protein.
- the rest of the polypeptide is expressed alone or as a fusion with other peptides, tags or proteins located at the N- or C- terminus (e.g., 6XHis, HA or FLAG tags).
- Suitable fusions include tags, peptides or proteins that facilitate affinity purification or detection (e.g., BCE103, 6XHis, HA, chitin binding protein, thioredoxin or FLAG tags), as well as those that facilitate expression, secretion or processing of the target endo-P-mannanase.
- Suitable processing sites include enterokinase, STE13, Kex2 or other protease cleavage sites for cleavage in vivo or in vitro.
- Polynucleotides of the present invention can be introduced into expression host cells by a number of transformation methods including, but not limited to, electroporation, lipid- assisted transformation or transfection ("lipofection"), chemically mediated transfection (e.g., CaCl and/or CaP), lithium acetate-mediated transformation (e.g., of host-cell protoplasts), biolistic "gene gun” transformation, PEG-mediated transformation (e.g., of host-cell
- protoplasts protoplasts
- protoplast fusion e.g., using bacterial or eukaryotic protoplasts
- liposome- mediated transformation e.g., using bacterial or eukaryotic protoplasts
- Agrobacterium tumefaciens e.g., adenovirus or other viral or phage transformation or transduction.
- a polypeptide of the present invention can be expressed intracellularly.
- a permeabilisation or lysis step can be used to release the polypeptide into the supernatant.
- the disruption of the membrane barrier is effected by the use of mechanical means such as ultrasonic waves, pressure treatment (French press), cavitation or the use of membrane-digesting enzymes such as lysozyme or enzyme mixtures.
- the polynucleotides encoding the polypeptide can be expressed by use of a suitable cell-free expression system.
- RNA is exogenously added or generated without transcription and translated in cell free systems.
- the polypeptides of the present invention disclosed herein may have enzymatic activity over a broad range of pH conditions.
- the disclosed polypeptides of the present invention have enzymatic activity from about pH 4.0 to about pH 11.0, or from about pH 4.5 to about pH 11.0.
- the polypeptides have substantial enzymatic activity, for example, at least 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity from about pH 4.0 to 11.0, pH 4.5 to 11.0, pH 4.5 to 9.0, pH 5.5 to 8.5, or pH 6.0 to 7.5.
- the pH values described herein may vary by + 0.2. For example a pH value of about 8.0 could vary from pH 7.8 to pH 8.2.
- the polypeptides of the present invention disclosed herein may have enzymatic activity over a wide range of temperatures, e.g., from about 20°C or lower to 90°C, 30°C to 80°C, 40°C to 70°C, 45°C to 65°C, or 50°C to 60°C.
- the polypeptides have substantial enzymatic activity, for example, at least 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity at a temperature range of about 20°C or lower to 90°C, 30°C to 80°C, 40°C to 70°C, 45°C to 65°C, or 50°C to 60°C.
- the temperature values described herein may vary by + 0.2°C.
- a temperature of about 50°C could vary from 49.8°C to 50.2°C.
- compositions and methods disclosed herein is a detergent composition comprising an isolated a polypeptide of the present invention (including variants or fragments, thereof) and methods for using such compositions in cleaning applications.
- Cleaning applications include, but are not limited to, laundry or textile cleaning, laundry or textile softening, dishwashing (manual and automatic), stain pre-treatment, and the like. Particular applications are those where mannans (e.g. , locust bean gum, guar gum, etc.) are a component of the soils or stains to be removed.
- Detergent compositions typically include an effective amount of any of the polypeptides of the present inventions described herein, e.g.
- At least 0.0001 weight percent from about 0.0001 to about 1, from about 0.001 to about 0.5, from about 0.01 to about 0.1 weight percent, or even from about 0.1 to about 1 weight percent, or more.
- An effective amount of a polypeptide of the present invention in the detergent composition results in the polypeptide of the present invention having enzymatic activity sufficient to hydrolyze a mannan- containing substrate, such as locust bean gum, guar gum, or combinations thereof.
- detergent compositions having a concentration from about 0.4 g/L to about 2.2 g/L, from about 0.4 g/L to about 2.0 g/L, from about 0.4 g/L to about 1.7 g/L, from about 0.4 g/L to about 1.5 g/L, from about 0.4 g/L to about 1 g/L, from about 0.4 g/L to about 0.8 g/L, or from about 0.4 g/L to about 0.5 g/L may be mixed with an effective amount of an isolated a polypeptide of the present invention.
- the detergent composition may also be present at a concentration of about 0.4 ml/L to about 2.6 ml/L, from about 0.4 ml/L to about 2.0 ml/L, from about 0.4 ml/L to about 1.5 m/L, from about 0.4 ml/L to about 1 ml/L, from about 0.4 ml/L to about 0.8 ml/L, or from about 0.4 ml/L to about 0.5 ml/L.
- the detergent composition comprises one or more surfactants, which may be non-ionic, semi-polar, anionic, cationic, zwitterionic, or combinations and mixtures thereof.
- the surfactants are typically present at a level of from about 0.1% to 60% by weight.
- Exemplary surfactants include but are not limited to sodium dodecylbenzene sulfonate, C12- 14 pareth-7, C12-15 pareth-7, sodium C12-15 pareth sulfate, C14-15 pareth-4, sodium laureth sulfate (e.g.
- Anionic surfactants that may be used with the detergent compositions described herein include but are not limited to linear alkylbenzenesulfonate (LAS), alpha-olefinsulfonate (AOS), alkyl sulfate (fatty alcohol sulfate) (AS), alcohol ethoxysulfate (AEOS or AES), secondary alkanesulfonates (SAS), alpha-sulfo fatty acid methyl esters, alkyl- or alkenylsuccinic acid, or soap.
- LAS linear alkylbenzenesulfonate
- AOS alpha-olefinsulfonate
- AS alkyl sulfate (fatty alcohol sulfate)
- AEOS or AES alcohol ethoxysulfate
- SAS secondary alkanesulfonates
- alpha-sulfo fatty acid methyl esters alkyl- or alkenylsuccinic acid, or soap.
- nonionic surfactant such as alcohol ethoxylate (AEO or AE), carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamine oxide, ethoxylated fatty acid monoethanolamide, fatty acid
- AEO or AE alcohol ethoxylate
- carboxylated alcohol ethoxylates such as carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamine oxide, ethoxylated fatty acid monoethanolamide, fatty acid
- Nonionic surfactants that may be used with the detergent compositions described herein include but are not limited to polyoxyethylene esters of fatty acids, polyoxyethylene sorbitan esters (e.g. , TWEENs), polyoxyethylene alcohols, polyoxyethylene isoalcohols, polyoxyethylene ethers (e.g.
- polyoxyethylene esters polyoxyethylene-/?- tert-octylphenols or octylphenyl-ethylene oxide condensates (e.g., NONIDET P40), ethylene oxide condensates with fatty alcohols (e.g., LUBROL), polyoxyethylene nonylphenols, polyalkylene glycols (SYNPERONIC F108), sugar-based surfactants (e.g. , glycopyranosides, thioglycopyranosides), and combinations and mixtures thereof.
- polyoxyethylene esters polyoxyethylene-/?- tert-octylphenols or octylphenyl-ethylene oxide condensates
- ethylene oxide condensates with fatty alcohols e.g., LUBROL
- polyoxyethylene nonylphenols polyalkylene glycols
- sugar-based surfactants e.g. , glycopyranosides, thioglycopyranosides
- the detergent compositions disclosed herein may have mixtures that include, but are not limited to 5- 15% anionic surfactants, ⁇ 5% nonionic surfactants, cationic surfactants, phosphonates, soap, enzymes, perfume, butylphenyl methylptopionate, geraniol, zeolite, polycarboxylates, hexyl cinnamal, limonene, cationic surfactants, citronellol, and
- Detergent compositions may additionally include one or more detergent builders or builder systems, a complexing agent, a polymer, a bleaching system, a stabilizer, a foam booster, a suds suppressor, an anti-corrosion agent, a soil- suspending agent, an anti-soil redeposition agent, a dye, a bactericide, a hydrotope, a tarnish inhibitor, an optical brightener, a fabric conditioner, and a perfume.
- the detergent compositions may also include enzymes, including but not limited to proteases, amylases, cellulases, lipases, pectin degrading enzymes, xyloglucanases, or additional carboxylic ester hydrolases.
- the pH of the detergent compositions should be neutral to basic, as described herein.
- the detergent compositions comprise at least about 1 %, from about 3% to about 60% or even from about 5% to about 40% builder by weight of the cleaning composition.
- Builders may include, but are not limited to, the alkali metals, ammonium and alkanolammonium salts of polyphosphates, alkali metal silicates, alkaline earth and alkali metal carbonates, aluminosilicates, polycarboxylate compounds, ether hydroxypolycarboxylates, copolymers of maleic anhydride with ethylene or vinyl methyl ether, 1, 3, 5-trihydroxy benzene-2, 4, 6-trisulphonic acid, and carboxymethyloxysuccinic acid, the various alkali metals, ammonium and substituted ammonium salts of polyacetic acids such as ethylenediamine tetraacetic acid and nitrilotriacetic acid, as well as polycarboxylates such as mellitic acid,
- the builders form water-soluble hardness ion complexes (e.g. , sequestering builders), such as citrates and polyphosphates (e.g. , sodium tripolyphosphate and sodium tripolyphospate hexahydrate, potassium tripolyphosphate, and mixed sodium and potassium tripolyphosphate, etc.). It is contemplated that any suitable builder will find use in the present disclosure, including those known in the art (See, e.g. , EP 2 100 949).
- water-soluble hardness ion complexes e.g. , sequestering builders
- citrates and polyphosphates e.g. , sodium tripolyphosphate and sodium tripolyphospate hexahydrate, potassium tripolyphosphate, and mixed sodium and potassium tripolyphosphate, etc.
- any suitable builder will find use in the present disclosure, including those known in the art (See, e.g. , EP 2 100 949).
- the cleaning compositions described herein further comprise adjunct materials including, but not limited to surfactants, builders, bleaches, bleach activators, bleach catalysts, other enzymes, enzyme stabilizing systems, chelants, optical brighteners, soil release polymers, dye transfer agents, dispersants, suds suppressors, dyes, perfumes, colorants, filler salts, hydrotropes, photoactivators, fluorescers, fabric conditioners, hydrolyzable surfactants, preservatives, anti-oxidants, anti- shrinkage agents, anti-wrinkle agents, germicides, fungicides, color speckles, silvercare, anti-tarnish and/or anti- corrosion agents, alkalinity sources, solubilizing agents, carriers, processing aids, pigments, and pH control agents (See, e.g. , U.S. Pat. Nos. 6,610,642; 6,605,458; 5,705,464; 5,710,115;
- the cleaning compositions described herein are advantageously employed for example, in laundry applications, hard surface cleaning, dishwashing applications, as well as cosmetic applications such as dentures, teeth, hair, and skin.
- the polypeptides described herein are ideally suited for laundry and fabric softening applications.
- the polypeptides of the present invention may find use in granular and liquid compositions.
- a polypeptide or isolated polypeptide described herein may also find use cleaning in additive products.
- low temperature solution cleaning applications find use.
- the present disclosure provides cleaning additive products including at least one disclosed a polypeptide of the present invention is ideally suited for inclusion in a wash process when additional bleaching effectiveness is desired. Such instances include, but are not limited to low temperature solution cleaning applications.
- the additive product is in its simplest form, one or more endo-P-mannanases.
- the additive is packaged in dosage form for addition to a cleaning process.
- the additive is packaged in dosage form for addition to a cleaning process where a source of peroxygen is employed and increased bleaching effectiveness is desired.
- Any suitable single dosage unit form finds use with the present disclosure, including but not limited to pills, tablets, gelcaps, or other single dosage units such as pre-measured powders or liquids.
- filler(s) or carrier material(s) are included to increase the volume of such compositions.
- suitable filler or carrier materials include, but are not limited to various salts of sulfate, carbonate, and silicate as well as talc, clay, and the like.
- Suitable filler or carrier materials for liquid compositions include, but are not limited to water or low molecular weight primary and secondary alcohols including polyols and diols.
- the compositions contain from about 5% to about 90% of such materials.
- Acidic fillers find use to reduce pH.
- the cleaning additive includes adjunct ingredients, as described more fully below.
- the present cleaning compositions or cleaning additives contain an effective amount of at least one polypeptide described herein, optionally in combination with other endo-P-mannanases and/or additional enzymes.
- the additional enzymes include, but are not limited to, at least one enzyme selected from acyl transferases, amylases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinases, arabinosidases, aryl esterases, beta-galactosidases, beta-glucanases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, exo- beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemi
- rhamnogalacturonases beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, xylosidases, and mixtures thereof.
- the required level of enzyme is achieved by the addition of one or more disclosed a polypeptide of the present invention.
- the present cleaning compositions will comprise at least about 0.0001 weight percent, from about 0.0001 to about 10, from about 0.001 to about 1, or even from about 0.01 to about 0.1 weight percent of at least one of the disclosed a polypeptide of the present inventions.
- the cleaning compositions herein are typically formulated such that, during use in aqueous cleaning operations, the wash water will have a pH of from about 3.0 to about 11.
- Liquid product formulations are typically formulated to have a neat pH from about 5.0 to about 9.0.
- Granular laundry products are typically formulated to have a pH from about 8.0 to about 11.0.
- Techniques for controlling pH at recommended usage levels include the use of buffers, alkalis, acids, etc., and are well known to those skilled in the art.
- Suitable low pH cleaning compositions typically have a neat pH of from about 3.0 to about 5.0 or even from about 3.5 to about 4.5.
- Low pH cleaning compositions are typically free of surfactants that hydrolyze in such a pH environment.
- surfactants include sodium alkyl sulfate surfactants that comprise at least one ethylene oxide moiety or even from about 1 to about 16 moles of ethylene oxide.
- Such cleaning compositions typically comprise a sufficient amount of a pH modifier, such as sodium hydroxide, monoethanolamine, or hydrochloric acid, to provide such cleaning composition with a neat pH of from about 3.0 to about 5.0.
- Such compositions typically comprise at least one acid stable enzyme. In some embodiments, the compositions are liquids, while in other embodiments, they are solids.
- the pH of such liquid compositions is typically measured as a neat pH.
- the pH of such solid compositions is measured as a 10% solids solution of the composition wherein the solvent is distilled water. In these embodiments, all pH measurements are taken at 20°C, unless otherwise indicated.
- Suitable high pH cleaning compositions typically have a neat pH of from about 9.0 to about 11.0, or even a net pH of from 9.5 to 10.5.
- Such cleaning compositions typically comprise a sufficient amount of a pH modifier, such as sodium hydroxide, monoethanolamine, or hydrochloric acid, to provide such cleaning composition with a neat pH of from about 9.0 to about 11.0.
- Such compositions typically comprise at least one base-stable enzyme.
- the compositions are liquids, while in other embodiments, they are solids.
- the pH of such liquid compositions is typically measured as a neat pH.
- the pH of such solid compositions is measured as a 10% solids solution of said composition wherein the solvent is distilled water. In these embodiments, all pH measurements are taken at 20°C, unless otherwise indicated.
- a polypeptide of the present invention when the a polypeptide of the present invention is employed in a granular composition or liquid, it is desirable for the a polypeptide of the present invention to be in the form of an encapsulated particle to protect the a polypeptide of the present invention from other components of the granular composition during storage.
- encapsulation is also a means of controlling the availability of the a polypeptide of the present invention during the cleaning process.
- encapsulation enhances the performance of the a polypeptide of the present invention and/or additional enzymes.
- the a polypeptide of the present inventions of the present disclosure are encapsulated with any suitable
- the encapsulating material typically encapsulates at least part of the catalyst for the a polypeptide of the present inventions described herein.
- the encapsulating material is water-soluble and/or water- dispersible.
- the encapsulating material has a glass transition temperature (Tg) of 0°C or higher. Glass transition temperature is described in more detail in the PCT application WO 97/11151.
- the encapsulating material is typically selected from consisting of carbohydrates, natural or synthetic gums, chitin, chitosan, cellulose and cellulose derivatives, silicates, phosphates, borates, polyvinyl alcohol, polyethylene glycol, paraffin waxes, and combinations thereof.
- carbohydrate it is typically selected from monosaccharides, oligosaccharides, polysaccharides, and combinations thereof.
- the encapsulating material is a starch (See, e.g., EP 0 922 499; U.S.
- the encapsulating material is a microsphere made from plastic such as thermoplastics, acrylonitrile,
- microspheres that find use include, but are not limited to those supplied by
- EXPANCEL ® (Stockviksverken, Sweden), and PM 6545, PM 6550, PM 7220, PM 7228, EXTENDOSPHERES ® , LUXSIL ® , Q-CEL ® , and SPHERICEL ® (PQ Corp., Valley Forge, PA).
- granular composition refers to a conglomeration of discrete solid, macroscopic particles. Powders are a special class of granular material due to their small particle size, which makes them more cohesive and more easily suspended.
- the fabrics, textiles, dishes, or other surfaces to be cleaned are incubated in the presence of a detergent composition having a polypeptide of the present invention for a time sufficient to allow the polypeptide to hydrolyze mannan substrates including, but not limited to, locust bean gum, guar gum, and combinations thereof present in soil or stains, and then typically rinsed with water or another aqueous solvent to remove the detergent composition along with hydrolyzed mannans.
- a detergent composition having a polypeptide of the present invention for a time sufficient to allow the polypeptide to hydrolyze mannan substrates including, but not limited to, locust bean gum, guar gum, and combinations thereof present in soil or stains, and then typically rinsed with water or another aqueous solvent to remove the detergent composition along with hydrolyzed mannans.
- a polypeptide of the present inventions find particular use in the cleaning industry, including, but not limited to laundry and dish detergents. These applications place enzymes under various environmental stresses.
- a polypeptide of the present inventions may provide advantages over many currently used enzymes, due to their stability under various conditions.
- a low detergent concentration system includes detergents where less than about 800 ppm of the detergent components are present in the wash water.
- Japanese detergents are typically considered low detergent concentration system as they have approximately 667 ppm of detergent components present in the wash water.
- a medium detergent concentration includes detergents where between about 800 ppm and about 2000 ppm of the detergent components are present in the wash water.
- North American detergents are generally considered to be medium detergent concentration systems as they have approximately 975 ppm of detergent components present in the wash water. Brazil typically has approximately 1500 ppm of detergent components present in the wash water.
- a high detergent concentration system includes detergents where greater than about 2000 ppm of the detergent components are present in the wash water.
- European detergents are generally considered to be high detergent concentration systems as they have approximately 4500-5000 ppm of detergent components in the wash water.
- Latin American detergents are generally high suds phosphate builder detergents and the range of detergents used in Latin America can fall in both the medium and high detergent concentrations as they range from 1500 ppm to 6000 ppm of detergent components in the wash water. As mentioned above, Brazil typically has approximately 1500 ppm of detergent components present in the wash water. However, other high suds phosphate builder detergent geographies, not limited to other Latin American countries, may have high detergent
- concentration systems up to about 6000 ppm of detergent components present in the wash water.
- concentrations of detergent compositions in typical wash solutions throughout the world varies from less than about 800 ppm of detergent composition ("low detergent concentration geographies”), for example about 667 ppm in Japan, to between about 800 ppm to about 2000 ppm ("medium detergent concentration geographies"), for example about 975 ppm in U.S. and about 1500 ppm in Brazil, to greater than about 2000 ppm ("high detergent concentration geographies”), for example about 4500 ppm to about 5000 ppm in Europe and about 6000 ppm in high suds phosphate builder geographies.
- low detergent concentration geographies for example about 667 ppm in Japan
- intermediate detergent concentration geographies for example about 975 ppm in U.S. and about 1500 ppm in Brazil
- high detergent concentration geographies for example about 4500 ppm to about 5000 ppm in Europe and about 6000 ppm in high suds phosphate builder geographies.
- the concentrations of the typical wash solutions are determined empirically. For example, in the U.S., a typical washing machine holds a volume of about 64.4 L of wash solution. Accordingly, in order to obtain a concentration of about 975 ppm of detergent within the wash solution about 62.79 g of detergent composition must be added to the 64.4 L of wash solution. This amount is the typical amount measured into the wash water by the consumer using the measuring cup provided with the detergent.
- different geographies use different wash temperatures. The temperature of the wash water in Japan is typically less than that used in Europe. For example, the temperature of the wash water in North America and Japan is typically between about 10 and about 30°C (e.g.
- the temperature of wash water in Europe is typically between about 30 and about 60°C (e.g. , about 40°C).
- the detergent compositions described herein may be utilized at temperature from about 10°C to about 60°C, or from about 20°C to about 60°C, or from about 30°C to about 60°C, or from about 40°C to about 60°C, as well as all other combinations within the range of about 40°C to about 55°C, and all ranges within 10°C to 60°C.
- cold water is typically used for laundry, as well as dish washing applications.
- the "cold water washing" of the present disclosure utilizes washing at temperatures from about 10°C to about 40°C, or from about 20°C to about 30°C, or from about 15°C to about 25°C, as well as all other combinations within the range of about 15°C to about 35°C, and all ranges within 10°C to 40°C.
- Water hardness is usually described in terms of the grains per gallon mixed Ca 2+ /Mg 2+ .
- Hardness is a measure of the amount of calcium (Ca 2+ ) and magnesium (Mg 2+ ) in the water. Most water in the United States is hard, but the degree of hardness varies. Moderately hard (60- 120 ppm) to hard (121- 181 ppm) water has 60 to 181 parts per million (parts per million converted to grains per U.S. gallon is ppm # divided by 17.1 equals grains per gallon) of hardness minerals.
- European water hardness is typically greater than about 10.5 (for example about 10.5 to about 20.0) grains per gallon mixed Ca 2+ /Mg 2+ (e.g. , about 15 grains per gallon mixed Ca 2+ /Mg 2+ ).
- North American water hardness is typically greater than Japanese water hardness, but less than European water hardness.
- North American water hardness can be between about 3 to about 10 grains, about 3 to about 8 grains or about 6 grains.
- Japanese water hardness is typically lower than North American water hardness, usually less than about 4, for example about 3 grains per gallon mixed Ca 2+ /Mg 2+ .
- the present disclosure provides a polypeptide of the present inventions that show surprising wash performance in at least one set of wash conditions (e.g., water temperature, water hardness, and/or detergent concentration).
- a polypeptide of the present inventions are comparable in wash performance to other endo-P-mannanases.
- a polypeptide of the present inventions exhibit enhanced wash performance as compared to endo-P-mannanases currently commercially available.
- the a polypeptide of the present inventions provided herein exhibit enhanced oxidative stability, enhanced thermal stability, enhanced cleaning capabilities under various conditions, and/or enhanced chelator stability.
- a polypeptide of the present inventions may find use in cleaning compositions that do not include detergents, again either alone or in combination with builders and stabilizers.
- the cleaning compositions comprise at least one a polypeptide of the present invention of the present disclosure at a level from about 0.00001 % to about 10% by weight of the composition and the balance (e.g. , about 99.999% to about 90.0%) comprising cleaning adjunct materials by weight of composition.
- the cleaning compositions comprises at least one a polypeptide of the present invention at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% by weight of the composition and the balance of the cleaning composition (e.g., about 99.9999% to about 90.0%, about 99.999 % to about 98%, about 99.995% to about 99.5% by weight) comprising cleaning adjunct materials.
- the balance of the cleaning composition e.g., about 99.9999% to about 90.0%, about 99.999 % to about 98%, about 99.995% to about 99.5% by weight
- any other suitable endo-P-mannanases find use in the compositions described herein either alone or in combination with a polypeptide described herein.
- Suitable endo-P-mannanases include, but are not limited to, endo-P-mannanases of the GH26 family of glycosyl hydrolases, endo-P- mannanases of the GH5 family of glycosyl hydrolases, acidic endo-P-mannanases, neutral endo- P-mannanases, and alkaline endo-P-mannanases. Examples of alkaline endo-P-mannanases include those described in U.S. Pat. Nos.
- suitable endo-P-mannanases include, but are not limited to those of animal, plant, fungal, or bacterial origin. Chemically or genetically modified mutants are encompassed by the present disclosure.
- useful endo-P-mannanases include Bacillus endo-P-mannanases such as B. subtilis endo-P-mannanase (See, e.g., U.S. Pat. No. 6, 060,299, and WO 9964573A1), B. sp.
- endo-P-mannanase See, e.g., U.S. Pat. No. 6,566,114 and W09964619A1
- Bacillus sp. AAI12 endo-P-mannanase See, e.g., U.S. Pat. No. 6,566,114 and W09964619A1
- Caldocellulosirup tor endo-P-mannanases such as C. sp. endo-P-mannanase (See, e.g., U.S. Pat. No. 6,566,114 and W09964619A1).
- mannanases find use in some embodiments of the present disclosure, including but not limited to Agaricus bisporus mannanase (See, Tang et al., [2001] Appl. Environ. Microbiol. 67: 2298- 2303), Aspergillu tamarii mannanase (See, Civas et al., [1984] Biochem. J. 219: 857-863), Aspergillus aculeatus mannanase (See, Christgau et al., [1994] Biochem. Mol. Biol. Int.
- Agaricus bisporus mannanase See, Tang et al., [2001] Appl. Environ. Microbiol. 67: 2298- 2303
- Aspergillu tamarii mannanase See, Civas et al., [1984] Biochem. J. 219: 857-863
- Aspergillus aculeatus mannanase See
- Biotechnol. 128(3): 452-461 Aspergillus terms mannanase (See, Huang et al., [2007] Wei Sheng Wu Xue Bao. 47(2): 280-284), Paenibacillus and Bacillus spp. mannanase (See, U.S. Pat No. 6,376,445.), Bacillus AM001 mannanase (See, Akino et al, [1989] Arch. Microbiol. 152: 10-15), Bacillus brevis mannanase (See, Araujo and Ward, [1990] J. Appl. Bacteriol. 68: 253- 261), Bacillus circulans K-l mannanase (See, Yoshida et al., [1998] Biosci. Biotechnol.
- Biochem. 62(3): 514-520 Bacillus polymyxa mannanase (See, Araujo and Ward, [1990] J. Appl. Bacteriol. 68: 253-261), Bacillus sp JAMB-750 mannanase (See, Hatada et al., [2005] Extremophiles. 9: 497-500), Bacillus sp. M50 mannanase (See, Chen et al., [2000] Wei Sheng Wu Xue Bao. 40: 62-68), Bacillus sp. N 16-5 mannanase (See, Yanhe et al., [2004]
- Bacillus subtilis SA-22 mannanase See, Sun et al., [2003] Sheng Wu Gong Cheng Xue Bao. 19(3): 327-330
- Bacillus subtilisl6S mannanase See, Helow and Khattab, [1996] Acta Microbiol. Immunol. Hung. 43: 289-299
- Bacteroides ovatus mannanase See, Gherardini et al., [1987] J. Bacteriol. 169: 2038-2043
- Bacteroides ruminicola mannanase See, Matsushita et al., [1991] J. Bacteriol. 173: 6919-6926)
- Caldibacillus cellulovorans mannanase See, Sunna et al., [2000] Appl. Environ. Microbiol. 66: 664-670
- Caldocellulosiruptor sac char olyticus mannanase See, Morris et al., [1995] Appl. Environ. Microbiol. 61: 2262-2269
- Caldocellum saccharolyticum mannanase See, Bicho et al., [1991] Appl. Microbiol. Biotechnol. 36: 337-343
- Cellulomonas fimi mannanase See, Stoll et al., [1999] Appl.
- Clostridium thermocellum mannanase See, Halstead et al., [1999] Microbiol. 145: 3101-3108
- Dictyoglomus thermophilum mannanase See, Gibbs et al., [1999] Curr.
- Microbiol. 39(6): 351-357 Flavobacterium sp mannanase (See, Zakaria et al., [1998] Biosci. Biotechnol. Biochem. 62: 655-660), Gastropoda pulmonata mannanase (See, Charrier and Rouland, [2001] J. Expt. Zool. 290: 125-135), Littorina brevicula mannanase (See, Yamamura et al., [1996] Biosci. Biotechnol. Biochem.
- Lycopersicon esculentum mannanase See, Filichkin et al., [2000] Plant Physiol. 134: 1080-1087
- Paenibacillus curdlanolyticus mannanase See, Pason and Ratanakhanokchai, [2006] Appl. Environ. Microbiol. 72: 2483- 2490
- Paenibacillus polymyxa mannanase See, Han et al., [2006] Appl. Microbiol Biotechnol. 73(3): 618-630
- Phanerochaete chrysosporium mannanase See, Wymelenberg et al., [2005] J.
- Rhodothermus marinus mannanase See, Politz et al., [2000] Appl. Microbiol. Biotechnol. 53 (6): 715-721
- Sclerotium rolfsii mannanase See, Sachslehner et al., [2000] J. Biotechnol. 80: 127-134
- Streptomyces galbus mannanase See, Kansoh and Nagieb, [2004] Anton, van. Leeuwonhoek. 85: 103-114
- Streptomyces lividans mannanase See, Arcand et al., [1993] J.Biochem. 290: 857-863
- Thermoanaerobacterium Polysaccharolyticum mannanase See, Cann et al., [1999] J. Bacteriol. 181: 1643-1651
- Thermomonospora fusca mannanase See, Hilge et al., [1998] Structure 6: 1433-1444
- Thermotoga maritima mannanase See, Parker et al., [2001] Biotechnol. Bioeng. 75(3): 322-333
- Thermotoga neapolitana mannanase See, Duffaud et al., [1997] Appl.
- endo-P-mannanases include commercially available endo- ⁇ - mannanases such as HEMICELL ® (Chemgen); GAMANASE ® and MANNAWAY ® ,
- the cleaning compositions of the present disclosure further comprise endo-P-mannanases at a level from about 0.00001 to about 10% of additional endo-P-mannanase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present disclosure also comprise endo-P-mannanases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% endo-P-mannanase by weight of the composition.
- any suitable protease may be used. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments of the present disclosure, any suitable protease may be used. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments of the present disclosure, any suitable protease may be used. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments of the present disclosure, any suitable protease may be used. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments of the present disclosure, any suitable protease may be used. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments of the present disclosure, any suitable protease may be used.
- the protease is a serine protease, preferably an alkaline microbial protease or a trypsin-like protease.
- Various proteases are described in PCT applications WO 95/23221 and WO
- metalloproteases find use in the present disclosure, including but not limited to the neutral metalloprotease described in PCT application WO 07/044993.
- protease enzymes that find use in the present invention include, but are not limited to MAXATASE®, MAXACALTM, MAXAPEMTM, OPTICLEAN®, OPTIMASE®, PROPERASE®, PURAFECT®, PURAFECT® OXP, PURAMAXTM,
- EXCELLASETM PREFERENZTM proteases (e.g. P100, PI 10, P280), EFFECTENZTM proteases (e.g. P1000, P1050, P2000), EXCELLENZTM proteases (e.g. P1000), ULTIMASE®, and PURAFASTTM (DuPont); ALCALASE®, SAVIN ASE®, PRIMASE®, DURAZYMTM, POLARZYME®, OVOZYME®, KANNASE®, LIQUANASE®, NEUTRASE®, RELASE® and ESPERASE® (Novozymes); BLAPTM and BLAPTM variants (Henkel
- any suitable amylase may be used.
- any amylase ⁇ e.g., alpha and/or beta) suitable for use in alkaline solutions also find use.
- Suitable amylases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- Amylases that find use in the present disclosure include, but are not limited to a-amylases obtained from B. licheniformis ⁇ See, e.g., GB 1,296,839).
- Commercially available amylases that find use in the present disclosure include, but are not limited to DURAMYL ® , TERM AM YL ® , FUNGAMYL ® , STAINZYME ® , STAINZYME PLUS ® , STAINZYME ULTRA ® , and BANTM (Novozymes A/S, Denmark), as well as PURASTAR ® , POWERASETM, RAPID ASE ® , and MAXAMYL ® P (Genencor, A Danisco Division, Palo Alto, CA).
- the disclosed cleaning compositions further comprise amylases at a level from about 0.00001% to about 10% of additional amylase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions also comprise amylases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% amylase by weight of the composition.
- pectin degrading enzyme(s) encompass arabinanase (EC 3.2.1.99), galactanases (EC 3.2.1.89), polygalacturonase (EC 3.2.1.15) exo- polygalacturonase (EC 3.2.1.67), exo-poly-alpha-galacturonidase (EC 3.2.1.82), pectin lyase (EC 4.2.2.10), pectin esterase (EC 3.2.1.11), pectate lyase (EC 4.2.2.2), exo-polygalacturonate lyase (EC 4.2.2.9) and hemicellulases such as endo-l,3-P-xylosidase (EC 3.2.1.32), xylan-l,4-P- xylosidase (EC 3.2.1.37) and a-L-arabin
- Suitable pectin degrading enzymes include those of plant, fungal, or microbial origin. In some embodiments, chemically or genetically modified mutants are included.
- the pectin degrading enzymes are alkaline pectin degrading enzymes, i.e., enzymes having an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of their maximum activity at a pH of from about 7.0 to about 12. In certain other embodiments, the pectin degrading enzymes are enzymes having their maximum activity at a pH of from about 7.0 to about 12. Alkaline pectin degrading enzymes are produced by alkalophilic microorganisms e.g., bacterial, fungal, and yeast microorganisms such as Bacillus species.
- the microorganisms are Bacillus firmus, Bacillus circulans, and Bacillus subtilis as described in JP 56131376 and JP 56068393.
- Alkaline pectin decomposing enzymes may include but are not limited to galacturn-l,4-a-galacturonase (EC 3.2.1.67), polygalacturonase activities (EC 3.2.1.15, pectin esterase (EC 3.1.1.11), pectate lyase (EC 4.2.2.2) and their iso enzymes.
- Alkaline pectin decomposing enzymes can be produced by the Erwinia species. In some embodiments, the alkaline pectin decomposing enzymes are produced by E.
- alkaline pectin enzymes are produced by Bacillus species as disclosed in JP 73006557 and Agr. Biol. Chem. (1972), 36 (2) 285-93.
- the disclosed cleaning compositions further comprise pectin degrading enzymes at a level from about 0.00001% to about 10% of additional pectin degrading enzyme by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions also comprise pectin degrading enzymes at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% pectin degrading enzyme by weight of the composition.
- any suitable xyloglucanase finds used in the cleaning compositions of the present disclosure.
- Suitable xyloglucanases include, but are not limited to those of plant, fungal, or bacterial origin. Chemically or genetically modified mutants are included in some embodiments.
- xyloglucanase(s) encompass the family of enzymes described by Vincken and Voragen at Wageningen University [Vincken et al (1994) Plant Physiol., 104, 99-107] and are able to degrade xyloglucans as described in Hayashi et al (1989) Plant. Physiol. Plant Mol. Biol., 40, 139-168.
- Vincken et al demonstrated the removal of xyloglucan coating from cellulose of the isolated apple cell wall by a xyloglucanase purified from Trichoderma viride (endo-IV-glucanase). This enzyme enhances the enzymatic degradation of cell wall-embedded cellulose and work in synergy with pectic enzymes.
- Rapidase LIQ+ from Gist-Brocades contains a xyloglucanase activity.
- the disclosed cleaning compositions further comprise xyloglucanases at a level from about 0.00001% to about 10% of additional xyloglucanase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions also comprise xyloglucanases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% xyloglucanase by weight of the composition.
- xyloglucanases for specific applications are alkaline xyloglucanases, i.e., enzymes having an enzymatic activity of at least 10%, preferably at lest 25%, more preferably at least 40% of their maximum activity at a pH ranging from 7 to 12. In certain other embodiments, the xyloglucanases are enzymes having their maximum activity at a pH of from about 7.0 to about 12.
- any suitable cellulase finds used in the cleaning compositions of the present disclosure.
- Suitable cellulases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- Suitable cellulases include, but are not limited to Humicola insolens cellulases (See, e.g., U.S. Pat. No. 4,435,307).
- Especially suitable cellulases are the cellulases having color care benefits (See, e.g., EP 0 495 257).
- Commercially available cellulases that find use in the present disclosure include, but are not limited to ENDOLASE ® , CELLUCLEAN ® ,
- cellulases are incorporated as portions or fragments of mature wild- type or variant cellulases, wherein a portion of the N- terminus is deleted (See, e.g., U.S. Pat. No. 5,874,276).
- the cleaning compositions of the present disclosure further comprise cellulases at a level from about
- the cleaning compositions also comprise cellulases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% cellulase by weight of the composition.
- any lipase suitable for use in detergent compositions also finds use in the present disclosure.
- Suitable lipases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- useful lipases include Humicola lanuginosa lipase (See, e.g., EP 258 068, and EP 305 216), Rhizomucor miehei lipase (See, e.g., EP 238 023), Candida lipase, such as C. antarctica lipase (e.g., the C. antarctica lipase A or B; see, e.g., EP 214 761),
- C. antarctica lipase e.g., the C. antarctica lipase A or B; see, e.g., EP 214 761
- Pseudomonas lipases such as P. alcaligenes lipase and P. pseudoalcaligenes lipase (See, e.g., EP 218 272), P. cepacia lipase (See, e.g., EP 331 376), P. stutzeri lipase (See, e.g., GB 1,372,034), P. fluorescens lipase, Bacillus lipase (e.g., B. subtilis lipase [Dartois et al., (1993) Biochem. Biophys. Acta 1131:253-260]; B.
- stearothermophilus lipase See, e.g., JP 64/744992]; and B. pumilus lipase [See, e.g., WO 91/16422]).
- a number of cloned lipases find use in some embodiments of the present disclosure, including but not limited to Penicillium
- camembertii lipase See, Yamaguchi et al., [1991] Gene 103:61-67), Geotricum candidum lipase (See, Schimada et al., [1989] J. Biochem. 106:383-388), and various Rhizopus lipases such as R. delemar lipase (See, Hass et al., [1991] Gene 109: 117-113), R. niveus lipase (Kugimiya et al., [1992] Biosci. Biotech. Biochem. 56:716-719), and R. oryzae lipase.
- cutinases Other types of lipolytic enzymes such as cutinases also find use in some embodiments of the present disclosure, including but not limited to the cutinase derived from Pseudomonas mendocina (See, WO 88/09367), and the cutinase derived from Fusarium solani pisi (See, WO 90/09446).
- lipases include commercially available lipases such as Ml LIPASETM, LUMA FASTTM, and LIPOMAXTM (Genencor, A Danisco Division, Palo Alto, CA); LIPEX ® , LIPOCLEAN ® , LIPOLASE ® and LIPOLASE ® ULTRA (Novozymes A/S, Denmark); and LIPASE PTM
- the disclosed cleaning compositions further comprise lipases at a level from about 0.00001% to about 10% of additional lipase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions also comprise lipases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% lipase by weight of the composition.
- peroxidases are used in combination with hydrogen peroxide or a source thereof (e.g., a percarbonate, perborate or persulfate) in the compositions of the present disclosure.
- oxidases are used in combination with oxygen. Both types of enzymes are used for "solution bleaching" (i.e., to prevent transfer of a textile dye from a dyed fabric to another fabric when the fabrics are washed together in a wash liquor), preferably together with an enhancing agent (See, e.g. , WO 94/12621 and WO
- Suitable peroxidases/oxidases include, but are not limited to those of plant, bacterial or fungal origin. Chemically or genetically modified mutants are included in some
- the cleaning compositions of the present disclosure further comprise peroxidase and/or oxidase enzymes at a level from about 0.00001 to about 10% of additional peroxidase and/or oxidase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions also comprise peroxidase and/or oxidase enzymes at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% peroxidase and/or oxidase enzymes by weight of the composition.
- additional enzymes find use, including but not limited to perhydrolases (See, e.g. , WO 05/056782).
- perhydrolases See, e.g. , WO 05/056782.
- WO 05/056782 See, e.g. , WO 05/056782.
- mixtures of the above mentioned enzymes are encompassed herein, in particular one or more additional protease, amylase, lipase, mannanase, and/or at least one cellulase.
- varying levels of a polypeptide of the present invention(s) and one or more additional enzymes may both independently range to about 10%, the balance of the cleaning composition being cleaning adjunct materials.
- the specific selection of cleaning adjunct materials are readily made by considering the surface, item, or fabric to be cleaned, and the desired form of the composition for the cleaning conditions during use (e.g., through the wash detergent use).
- cleaning adjunct materials include, but are not limited to, surfactants, builders, bleaches, bleach activators, bleach catalysts, other enzymes, enzyme stabilizing systems, chelants, optical brighteners, soil release polymers, dye transfer agents, dye transfer inhibiting agents, catalytic materials, hydrogen peroxide, sources of hydrogen peroxide, preformed peracis, polymeric dispersing agents, clay soil removal agents, structure elasticizing agents, dispersants, suds suppressors, dyes, perfumes, colorants, filler salts, hydrotropes, photoactivators, fluorescers, fabric conditioners, fabric softeners, carriers, hydrotropes, processing aids, solvents, pigments, hydrolyzable surfactants, preservatives, anti- oxidants, anti- shrinkage agents, anti-wrinkle agents, germicides, fungicides, color speckles, silvercare, anti- tarnish and/or anti-corrosion agents, alkalinity sources, solubilizing agents, carriers, processing aids,
- an effective amount of one or more polypeptide of the present invention(s) provided herein are included in compositions useful for cleaning a variety of surfaces in need of stain removal.
- cleaning compositions include cleaning compositions for such applications as cleaning hard surfaces, fabrics, and dishes.
- the present disclosure provides fabric cleaning compositions, while in other embodiments, the present disclosure provides non-fabric cleaning compositions.
- the present disclosure also provides cleaning compositions suitable for personal care, including oral care (including dentrifices, toothpastes, mouthwashes, etc., as well as denture cleaning compositions), skin, and hair cleaning compositions.
- the present disclosure provides fabric softening compositions. It is intended that the present disclosure encompass detergent compositions in any form (i.e., liquid, granular, bar, solid, semisolid, gel, paste, emulsion, tablet, capsule, unit dose, sheet, foam etc.).
- compositions suitable for use in laundry machine washing method(s) preferably contain at least one surfactant and at least one builder compound, as well as one or more cleaning adjunct materials preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors.
- cleaning adjunct materials preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors.
- laundry compositions also contain softening agents (i.e., as additional cleaning adjunct materials).
- compositions of the present disclosure also find use detergent additive products in solid or liquid form. Such additive products are intended to supplement and/or boost the performance of conventional detergent compositions and can be added at any stage of the cleaning process.
- the density of the laundry detergent compositions herein ranges from about 400 to about 1200 g/liter, while in other embodiments, it ranges from about 500 to about 950 g/liter of composition measured at 20°C.
- compositions of the disclosure preferably contain at least one surfactant and preferably at least one additional cleaning adjunct material selected from organic polymeric compounds, suds enhancing agents, group II metal ions, solvents, hydrotropes, and additional enzymes.
- compositions comprising at least one polypeptide of the present invention are a compact granular fabric cleaning composition, while in other embodiments, the composition is a granular fabric cleaning composition useful in the laundering of colored fabrics, in further embodiments, the composition is a granular fabric cleaning composition which provides softening through the wash capacity, in additional embodiments, the composition is a heavy duty liquid fabric cleaning composition.
- the compositions comprising at least one polypeptide of the present invention of the present disclosure are fabric cleaning
- compositions such as those described in U.S. Pat. Nos. 6,610,642 and 6,376,450.
- a polypeptide of the present invention find use in granular laundry detergent compositions of particular utility under European or Japanese washing conditions (See, e.g. , U.S. Pat. No.
- the present disclosure provides hard surface cleaning compositions comprising at least one polypeptide of the present invention.
- the compositions comprising at least one polypeptide of the present invention is a hard surface cleaning composition such as those described in U.S. Pat. Nos.
- the present disclosure provides dishwashing
- compositions comprising at least one polypeptide of the present invention are a hard surface cleaning composition such as those in U.S. Pat. Nos. 6,610,642 and 6,376,450.
- present disclosure provides dishwashing compositions comprising at least one polypeptide of the present invention provided herein.
- compositions comprising at least one polypeptide of the present invention comprise oral care compositions such as those in U.S. Pat. Nos. 6,376,450 and 6,605,458.
- the formulations and descriptions of the compounds and cleaning adjunct materials contained in the aforementioned U.S. Pat. Nos. 6,376,450; 6,605,458; and 6,610,642 find use with a polypeptide of the present invention.
- compositions comprising at least one polypeptide of the present invention comprise fabric softening compositions such as those in GB-A1 400898, GB-A1 514 276, EP 0 011 340, EP 0 026 528, EP 0 242 919, EP 0 299 575, EP 0 313 146, and U.S. Pat. No. 5,019,292.
- fabric softening compositions such as those in GB-A1 400898, GB-A1 514 276, EP 0 011 340, EP 0 026 528, EP 0 242 919, EP 0 299 575, EP 0 313 146, and U.S. Pat. No. 5,019,292 find use with a polypeptide of the present.
- the cleaning compositions of the present disclosure are formulated into any suitable form and prepared by any process chosen by the formulator, non-limiting examples of which are described in U.S. Pat. Nos. 5,879,584; 5,691,297; 5,574,005; 5,569,645; 5,565,422; 5,516,448; 5,489,392; and 5,486,303; all of which are incorporated herein by reference.
- the pH of such composition is adjusted via the addition of a material such as monoethanolamine or an acidic material such as HC1.
- the cleaning compositions of the present invention are provided in unit dose form, including tablets, capsules, sachets, pouches, sheets, and multicompartment pouches.
- the unit dose format is designed to provide controlled release of the ingredients within a multi-compartment pouch (or other unit dose format). Suitable unit dose and controlled release formats are known in the art (See e.g., EP 2 100 949, WO 02/102955, US Pat. Nos. 4,765,916 and 4,972,017, and WO 04/111178 for materials suitable for use in unit dose and controlled release formats).
- the unit dose form is provided by tablets wrapped with a water-soluble film or water-soluble pouches.
- Various unit dose formats are provided in EP 2 100 947 and WO2013/165725 (which is hereby incorporated by reference), and are known in the art.
- adjuncts illustrated hereinafter are suitable for use in the instant cleaning compositions.
- these adjuncts are incorporated for example, to assist or enhance cleaning performance, for treatment of the substrate to be cleaned, or to modify the aesthetics of the cleaning composition as is the case with perfumes, colorants, dyes or the like. It is understood that such adjuncts are in addition to a polypeptide of the present. The precise nature of these additional components, and levels of incorporation thereof, will depend on the physical form of the composition and the nature of the cleaning operation for which it is to be used.
- Suitable adjunct materials include, but are not limited to, surfactants, builders, chelating agents, dye transfer inhibiting agents, deposition aids, dispersants, additional enzymes, and enzyme stabilizers, catalytic materials, bleach activators, bleach boosters, hydrogen peroxide, sources of hydrogen peroxide, preformed peracids, polymeric dispersing agents, clay soil removal/anti- redeposition agents, brighteners, suds suppressors, dyes, perfumes, structure elasticizing agents, fabric softeners, carriers, hydrotropes, processing aids and/or pigments.
- suitable examples of such other adjuncts and levels of use are found in U.S. Pat. Nos. 5,576,282; 6,306,812; and 6,326,348 are incorporated by reference.
- adjunct ingredients may constitute the balance of the cleaning compositions of the present disclosure.
- the cleaning compositions according to the present disclosure comprise at least one surfactant and/or a surfactant system wherein the surfactant is selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitterionic surfactants, semi-polar nonionic surfactants, and mixtures thereof.
- the surfactant is selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitterionic surfactants, semi-polar nonionic surfactants, and mixtures thereof.
- the composition typically does not contain alkyl ethoxylated sulfate, as it is believed that such surfactant may be hydrolyzed by such compositions' acidic contents.
- the surfactant is present at a level of from about 0.1% to about 60%, while in alternative embodiments the level is from about 1 % to about 50%, while in still further embodiments the level is from about 5% to about 40%, by weight of the cleaning composition.
- the cleaning compositions of the present disclosure contain at least one chelating agent.
- Suitable chelating agents may include, but are not limited to copper, iron, and/or manganese chelating agents, and mixtures thereof.
- the cleaning compositions of the present disclosure comprise from about 0.1% to about 15% or even from about 3.0% to about 10% chelating agent by weight of the subject cleaning composition.
- the cleaning compositions provided herein contain at least one deposition aid.
- Suitable deposition aids include, but are not limited to, polyethylene glycol, polypropylene glycol, polycarboxylate, soil release polymers such as polytelephthalic acid, clays such as kaolinite, montmorillonite, atapulgite, illite, bentonite, halloysite, and mixtures thereof.
- anti-redeposition agents find use in some embodiments of the present disclosure.
- non-ionic surfactants find use.
- non-ionic surfactants find use for surface modification purposes, in particular for sheeting, to avoid filming and spotting and to improve shine.
- these non-ionic surfactants also find use in preventing the re-deposition of soils.
- the anti-redeposition agent is a non-ionic surfactant as known in the art ⁇ See, e.g., EP 2 100 949).
- the cleaning compositions of the present disclosure include one or more dye transfer inhibiting agents.
- Suitable polymeric dye transfer inhibiting agents include, but are not limited to, polyvinylpyrrolidone polymers, polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones, and polyvinylimidazoles, or mixtures thereof.
- the cleaning compositions of the present disclosure comprise from about 0.0001% to about 10%, from about 0.01% to about 5%, or even from about 0.1% to about 3% by weight of the cleaning composition.
- silicates are included within the compositions of the present disclosure.
- sodium silicates ⁇ e.g., sodium disilicate, sodium metasilicate, and crystalline phyllosilicates
- silicates are present at a level of from about 1% to about 20%.
- silicates are present at a level of from about 5% to about 15% by weight of the composition.
- the cleaning compositions of the present disclosure also contain dispersants.
- Suitable water-soluble organic materials include, but are not limited to the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms.
- the enzymes used in the cleaning compositions are stabilized by any suitable technique.
- the enzymes employed herein are stabilized by the presence of water-soluble sources of calcium and/or magnesium ions in the finished compositions that provide such ions to the enzymes.
- the enzyme stabilizers include oligosaccharides, polysaccharides, and inorganic divalent metal salts, including alkaline earth metals, such as calcium salts. It is contemplated that various techniques for enzyme stabilization will find use in the present disclosure.
- the enzymes employed herein are stabilized by the presence of water-soluble sources of zinc (II), calcium (II), and/or magnesium (II) ions in the finished compositions that provide such ions to the enzymes, as well as other metal ions ⁇ e.g., barium (II), scandium (II), iron (II), manganese (II), aluminum (III), tin (II), cobalt (II), copper (II), nickel (II), and oxovanadium (IV). Chlorides and sulfates also find use in some embodiments of the present disclosure.
- oligosaccharides and polysaccharides are known in the art (See, e.g., WO 07/145964).
- reversible protease inhibitors also find use, such as boron-containing compounds (e.g., borate, 4-formyl phenyl boronic acid) and/or a tripeptide aldehyde find use to further improve stability, as desired.
- bleaches, bleach activators, and/or bleach catalysts are present in the compositions of the present disclosure.
- the cleaning compositions of the present disclosure comprise inorganic and/or organic bleaching compound(s).
- Inorganic bleaches may include, but are not limited to perhydrate salts (e.g. , perborate, percarbonate, perphosphate, persulfate, and persilicate salts).
- inorganic perhydrate salts are alkali metal salts.
- inorganic perhydrate salts are included as the crystalline solid, without additional protection, although in some other embodiments, the salt is coated. Any suitable salt known in the art finds use in the present disclosure (See, e.g. , EP 2 100 949).
- bleach activators are used in the compositions of the present disclosure.
- Bleach activators are typically organic peracid precursors that enhance the bleaching action in the course of cleaning at temperatures of 60°C and below.
- Bleach activators suitable for use herein include compounds which, under perhydrolysis conditions, give aliphatic peroxycarboxylic acids having preferably from about 1 to about 10 carbon atoms, in particular from about 2 to about 4 carbon atoms, and/or optionally substituted perbenzoic acid. Additional bleach activators are known in the art and find use in the present disclosure (See, e.g., EP 2 100 949).
- the cleaning compositions of the present disclosure further comprise at least one bleach catalyst.
- the manganese triazacyclononane and related complexes find use, as well as cobalt, copper, manganese, and iron complexes. Additional bleach catalysts find use in the present disclosure (See, e.g., U.S. Pat. No. 4,246,612; U.S. Pat. No. 5,227,084; U.S. Pat. No. 4,810,410; WO 99/06521 ; and EP 2 100 949).
- the cleaning compositions of the present disclosure contain one or more catalytic metal complexes.
- a metal-containing bleach catalyst finds use.
- the metal bleach catalyst comprises a catalyst system comprising a transition metal cation of defined bleach catalytic activity, (e.g. , copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations), an auxiliary metal cation having little or no bleach catalytic activity (e.g.
- the cleaning compositions of the present disclosure are catalyzed by means of a manganese compound.
- a manganese compound Such compounds and levels of use are well known in the art (See, e.g., U.S. Pat. No. 5,576,282).
- cobalt bleach catalysts find use in the cleaning compositions of the present disclosure.
- Various cobalt bleach catalysts are known in the art (See, e.g., U.S. Pat. Nos. 5,597,936 and 5,595,967) and are readily prepared by known procedures.
- the cleaning compositions of the present disclosure include a transition metal complex of a macropolycyclic rigid ligand (MRL).
- MRL macropolycyclic rigid ligand
- the compositions and cleaning processes provided by the present disclosure are adjusted to provide on the order of at least one part per hundred million of the active MRL species in the aqueous washing medium, and in some preferred embodiments, provide from about 0.005 ppm to about 25 ppm, more preferably from about 0.05 ppm to about 10 ppm, and most preferably from about 0.1 ppm to about 5 ppm, of the MRL in the wash liquor.
- preferred transition-metals in the instant transition-metal bleach catalyst include, but are not limited to manganese, iron, and chromium.
- Preferred MRLs also include, but are not limited to special ultra-rigid ligands that are cross-bridged (e.g., 5,12- diethyl- l,5,8,12-tetraazabicyclo[6.6.2] hexadecane).
- Suitable transition metal MRLs are readily prepared by known procedures (See, e.g., WO 2000/32601 and U.S. Pat. No. 6,225,464).
- the cleaning compositions of the present disclosure comprise metal care agents.
- Metal care agents find use in preventing and/or reducing the tarnishing, corrosion, and/or oxidation of metals, including aluminum, stainless steel, and non-ferrous metals (e.g., silver and copper). Suitable metal care agents include those described in EP 2 100 949, WO 94/26860, and WO 94/26859).
- the metal care agent is a zinc salt.
- the cleaning compositions of the present disclosure comprise from about 0.1% to about 5% by weight of one or more metal care agent.
- the cleaning compositions of the present disclosure are formulated into any suitable form and prepared by any process chosen by the formulator, non- limiting examples of which are described in U.S. Pat. Nos. 5,879,584; 5,691,297; 5,574,005; 5,569,645; 5,516,448; 5,489,392; and 5,486,303; all of which are incorporated herein by reference.
- the pH of such composition is adjusted via the addition of an acidic material such as HC1.
- the cleaning compositions disclosed herein of find use in cleaning a situs (e.g. , a surface, dishware, or fabric). Typically, at least a portion of the situs is contacted with an embodiment of the present cleaning composition, in neat form or diluted in wash liquor, and then the situs is optionally washed and/or rinsed.
- "washing” includes but is not limited to, scrubbing and mechanical agitation.
- the cleaning compositions are typically employed at concentrations of from about 500 ppm to about 15,000 ppm in solution.
- the wash solvent is water
- the water temperature typically ranges from about 5°C to about 90°C and, when the situs comprises a fabric, the water to fabric mass ratio is typically from about 1 : 1 to about 30: 1.
- polypeptide of the present invention for hydrolysis of polysaccharide chains containing mannose units, including, but not limited to, mannans, galactomannans, and glucomannans, makes the present polypeptides particularly useful for performing mannan hydrolysis reactions involving polysaccharide substrates containing 1,4- ⁇ - D-mannosidic linkages.
- a donor molecule is incubated in the presence of an isolated polypeptide or a polypeptide described herein or fragment or variant thereof under conditions suitable for performing a mannan hydrolysis reaction, followed by, optionally, isolating a product from the reaction.
- the product may become a component of the foodstuff without isolation.
- the donor molecule is a polysaccharide chain comprising mannose units, including but not limited to mannans, glucomannans, galactomannans, and galacto glucomannans.
- Polypeptides of the present invention for Food Processing and/or Animal Feed
- a composition comprising a polypeptide described herein is used to process and/or manufacture animal feed or food for humans.
- a polypeptide of the present invention can be an additive to feed for non-human animals.
- a polypeptide of the present invention can be useful for human food, such as, for example, as an additive to human food.
- plant material containing oligomannans such as mannan, galactomannan, glucomannan and galactoglucomannan can reduce an animal's ability to digest and absorb nutritional compounds such as minerals, vitamins, sugars, and fats.
- oligomannans such as mannan, galactomannan, glucomannan and galactoglucomannan can reduce an animal's ability to digest and absorb nutritional compounds such as minerals, vitamins, sugars, and fats.
- animal feed containing plant material is incubated in the presence of a polypeptide and/or isolated polypeptide described herein or fragment or variant thereof under conditions suitable for breaking down mannan-containing polymers.
- a bread improver composition comprises a polypeptide described herein, optionally in combination with a source of mannan or glucomannan or galactomannan, and further optionally in combination with one or more other enzymes.
- non-human animal includes all non-ruminant and ruminant animals.
- the non-ruminant animal is selected from the group consisting of, but is not limited to, horses and monogastric animals such as, but not limited to, pigs, poultry, swine and fish.
- the pig may be, but is not limited to, a piglet, a growing pig, and a sow;
- the poultry may be, but is not limited to, a turkey, a duck and a chicken including, but not limited to, a broiler chick and a layer; and fish including but not limited to salmon, trout, tilapia, catfish and carps; and crustaceans including but not limited to shrimps and prawns.
- the ruminant animal is selected from the group consisting of, but is not limited to, cattle, young calves, goats, sheep, giraffes, bison, moose, elk, yaks, water buffalo, deer, camels, alpacas, llamas, antelope, pronghorn, and nilgai.
- a polypeptide of the present invention is used to pretreat feed instead of as a feed additive.
- a polypeptide of the present invention is added to, or used to pretreat, feed for weanling pigs, nursery pigs, piglets, fattening pigs, growing pigs, finishing pigs, laying hens, broiler chicks, and turkeys.
- a polypeptide of the present invention is added to, or used to pretreat, feed from plant material such as palm kernel, coconut, konjac, locust bean gum, gum guar, soy beans, barley, oats, flax, wheat, corn, linseed, citrus pulp, cottonseed, groundnut, rapeseed, sunflower, peas, and lupines.
- plant material such as palm kernel, coconut, konjac, locust bean gum, gum guar, soy beans, barley, oats, flax, wheat, corn, linseed, citrus pulp, cottonseed, groundnut, rapeseed, sunflower, peas, and lupines.
- a polypeptide in accordance with the present invention isthermostable, and as a result, a polypeptide disclosed herein can be used in processes of producing pelleted feed in which heat is applied to the feed mixture before the pelleting step.
- a polypeptide of the present invention is added to the other feed ingredients either in advance of the pelleting step or after the pelleting step (i.e to the already formed feed pellets).
- food processing or feed supplement compositions that containa polypeptide described herein may optionally further contain other substituents selected from coloring agents, aroma compounds, stabilizers, vitamins, minerals, and other feed or food enhancing enzymes. This applies in particular to the so-called pre-mixes.
- a food additive according to the present invention may be combined in an appropriate amount with other food components, such as, for example, a cereal or plant protein to form a processed food product.
- an animal feed composition and/or animal feed additive composition and/or pet food comprises a polypeptide described herein.
- Another embodiment relates to a method for preparing an animal feed composition and/or animal feed additive composition and/or pet food comprising mixing a polypeptide described herein with one or more animal feed ingredients and/or animal feed additive ingredients and/or pet food ingredients.
- a further embodiment relates to the use of a polypeptide described herein to prepare an animal feed composition and/or animal feed additive composition and/or pet food.
- the phrase "pet food” means food for a household animal such as, but not limited to, dogs; cats; gerbils; hamsters; chinchillas; fancy rats; guinea pigs; avian pets, such as canaries, parakeets, and parrots; reptile pets, such as turtles, lizards and snakes; and aquatic pets, such as tropical fish and frogs.
- animal feed composition feedstuff and fodder are used interchangeably and may comprise one or more feed materials selected from the group comprising a) cereals, such as small grains (e.g., wheat, barley, rye, oats and combinations thereof) and/or large grains such as maize or sorghum; b) by-products from cereals, such as corn gluten meal, Distillers Dried Grain Solubles (DDGS) (particularly corn based Distillers Dried Grain Solubles
- cDDGS cDDGS
- wheat bran wheat middlings, wheat shorts, rice bran, rice hulls, oat hulls, palm kernel, and citrus pulp
- protein obtained from sources such as soya, sunflower, peanut, lupin, peas, fava beans, cotton, canola, fish meal, dried plasma protein, meat and bone meal, potato protein, whey, copra, and sesame
- oils and fats obtained from vegetable and animal sources
- minerals and vitamins e.
- the food composition or additive may be liquid or solid.
- Polypeptides of the present invention for fermented beverages such as beer
- the food composition is a beverage, including, but not limited to, a fermented beverage such as beer and wine, comprising a polypeptide described herein.
- the term “fermented beverage” is meant to comprise any beverage produced by a method comprising a fermentation process, such as a microbial fermentation, such as a bacterial and/or yeast fermentation.
- the fermented beverage is beer.
- beer is meant to comprise any fermented wort produced by fermentation/brewing of a starch-containing plant material. Often, beer is produced from malt or adjunct, or any combination of malt and adjunct as the starch-containing plant material.
- malt is understood as any malted cereal grain, such as malted barley or wheat.
- adjunct refers to any starch and/or sugar containing plant material which is not malt, such as barley or wheat malt.
- adjuncts include, for example, common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, cassava and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like may be used as a source of starch
- the term "mash” refers to an aqueous slurry of any starch and/or sugar containing plant material such as grist, e. g. comprising crushed barley malt, crushed barley, and/or other adjunct or a combination hereof, mixed with water later to be separated into wort and spent grains.
- wort refers to the unfermented liquor run-off following extracting the grist during mashing.
- the invention in another aspect relates to a method of preparing a fermented beverage such as beer comprising mixing any polypeptide of the present invention with a malt and/or adjunct.
- Examples of beers comprise: full malted beer, beer brewed under the
- fruit flavoured malt beverages e. g. citrus flavoured, such as lemon-, orange-, lime-, or berry-flavoured malt beverages
- liquor flavoured malt beverages e. g. , vodka
- One aspect of the invention relates to the use of any polypeptide of the present invention in the production of a fermented beverage, such as a beer.
- Another aspect concerns a method of providing a fermented beverage comprising the step of contacting a mash and/or a wort with any polypeptide of the present invention.
- a further aspect relates to a method of providing a fermented beverage comprising the steps of: (a) preparing a mash, (b) filtering the mash to obtain a wort, and (c) fermenting the wort to obtain a fermented beverage, such as a beer, wherein any polypeptide of the present invention is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
- a fermented beverage such as a beer
- a method comprising the step(s) of (1) contacting a mash and/or a wort with any polypeptide of the present invention; and/or (2) (a) preparing a mash, (b) filtering the mash to obtain a wort, and (c) fermenting the wort to obtain a fermented beverage, such as a beer, wherein any polypeptide of the present invention is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
- a polypeptide of the present inventions described herein may also be used for hydrolyzing galactomannans present in liquid coffee extracts.
- a polypeptide of the present invention is used to inhibit gel formation during freeze drying of liquid coffee extracts. The decreased viscosity of the extract reduces the energy consumption during drying.
- a polypeptide of the present inventions is applied in an immobilized form in order to reduce enzyme consumption and avoid contamination of the coffee extract. This use is further disclosed in EP 676 145.
- the coffee extract is incubated in the presence of a polypeptide and/or isolated polypepetide of the present invention or fragment or variant thereof under conditions suitable for hydrolyzing galactomannans present in liquid coffee extract.
- Polypeptides of the present invention for use in bakery food products [00237]
- the invention relates to a method of preparing baked products comprising addition of any polypeptide of the invention to dough, followed by baking the dough.
- baked products are well known to those skilled in the art and include breads, rolls, puff pastries, sweet fermented doughs, buns, cakes, crackers, cookies, biscuits, waffles, wafers, tortillas, breakfast cereals, extruded products, and the like.
- Any polypeptide of the invention may be added to dough as part of a bread improver composition.
- Bread improvers are compositions containing a variety of ingredients, which improve dough properties and the quality of bakery products, e.g. bread and cakes.
- Bread improvers are often added in industrial bakery processes because of their beneficial effects e.g. the dough stability and the bread texture and volume.
- Bread improvers usually contain fats and oils as well as additives like emulsifiers, enzymes, antioxidants, oxidants, stabilizers and reducing agents.
- enzymes which may also be present in the bread improver or which may be otherwise used in conjunction with any of the polypeptides of the present invention include amylases, hemicellulases, amylolytic complexes, lipases, proteases, xylanases, pectinases, pullulanases, non starch polysaccharide degrading enzymes and redox enzymes like glucose oxidase, lipoxygenase or ascorbic acid oxidase.
- any of the polypeptides of the invention may be added to dough as part of a bread improver composition which also comprises a glucomannan and/or galactomannan source such as konjac gum, guar gum, locust bean gum (Ceratonia siliqua), copra meal, ivory nut mannan (Phyteleohas macrocarpa), seaweed mannan extract, coconut meal, and the cell wall of brewers yeast (may be dried, or used in the form of brewers yeast extract).
- Other acceptable mannan derivatives for use in the current invention include unbranched P-l,4-linked mannan homopolymer and manno-oligosaccharides
- mannobiose mannotriose, mannotetraose and mannopentoase
- Any polypeptide of the invention can be further used either alone, or in combination with a glucomannan and/or galactomannan and/or galactoglucomannan to improve the dough tolerance; dough flexibility and/or dough stickiness; and/or bread crumb structure, as well as retarding staling of the bread.
- the mannanase hydrolysates act as soluble prebiotics such as manno- oligosaccharides (MOS) which promote the growth of lactic acid bacteria commonly associated with good health when found at favourable population densities in the colon.
- MOS manno- oligosaccharides
- the dough to which any polypeptide of the invention is added comprises bran or oat, rice, millet, maize, or legume flour in addition to or instead of pure wheat flour (i.e., is not a pure white flour dough).
- Polypeptides of the present invention for use in Dairy food products
- any polypeptide of the invention may be added to milk or any other dairy product to which has also been added a glucomannan and/or galactomannan.
- Typical glucomannan and/or galactomannan sources are listed above in the bakery aspects, and include guar or konjac gum.
- any polypeptide of the invention with a glucomannan and/or galactomannan releases mannanase hydrolysates (mannooligosaccharides) which act as soluble prebiotics by promoting the selective growth and proliferation of probiotic bacteria (especially Bifidobacteria and Lactobacillus lactic acid bacteria) commonly associated with good health when found at favourable population densities in the large intestine or colon.
- mannanase hydrolysates mannooligosaccharides
- probiotic bacteria especially Bifidobacteria and Lactobacillus lactic acid bacteria
- Another aspect relates to a method of preparing milk or dairy products comprising addition of any polypeptide of the invention and any glucomannan or galactomannan or galactoglucomannan.
- any polypeptide of the invention is used in combination with any glucomannan or galactomannan prior to or following addition to a dairy based foodstuff to produce a dairy based foodstuff comprising prebiotic mannan hydrolysates.
- the thusly produced mannooligosacharide-containing dairy product is capable of increasing the population of beneficial human intestinal microflora
- the dairy based foodstuff may comprise any polypeptide of the invention together with any source of glucomannan and/or galactomannan and/or galactoglucomannan, and a dose sufficient for inoculation of at least one strain of bacteria (such as Bifidobacteria or Lactobacillus) known to be of benefit in the human large intestine.
- the dairy-based foodstuff is a yoghurt or milk drink.
- polypeptides described herein find further use in the enzyme aided bleaching of paper pulps such as chemical pulps, semi-chemical pulps, kraft pulps, mechanical pulps, and pulps prepared by the sulfite method.
- paper pulps are incubated with a polypeptide and/or isolated polypeptide or fragment or variant thereof described herein under conditions suitable for bleaching the paper pulp.
- the pulps are chlorine free pulps bleached with oxygen, ozone, peroxide or peroxyacids.
- a polypeptide of the invention is used in enzyme aided bleaching of pulps produced by modified or continuous pulping methods that exhibit low lignin contents.
- a polypeptide of the present invention is applied alone or preferably in combination with xylanase and/or endoglucanase and/or alpha- galactosidase and/or cellobiohydrolase enzymes.
- Galactomannans such as guar gum and locust bean gum are widely used as thickening agents e.g., in food and print paste for textile printing such as prints on T-shirts.
- a polypeptide described herein also finds use in reducing the thickness or viscosity of mannan-containing substrates.
- a polypeptide described herein is used for reducing the viscosity of residual food in processing equipment thereby facilitating cleaning after processing.
- a polypeptide disclosed herein is used for reducing viscosity of print paste, thereby facilitating wash out of surplus print paste after textile printings.
- a mannan-containing substrate is incubated with a polypeptide and/or isolated polypeptide or fragment or variant thereof described herein under conditions suitable for reducing the viscosity of the mannan-containing substrate.
- nucleic acid sequence for the BciMan3 gene (NCBI Reference Sequence AY907668.1, from 430 to 1413, complement) isolated from B. circulans 196 is set forth as SEQ ID NO:3 (the sequence encoding the predicted native signal peptide is shown in bold):
- nucleic acid sequence for the BciMan4 gene (NCBI Reference Sequence AY913796.1, from 785 tol765) isolated from Bacillus circulans CGMCC1554 is set forth as SEQ ID NO:5 (the sequence encoding the predicted native signal peptide is shown in bold): ATGGCCAAGTTGCAAAAGGGTACAATCTTAACAGTCATTGCAGCACTGATGTT TGTCATTTTGGGGAGCGCGGCGCCCAAAGCCGCAGCAGCTACAGGTTTTTACGT GAATGGAGGCAAATTGTACGATTCTACGGGTAAACCATTTTACATGAGGGGTATCA ATCATGGGCACTCCTGGTTTAAAAATGATTTGAACACGGCTATCCCTGCGATCGCAA AAACGGGTGCCAATACGGTACGAATTGTTTTATCAAACGGTACACAATACACCAAG GATGATCTGAATTCCGTAAAAAACATCATTAATGTCGTAAATGCAAACAAGATGAT TGCTGTGCTTGAAGTAC ACGATGCC
- nucleic acid sequence for the PpoManl gene (NCBI Reference Sequence NC_014483.1, from 649134 to 650117, complement) isolated from Paenibacillus polymyxa E681 is set forth as SEQ ID NO:7 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the protein encoded by the PpoManl gene, PpoManl (NCBI Accession No. YP_003868989.1) is set forth as SEQ ID NO:8 (the predicted native signal peptide is shown in bold):
- NC_014622.1, from 746871 to747854, complement isolated from Paenibacillus polymyxa SC2 is set forth as SEQ ID NO:9 (the sequence encoding the predicted native signal peptide is shown in bold): GTGAACGCATTGTTAAGAAAAGCATTATTGTCTGGACTCGCTGGTCTGCTTATC ATGATTGGTTTGGGGGGATTCTTCTCCAAGGCGCAAGCTGCTTCAGGATTTTAT
- amino acid sequence of the hypothetical protein encoded by the FpoManl gene, PpoMan2 (NCBI Accession No. YP_003944884.1) is set forth as SEQ ID NO: 10 (the predicted native signal peptide is shown in bold):
- nucleic acid sequence for the PspMan4 gene (NCBI Reference Sequence GQ358926.1) isolated from Paenibacillus sp. Al is set forth as SEQ ID NO: 11 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the protein encoded by the PspMan4 gene, PspMan4 (NCBI Accession No. ACU30843.1) is set forth as SEQ ID NO: 12 (the predicted native signal peptide is shown in bold):
- JN603735.1, from 536 to 1519) isolated from Paenibacillus sp. CH-3 is set forth as SEQ ID NO: 13 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the protein encoded by the PspMan5 gene, PspMan5 (NCBI Accession No. AEX60762.1) is set forth as SEQ ID NO: 14 (the predicted native signal peptide is shown in bold):
- mannanases were identified by sequencing the genomes of Paenibacillus amylolyticus DSM11730, DSM15211, and DSM11747, Paenibacillus pabuli DSM3036, Paenibacillus sp. FeL05 (renamed as Paenibacillus hunanensis DSM22170), and Paenibacillus tundrae (Culture Collection DuPont). The entire genomes of these organisms were sequenced by BaseClear (Leiden, The Netherlands) using the Illumina's next generation sequencing technology and subsequently assembled by BaseClear. Contigs were annotated by BioXpr (Namur, Belgium).
- nucleotide sequence of the PamMan2 gene isolated from Paenibacillus amylolyticus is set forth as SEQ ID NO: 15 (the identical sequence was found in DSM11730,
- the amino acid sequence of the PamMan2 precursor protein is set forth as SEQ ID NO: 16 (the predicted native signal peptide is shown in bold):
- nucleotide sequence of the FpaManl gene isolated from Paenibacillus pabuli DSM3036 is set forth as SEQ ID NO: 18 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the PpaMan2 precursor protein is set forth as SEQ ID NO: 19 (the predicted native signal peptide is shown in italics and bold):
- amino acid sequence of the PspMan9 precursor protein is set forth as SEQ ID NO:21 (the predicted native signal peptide is shown in italics and bold):
- nucleotide sequence of the FtuManl gene isolated from Paenibacillus tundrae is set forth as SEQ ID NO:22 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the PtuMan2 precursor protein is set forth as SEQ ID NO:23 (the predicted native signal peptide is shown in bold):
- PpaManl, PpoManl, PpoManl, PspMan4, PspMan5, and PspMan9 genes were synthesized and inserted into the B. subtilis expression vector p2JM103BBI (Vogtentanz, Protein Expr Purif, 55:40-52, 2007) by Generay Biotech (Shanghai, China), resulting in expression plasmids containing an aprE promoter, an aprE signal sequence used to direct target protein secretion in B.
- subtilis an oligonucleotide AGK-proAprE that encodes peptide Ala-Gly-Lys to facilitate the secretion of the target protein, and the synthetic nucleotide sequence encoding the mature region of the gene of interest.
- a representative plasmid map for PspMan4 expression plasmid (p2JM- PspMan4) is depicted in Figure 1.
- a suitable B. subtilis host strain was transformed with each of the expression plasmids and the transformed cells were spread on Luria Agar plates supplemented with 5ppm chloramphenicol.
- B. subtilis transformants containing the plasmids were grown in a 250ml shake flask in a MOPS based defined medium, supplemented with additional 5mM CaCl 2 .
- nucleotide sequence of the synthesized BciManl gene in the expression plasmid p2JM-BciManl is set forth as SEQ ID NO:25 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the BciManl precursor protein expressed from the p2JM-BciManl plasmid is set forth as SEQ ID NO:26 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the BciManl mature protein expressed from p2JM- BciManl plasmid is set forth as SEQ ID NO:27 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- the nucleotide sequence of the synthesized BciMan3 gene in the p2JM-BciMan3 plasmid is set forth as SEQ ID NO:29 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAACAGGCTTTTATGT CAATGGCACGAAACTGTATGATAGCACAGGCAAAGCATTTGTTATGAGAGGCGTTA ATCATCCGCATACGTGGTATAAAAACGATCTGAATGCAGCAATTCCGGCTATTGCA CAAACAGGCGCAAATACAGTTAGAGTTGTTCTGTCAAATGGCAGCCAATGGACAAA AGATGATCTGAATAGCGTCAACAGCATTTCACTGGTTAGCCAACATCAAATGAAATGGCAAA
- amino acid sequence of the BciMan3 precursor protein expressed from the p2JM-BciMan3 plasmid is set forth as SEQ ID NO:30 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the BciMan3 mature protein expressed from p2JM- BciMan3 is set forth as SEQ ID NO:31 (the three residue amino-terminal extension based on the predicted cleavage site shown in bold):
- the nucleotide sequence of the synthesized BciMan4 gene in the expression plasmid p2JM-BciMan4 is set forth as SEQ ID NO:33 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the BciMan4 precursor protein expressed from plasmid p2JM-BciMan4 is set forth as SEQ ID NO:34 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the BciMan4 mature protein expressed from p2JM- BciMan4 is set forth as SEQ ID NO:35 (the three residue amino-terminal extension based on the predicted cleavage site shown in bold):
- the nucleotide sequence of the synthesized FpaManl gene in plasmid p2JM- PpaMan2 is set forth as SEQ ID NO:37 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAGCAGGCTTTTATGT TTCAGGCAACAAGCTGTATGATTCAACAGGAAAAGCATTTGTTATGAGAGGCGTTA ATCATTCACATACATGGTTTAAGAACGATCTTAATACAGCCATTCCGGCAATCGCGA AGACAGGAGCAAATACAGTGAGAATTGTTCTTTCAAACGGAACGCAATATACAAAA GATGACCTGAACGCCGTTAAGAATATCATTAATCTGGTTTCACAAAATAAGATG
- amino acid sequence of the PpaMan2 precursor protein expressed from plasmid p2JM-PpaMan2 is set forth as SEQ ID NO:38 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension(AGK) is shown in bold):
- amino acid sequence of the PpaMan2 mature protein expressed from p2JM- PpaMan2 is set forth as SEQ ID NO:39 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- amino acid sequence of the PpaMan2 mature protein is set forth as SEQ ID NO:40:
- nucleotide sequence of the synthesized PpoManl gene in plasmid p2JM- PpoManl is set forth as SEQ ID NO:41(the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAAGCGGCTTTTATGT TTCAGGCACAAAACTGTATGATAGCACAGGCAAACCGTTTGTTATGAGAGGCGTTA ATCATGCACATACGTGGTATAAAAACGATCTGTATACGGCAATTCCGGCTATTGCAC AAACAGGCGCAAATACAGTTAGAATTGTTCTGAGCAATGGCAACCAGTATACGAAA GATGATATCAACAGCGTCAAAAACATTATCAGCCTGGTCAGCAACTATAAAATGAT
- amino acid sequence of the PpoManl precursor protein expressed from plasmid p2JM-PpoManl is set forth as SEQ ID NO:42 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension(AGK) is shown in bold):
- amino acid sequence of the PpoManl mature protein expressed from p2JM- PpoManl is set forth as SEQ ID NO:43 (the three residue amino-terminal extension based on the predicted cleavage site shown in bold):
- the nucleotide sequence of the synthesized FpoManl gene in plasmid p2JM- PpoMan2 is set forth as SEQ ID NO:45 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAAGCGGCTTTTATGT TTCAGGCACAAATCTGTATGATAGCACAGGCAAACCGTTTGTTATGAGAGGCGTTA ATCATGC ACATACGTGGTATAA AAACGATCTGTATACGGCAATTCCGGCAATCGC A AAAACAGGCGCAAATACAGTTAGAATTGTTCTGAGCAATGGCAACCAGTATACGAA AGATGATATCAACAGCGTCAAAAACATTATCAGCCTGGTCAGCAACCATAAAATGA
- amino acid sequence of the PpoMan2 precursor protein expressed from plasmid p2JM-PpoMan2 is set forth as SEQ ID NO:46 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold): MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKASGFYVSGTNLYOSTGKPFVMRGVNHAH TWYKNDLYTAIPAIAKTGANTVRIVLSNGNQYTKDDINSVKNIISLVSNHKMIAVLEVH DATGKDDYASLDAAVNYWISIKDALIGKEDRVrVNIANEWYGSWNGGGWADGYKQAI PKLRNAGIKNTLIVDCAGWGQYPQSINDFGKSVFAADSLKNTVFSIHMYEFAGKDVQT VRTNIDNVLYQGLPLIIGEFGGYHQGADVDETEIMRYGQSKSVGWLAWSWYGNSSNLN YLDLVTGPNG
- amino acid sequence of the PpoMan2 mature protein expressed from p2JM- PpoMan2 is set forth as SEQ ID NO:47 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- amino acid sequence of the PpoMan2 mature protein is set forth as SEQ ID NO:48:
- nucleotide sequence of the synthesized PspMan4 gene in plasmid p2JM- PspMan4 is set forth as SEQ ID NO:49 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCAGGCTGCTGGAAATGGCGACAGGCTTTT ATGTTTCAGGCAACAAACTGTATGATAGCACAGGCAAACCGTTTGTTATGAGAGGC GTTAATCATGGCCATAGCTGGTTTAAAAACGATCTGAATACAGCGATTCCGGCTATT GCAAAAACAGGCGCAAATACAGTTAGAATTGTTCTGTCAAATGGCAGCCTGTATAC GAAAGATGATCTGAATGCAGTCAAAAAAACATCATCAATGTCGTCAACCAGAACAAA
- amino acid sequence of the PspMan4 precursor protein expressed from plasmid p2JM-PspMan4 is set forth as SEQ ID NO:50 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the confirmed PspMan4 mature protein expressed from p2JM-PspMan4 is set forth as SEQ ID NO:51 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- amino acid sequence of the confirmed PspMan4 mature protein is set forth as SEQ ID NO:52: MATGFYVSGNKLYDSTGKPFVMRGVNHGHSWFKNDLNTAIPAIAKTGANTVRIVLSNG SLYTKDDLNAVKNIINVVNQNKMIAVLEVHDATGKDDYNSLDAAVNYWISIKEALIGK EDRVIVNIANEWYGTWNGSAWADGYKKAIPKLRNAGIKNTLIVDAAGWGQFPQSIVD YGQSVFAADSQKNTVFSIHMYEYAGKDAATVKANMENVLNKGLALIIGEFGGYHTNG DVDEYAIMRYGQEKGVGWLAWSWYGNSSGLNYLDMATGPNGSLTSFGNTVVNDTYG IKNTSQKAGIF.
- the nucleotide sequence of the synthesized PspMan5 gene in plasmid p2JM- PspMan5 is set forth as SEQ ID NO:53 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAA ATTGTGGATCAGCTTGTTGTTTGCGTTA ACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAACAGGCTTTTATGT TTCAGGCACAACACTGTATGATTCAACAGGCAAACCGTTTGTTATGAGAGGCGTTA ATCATAGCCATACGTGGTTTAAAAACGATCTGAATGCAGCAATTCCGGCAATCGCA AAAACAGGCGCAAATACAGTTAGAATTGTTCTGTCAAATGGCGTCCAGTATACAAG AGATGATGTCAATAGCGTC AAAAACATTATC AGCCTGGTCAACCAGAAC AAAAT
- amino acid sequence of the PspMan5 precursor protein expressed from plasmid p2JM-PspMan5 is set forth as SEQ ID NO:54 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold): MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKATGFYVSGTTLYOSTGKPFVMRGVNHSH TWFKNDLNAAIPAIAKTGANTVRIVLSNGVQYTRDDVNSVKNIISLVNQNKMIAVLEVH DATGKDDYASLDAAVNYWISIKDALIGKEDRVIVNIANEWYGTWNGSAWADGYKQAI PKLRNAGIKNTLIVDAAGWGQCPQSIVDYGQSVFAADSLKNTIFSIHMYEYAGGTDAIV KSNMENVLNKGLPLIIGEFGGQHTNGDVDEHAIMRYGQQKGVGWLAWSWYGNNSEL S YLDLA
- amino acid sequence of the PspMan5 mature protein expressed from p2JM- PspMan5 is set forth as SEQ ID NO:55 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- amino acid sequence of the PspMan5 mature protein is set forth as SEQ ID NO:56:
- nucleotide sequence of the synthesized PspMan9 gene in plasmid p2JM- PspMan9 is set forth as SEQ ID NO: 57 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue addition (AGK) is shown in bold):
- amino acid sequence of the PspMan9 precursor protein expressed from plasmid p2JM-PspMan9 is set forth as SEQ ID NO:58 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold):
- amino acid sequence of the PspMan9 mature protein expressed from p2JM- PspMan9 is set forth as SEQ ID NO:59 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site shown in bold):
- amino acid sequence of the PspMan9 mature protein is set forth as SEQ ID NO:60:
- BciManl, BciMan4, and PspMan4 proteins were purified via two chromatography steps: anion-exchange and hydrophobic interaction chromatography.
- the concentrated and desalted crude protein samples were loaded onto a 70 ml Q-Sepharose High Performance column pre-equilibrated with buffer A (Tris-HCl, pH7.5, 20mM). After column washing, the proteins were eluted with a gradient of 0-50% buffer A with 1 M NaCl in 5 column volumes. The target protein was in the flowthrough. Ammonium sulfate was then added to the
- BciMan3, PpoManl, PpoMan2 proteins were purified using a three step anion- exchange, hydrophobic interaction chromatography and gel filtration purification strategy.
- the 700 mL crude broth from the shake flask was concentrated by VIVAFLOW 200 (cutoff 10 kDa) and buffer exchanged into 20 mM Tris-HCl (pH 7.5).
- the liquid was then loaded onto a 50 mL Q-Sepharose High Performance column which was pre-equilibrated with 20 mM Tris-HCl, pH 7.5 (buffer A).
- the column was eluted with a linear gradient from 0 to 50% buffer B (buffer A containing 1 M NaCl) in 3 column volumes, followed with 3 column volumes of 100% buffer B.
- the protein of interest was detected in the gradient elution part and the pure fractions were pooled.
- 3 M ammonium sulfate solution was added to the active fractions to an ultimate concentration of 1 M, and then the pretreated fraction was loaded onto a 50 mL Phenyl- Sepharose Fast Flow column equilibrated with 20 mM Tris-HCl (pH 7.5) containing 1 M ammonium sulfate.
- the resulting solution was applied to a HiPrepTM Q XL 16/10 column pre-equilibrated with 20 mM Tris (pH8.5).
- the target protein was eluted from the column with a linear salt gradient from 0 to 0.6 M NaCl in buffer A.
- the resulting active protein fractions were then pooled and
- PpaMan2 was purified using hydrophobic interaction chromatography and cation exchange chromatography. 800 mL crude broth was concentrated by VIVAFLOW 200 (cutoff 10 kDa) and ammonium sulfate was added to a final concentration of 0.8 M. The sample was then loaded onto a 50 mL Phenyl-Sepharose High Performance column which was pre- equilibrated with buffer A (20 mM sodium acetate containing 0.8 M ammonium sulfate, pH 5.5). The column was treated with a gradient elution of 0-100% buffer B (20 mM sodium acetate at pH 5.5) in 5 column volumes, followed with 3 column volumes of 100% buffer B.
- the relative pure active fractions were pooled and buffer exchanged into buffer B.
- the solution turned to be cloudy and was dispensed to 50 mL tubes, centrifuged at 3800 rpm for 20 min. The supernatant and the precipitant were collected.
- the target protein was identified in the supernatant which was then subjected onto an SP- Sepharose Fast Flow column, a linear gradient elution with 0-50% buffer C (20 mM sodium acetate containing 1M sodium chloride) in 4 column volumes followed with 3 column volumes' step elution (100% buffer C) was performed.
- the purity of the each fraction was evaluated with SDS-PAGE. Pure fractions were pooled and concentrated using 10 kDa Amicon Ultra- 15 devices.
- the purified sample was stored in 20 mM sodium acetate buffer (pH 5.5) with 40% glycerol at -20°C.
- the beta 1-4 mannanase activity of the mannanases was measured using 0.5% locust bean gum galactomannan (Sigma G0753) and konjac glucomannan (Megazyme P-GLCML) as substrates.
- the assays were performed at 50°C for 10 minutes using two different buffer systems: 50 mM sodium acetatepH 5, and 50 mM HEPES pH 8.2.
- the released reducing sugar was quantified using a PAHBAH (p-Hydroxy benzoic acid hydrazide) assay (Lever, Anal Biochem, 47:248, 1972).
- PAHBAH p-Hydroxy benzoic acid hydrazide
- a standard curve using mannose was created for each buffer, and was used to calculate enzyme activity units.
- one mannanase unit is defined as the amount of enzyme required to generate 1 micromole of mannose reducing sugar equivalent per minute.
- the specific activities of the mannanases are summarized in Table
- the pH profile of mannanases was determined by assaying for mannanase activity at various pH values ranging from 2 to 9 at 50°C for 10 min with locust bean gum as the substrate.
- the proteins were diluted in 0.005% Tween-80 to an appropriate concentration based on the dose response curve.
- the substrate solutions buffered using sodium citrate/sodium phosphate buffers of different pH units, were pre-incubated in the thermomixer at 50°C for 5 min.
- the reaction was initiated by the addition of mannanases.
- the mixture was incubated at 50°C for 10 min, and then the reaction was stopped by transferring 10 microliters of reaction mixture to a 96- well PCR plate containing 100 microliters of the PAHBAH solution.
- the PCR plate was heated at 95°C for 5 minutes in a Bio-Rad DNA Engine. Then 100 microliters were transferred from each well to a new 96-well plate. The release of reducing sugars from the substrate was quantified by measuring the optical density at 410 nm in a spectrophotometer. Enzyme activity at each pH is reported as relative activity where the activity at the pH optimum was set to 100% The pH optimum and range of > 70% activity for the mannanases under these assay conditions is shown in Table 2.
- the temperature profile of mannanases was determined by assaying for mannanase activity with locust bean gum as the substrate at various temperatures for 10 min in 50 mM sodium citrate buffer at pH 6.0. The activity is reported as relative activity where the activity at the temperature optimum was set to 100%. The temperature optimum and temperature range of
- the temperature stability of Paenibacillus and Bacillus mannanases was determined in 50 mM sodium citrate buffer at pH 6.0. The enzyme was incubated at temperatures ranging from 40°C to 90°C for 2 hours in a thermocycler. The remaining enzyme activity was measured using locust bean gum as the substrate. The activity of the sample kept on ice was defined as 100% activity. The temperatures at which the enzymes retain 50% activity (T50) after a 2-hour incubation period under these assay conditions are shown in Table 4.
- Cleaning performance was measured using a high throughput assay developed to measure galactomannan removal from technical soils.
- the assay measures the release of locust bean gum from the technical soils containing locust bean gum.
- the BCA reagent measures the reducing ends of oligosaccharides released in the presence of mannanase enzyme, as compared to a blank (no enzyme) control. This measurement correlates with the cleaning performance for the enzymes.
- mannanases hydrolyze galactomannans, oligosaccharides of varying lengths with new reducing ends are released from the cotton swatch.
- the bicinchoninic acid in the BCA reagent then allows for the highly sensitive colorimetric detection as Cu 1+ is formed by the reduction of Cu 2+ .
- Aligned Length refers to the length (in amino acids) of the aligned protein sequence used for the PID calculation.
- Table 5A List of sequences with percent identity to PpaMan2 protein identified from the N( BI non-redundant protein database
- Table 6B List of sequences with percent identity to PspMan4 protein identified from
- Table 7A List of sequences with percent identity to PspMan9 protein identified from the NCBI non-redundant protein database
- a phylogenetic tree for amino acid sequences of the mannanases aligned in Figure 3 was built, and is shown on Figure 4.
- the full-length, untrimmed sequences were entered in the Vector NTI Advance suite and a Guide Tree was created using the Neighbor Joining (NJ) method (Saitou and Nei, Mol Biol Evol, 4:406-425, 1987).
- NJ Neighbor Joining
- the tree construction was calculated using the following parameters: Kimura's correction for sequence distance and ignoring positions with gaps.
- AlignX displays the calculated distance values in parenthesis following the molecule name displayed on the tree shown in Figure 4.
- NDL- Clade where the term NDL derives from the complete conserved residues NDL near the N- terminus (Asn- Asp-Leu 33-35).
- the numbering of residues for the mannanases shown is the consecutive linear sequence and are numbered by correspondence with the amino acid sequence set forth in SEQ ID NO:32.
- WX a KNDLXXAI where where X a is F or Y and X is any amino acid
- WX a KNDLX b X c AI where X a is F or Y, X b is N, Y or A, and X c is A or T
- WF/YKNDLX ⁇ T/A AI where Xi is N, Y or A.
- the phylogenetic tree described in Example 10 shows a differentiation between the NDL-Clade mannanases and other mannanases.
- the clade further differentiates into NDL- Clade 1 and NDL-Clade 2 where NDL-Clade 1 includes PtuMan2, PamMan2, PspMan4, BciMan4, PpaMan2, PspMan9 and PspMan5 while NDL-Clade 2 includes BciMan3, PpoMan2 and PpoManl.
- All members of the NDL-Clade have a conserved motif with the key feature of a deletion which is not present in the Bacillus sp. JAMB-602 and other reference mannanase sequences (hereinafter the "deletion motif).
- the deletion motif starts at position 262 in the conserved linear sequence of the amino acid sequences set forth in Figure 6 and includes the sequence LDXXXGPXGXLT, where X is any amino acid or LDM/LV/AT/AGPX ⁇ GX 2 LT, where is N, A or S and X 2 is S, T or N.
- the sequence further differentiates into
- NDL-Clade deletion motif i.e., LDM/LV/AT/AGPX ⁇ GX 2 LT, where ⁇ is N, A or S and X 2 is S, T or N
- LDM/LV/AT/AGPX ⁇ GX 2 LT where ⁇ is N, A or S and X 2 is S, T or N
- LD Leu262-Asp263
- LT Leu272-Thr273
- mannanases PspMan4, PspMan9 and PpaMan2 (gray).
- the structures of PspMan4, PspMan9 and PpaMan2 were modelled using the "align" option in the Molecular Operating Environment (MOE) software (Chemical Computing Group, Montreal, Quebec, Canada) to look for structural similarities.
- MOE Molecular Operating Environment
- the alignment applies conserved structural motifs as an additional guide to conventional sequence alignment. This alignment was performed using standard program defaults present in the 2012.10 distribution of MOE.
- the deletion motif segment is designated with an arrow. This deletion motif is located in a loop in the structure in the C-terminus. The C-terminal region of the Bacillus sp.
- JAMB-602 mannanase is thought to be important to understanding how these mannanases interact in alkaline environments (Akita et al., Acta Cryst, 60: 1490-1492, 2004). It is postulated that the deletion impacts the structure, length and flexibility of this loop which then impacts the activity and performance of the NDL-Clade mannanases.
- nucleotide sequence of the PamMan3 gene isolated from Paenibacillus sp. N021 is set forth as SEQ ID NO:61 (the sequence encoding the predicted native signal peptide is shown in bold):
- amino acid sequence of the PamMan3 precursor protein is set forth as SEQ ID NO:62 (the predicted native signal peptide is shown in bold):
- SEQ ID NO:63 ASGFYVSGNKLYDSTGKPFVMRGINHGHSWFKNDLNTAIPAIAKTGANTVRIVLSNGTLYTKDD LNSVK I INLVNQNKMIAVLEVHDATGKDDYNSLDAAVNYWI S IKEALIGKEDRVIV IANEWY GTWNGSAWADGYKKAIPKLRNAGIKNTLIVDAAGWGQYPQS IVDYGQSVFATDTLKNTVFS IHM YEYAGKDAATVKANMENVLNKGLAVI IGEFGGYHTNGDVDEYAIMRYGQEKGVGWLAWSWYGNS SGLGYLDLATGPNGSLTSYGNTVVNDTYGIKNTSQKAGIFQ .
- the nucleotide sequence of the synthesized PamMan3 gene in plasmid p2JM- PamMan3 is set forth as SEQ ID NO:64 (the gene has an alternative start codon (GTG), the oligonucleotide encoding the three residue amino-terminal extension (AGK) is shown in bold): GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAATCTTTACG ATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCATCAGGCTTTTATGT TTCAGGC AATAAACTTTATGATTC AACAGGAAAACCGTTTGTTATGAGAGGAATTA ATCACGGACATTCATGGTTCAAAAATGATCTTAACACAGCTATTCCGGCGATTGCGA AGACAGGCGCAAATACAGTTAGAATTGTTCTGTCAAATGGCACGCTGTACACAAAG GACGATCTGAACAGCGTTAAAAACATCATTAATCTGGTTAATCAAAATAAGATGATGAT
- the amino acid sequence of the PamMan3 precursor protein expressed from plasmid p2JM-PamMan3 is set forth as SEQ ID NO:65 (the predicted signal sequence is shown in italics, the three residue amino-terminal extension (AGK) is shown in bold): MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKASGFYVSGNKLYOSTGKPFVMRGINHGH SWFKNDLNTAIPAIAKTGANTVRIVLSNGTLYTKDDLNSVKNIINLVNQNKMIAVLEVH DATGKDDYNSLDAAVNYWISIKEALIGKEDRVIVNIANEWYGTWNGSAWADGYKKAI PKLRNAGIKNTLIVDAAGWGQYPQSrVDYGQSVFATDTLKNTVFSIHMYEYAGKDAAT VKANMENVLNKGLAVIIGEFGGYHTNGDVDEYAIMRYGQEKGVGWLAWSWYGNSSG LG YLDLATGPNGS L
- amino acid sequence of the PamMan3 mature protein expressed from p2JM- PamMan3 plasmid is set forth as SEQ ID NO:66 (the three residue amino-terminal extension (AGK) based on the predicted cleavage site is shown in bold):
- PamMan3 was purified via two chromatography steps: hydrophobic interaction chromatography and anion-exchange chromatography.
- the concentrated and desalted crude protein sample was loaded onto a Phenyl-Sepharose High Performance column pre-equilibrated with 20 mM HEPES (pH 7.4) containing 2.0 M ammonium sulfate. Gradient elution was performed, and fractions with enzymatic activity were pooled and loaded onto a 30 mL Q-
- Sepharose High Performance column pre-equilibrated with buffer A (20 mM HEPES, pH 7.4).
- the column was subjected to a gradient elution of 0-50% buffer B (buffer A containing 1 M sodium chloride) in 5 column volumes, followed by 4 column volumes of 100% buffer B.
- the purity of each fraction was analyzed by SDS-PAGE, and the result showed that the target protein had been effectively purified.
- the fractions with high purity were pooled and concentrated using an Amicon Ultra- 15 device with 10 K MWCO.
- the final purified protein was stored in 40% glycerol at -20°C until usage.
- Sequence Length refers to the length (in amino acids) of the protein sequences associated with the listed Accession Nos.
- Aligned Length refers to the length (in amino acids) of the aligned protein sequence used for the PID calculation.
- Table 12B List of sequences with percent identity to PamMan3 protein identified from the Genome Quest database
- a multiple mannanase amino acid sequence alignment was constructed using the trimmed amino acid sequences set forth in Figure 5 and the trimmed mature amino acid sequences for: PamMan3 (SEQ ID NO:67), Paenibac.sp_ETT37549.1 (SEQ ID NO:68), Paenibac.sp._WP_024633848.1 (SEQ ID NO:70), BleManl (SEQ ID NO:75), Bac.sp_
- WO2015022428-0015 (SEQ ID NO:78), 2WHL_A (SEQ ID NO:79) and
- P_mucilaginosus_YP_006190599.1 (SEQ ID NO:81) mannanases, and is shown in Figure 9. These sequences were aligned using CLUSTALW software (Thompson et al., Nucleic Acids
- Paenibac.sp._WP_024633848.1 (SEQ ID NO:70), PamMan3 (SEQ ID NO:67), BciMan4 (SEQ ID NO:36), PspMan4 (SEQ ID NO:52), PamMan2 (SEQ ID NO: 17), Paenibac.sp_ETT37549.1 (SEQ ID NO:68), and Paenibac.sp_WP_017688745.1 (SEQ ID NO:69) all belong to the NDL- Clade, of which a further sequence alignment of the trimmed amino acid sequences was provide using CLUSTALW software (Thompson et al., Nucleic Acids Research, 22:4673-4680, 1994) with the default parameters and is set forth in Figure 11.
- NDL-Clade can be further differentiated into NDL-Clade 1 , NDL-Clade 2, and NDL-Clade 3.
- NDL-Clade 1 includes PtuMan2, PamMan2, PamMan3, PspMan4, BciMan4, PpaMan2, PspMan9, PspMan5, Paenibac.sp._WP_017813111.1,
- NDL-Clade 2 includes BciMan3, Paenibac.sp.WP_009593769.1, PpoManl, PpoMan2, and Paenibac.sp_WP_017427981.1.
- NDL-Clade 3 includes P_mucilaginosus_YP_006190599.1 and Paenibac.sp_WP_019912481.1.
- a phylogenetic tree for the trimmed amino acid sequences of the NDL clade mannanases BciManl (SEQ ID NO:28), BciMan3 (SEQ ID NO:32), BciMan4 (SEQ ID NO:
- Paenibac.sp_ETT37549.1 (SEQ ID NO:68), Paenibac.sp_WP_017688745.1 (SEQ ID NO:69), Paenibac.sp._WP_024633848.1 (SEQ ID NO:70), Paenibac.sp._WP_017813111.1 (SEQ ID NO:71), Paenibac.sp_WP_017427981.1 (SEQ ID NO:72), Paenibac.sp.WP_009593769.1 (SEQ ID NO:73), Paenibac.sp_WP_019912481.1 (SEQ ID NO:74), BleManl (SEQ ID NO:75), Bac.nealsonii_AGU71466.1 (SEQ ID NO:76), Bac.sp._BAD99527.1 (SEQ ID NO:77), Bac.sp_ WO2015022428-0015 (SEQ ID NO:78), and 2WHL_A (SEQ ID NO
- P_mucilaginosus_YP_006190599.1 (SEQ ID NO:81), was built, and shown on FigurelO.
- the trimmed sequences were entered in the Vector NTI Advance suite and the alignment file was subsequently imported into The Geneious Tree Builder program (Geneious 8.1.2) and the phylogenetic tree shown in Figure 10 was built using the The Geneious Tree Builder, Neighbor- Joining tree build method. The percent sequences identity among these sequences was calculated and is shown on Table 13. Table 13. The percent sequence identity among ND ⁇ -1 clade mannanase mature sequences.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Polymers & Plastics (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Husbandry (AREA)
- Nutrition Science (AREA)
- Vascular Medicine (AREA)
- Detergent Compositions (AREA)
- Enzymes And Modification Thereof (AREA)
- Fodder In General (AREA)
- Alcoholic Beverages (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Non-Alcoholic Beverages (AREA)
- Distillation Of Fermentation Liquor, Processing Of Alcohols, Vinegar And Beer (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Treatments For Attaching Organic Compounds To Fibrous Goods (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112017000505A BR112017000505A2 (pt) | 2014-07-11 | 2015-07-10 | mananases de paenibacillus e bacillus spp. |
| EP15744426.6A EP3166419B1 (en) | 2014-07-11 | 2015-07-10 | Paenibacillus and bacillus spp. mannanases |
| US15/325,305 US20170159036A1 (en) | 2014-07-11 | 2015-07-10 | Paenibacillus and bacillus spp. mannanases |
| DK15744426T DK3166419T3 (da) | 2014-07-11 | 2015-07-10 | Paenibacillus-og bacillus spp. mannanaser |
| JP2017501229A JP7255832B2 (ja) | 2014-07-11 | 2015-07-10 | パエニバチルス(Paenibacillus)及びバチルス(Bacillus)種のマンナナーゼ |
| CN201580048728.4A CN107072250A (zh) | 2014-07-11 | 2015-07-10 | 类芽孢杆菌和芽孢杆菌属物种甘露聚糖酶 |
| US16/577,096 US20200277590A1 (en) | 2014-07-11 | 2019-09-20 | Paenibacillus and bacillus spp. mannanases |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNPCT/CN2014/082034 | 2014-07-11 | ||
| CN2014082034 | 2014-07-11 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/325,305 A-371-Of-International US20170159036A1 (en) | 2014-07-11 | 2015-07-10 | Paenibacillus and bacillus spp. mannanases |
| US16/577,096 Continuation US20200277590A1 (en) | 2014-07-11 | 2019-09-20 | Paenibacillus and bacillus spp. mannanases |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016007929A2 true WO2016007929A2 (en) | 2016-01-14 |
| WO2016007929A3 WO2016007929A3 (en) | 2016-03-17 |
Family
ID=53761534
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/040057 Ceased WO2016007929A2 (en) | 2014-07-11 | 2015-07-10 | Paenibacillus and bacillus spp. mannanases |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US20170159036A1 (https=) |
| EP (1) | EP3166419B1 (https=) |
| JP (2) | JP7255832B2 (https=) |
| CN (1) | CN107072250A (https=) |
| BR (1) | BR112017000505A2 (https=) |
| DK (1) | DK3166419T3 (https=) |
| WO (1) | WO2016007929A2 (https=) |
Cited By (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016205755A1 (en) | 2015-06-17 | 2016-12-22 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
| WO2017079751A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus sp. mannanases |
| WO2017079756A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus and bacillus spp. mannanases |
| WO2017106676A1 (en) | 2015-12-18 | 2017-06-22 | Danisco Us Inc | Polypeptides with endoglucanase activity and uses thereof |
| WO2017192300A1 (en) | 2016-05-05 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
| WO2017192692A1 (en) | 2016-05-03 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
| WO2017210295A1 (en) | 2016-05-31 | 2017-12-07 | Danisco Us Inc. | Protease variants and uses thereof |
| WO2017219011A1 (en) | 2016-06-17 | 2017-12-21 | Danisco Us Inc | Protease variants and uses thereof |
| WO2018085524A2 (en) | 2016-11-07 | 2018-05-11 | Danisco Us Inc | Laundry detergent composition |
| WO2018118950A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
| WO2018118917A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Protease variants and uses thereof |
| CN108220271A (zh) * | 2018-01-25 | 2018-06-29 | 中国农业大学 | 蛋白质AxMan113A作为β-甘露聚糖酶的应用 |
| WO2018169750A1 (en) | 2017-03-15 | 2018-09-20 | Danisco Us Inc | Trypsin-like serine proteases and uses thereof |
| WO2018184004A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Alpha-amylase combinatorial variants |
| WO2018206300A1 (en) * | 2017-05-08 | 2018-11-15 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2018206302A1 (en) * | 2017-05-08 | 2018-11-15 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2019036721A2 (en) | 2017-08-18 | 2019-02-21 | Danisco Us Inc | VARIANTS OF ALPHA-AMYLASES |
| WO2019108599A1 (en) | 2017-11-29 | 2019-06-06 | Danisco Us Inc | Subtilisin variants having improved stability |
| WO2019185726A1 (en) * | 2018-03-29 | 2019-10-03 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2019245705A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
| WO2019245704A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
| WO2020028443A1 (en) | 2018-07-31 | 2020-02-06 | Danisco Us Inc | Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid |
| CN110869499A (zh) * | 2017-05-30 | 2020-03-06 | 生化酶股份有限公司 | 甘露聚糖酶变体 |
| WO2020068486A1 (en) | 2018-09-27 | 2020-04-02 | Danisco Us Inc | Compositions for medical instrument cleaning |
| WO2020070199A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same |
| WO2020077331A2 (en) | 2018-10-12 | 2020-04-16 | Danisco Us Inc | Alpha-amylases with mutations that improve stability in the presence of chelants |
| WO2020112599A1 (en) | 2018-11-28 | 2020-06-04 | Danisco Us Inc | Subtilisin variants having improved stability |
| WO2020242858A1 (en) | 2019-05-24 | 2020-12-03 | Danisco Us Inc | Subtilisin variants and methods of use |
| WO2020247582A1 (en) | 2019-06-06 | 2020-12-10 | Danisco Us Inc | Methods and compositions for cleaning |
| WO2021080948A2 (en) | 2019-10-24 | 2021-04-29 | Danisco Us Inc | Variant maltopentaose/maltohexaose-forming alpha-amylases |
| WO2022047149A1 (en) | 2020-08-27 | 2022-03-03 | Danisco Us Inc | Enzymes and enzyme compositions for cleaning |
| WO2022165107A1 (en) | 2021-01-29 | 2022-08-04 | Danisco Us Inc | Compositions for cleaning and methods related thereto |
| WO2023278297A1 (en) | 2021-06-30 | 2023-01-05 | Danisco Us Inc | Variant lipases and uses thereof |
| KR20230056061A (ko) * | 2017-04-05 | 2023-04-26 | 에이비 엔자임스 게엠베하 | 박테리아 만나나아제를 포함하는 세제 조성물 |
| WO2023114988A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Variant maltopentaose/maltohexaose-forming alpha-amylases |
| WO2023114932A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023114939A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023114936A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023168234A1 (en) | 2022-03-01 | 2023-09-07 | Danisco Us Inc. | Enzymes and enzyme compositions for cleaning |
| EP3715444B1 (en) | 2019-03-29 | 2023-11-29 | The Procter & Gamble Company | Laundry detergent compositions with stain removal |
| WO2023250301A1 (en) | 2022-06-21 | 2023-12-28 | Danisco Us Inc. | Methods and compositions for cleaning comprising a polypeptide having thermolysin activity |
| US11866748B2 (en) * | 2017-10-24 | 2024-01-09 | Novozymes A/S | Compositions comprising polypeptides having mannanase activity |
| WO2024050346A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Detergent compositions and methods related thereto |
| WO2024050343A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Subtilisin variants and methods related thereto |
| WO2024102698A1 (en) | 2022-11-09 | 2024-05-16 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2024163584A1 (en) | 2023-02-01 | 2024-08-08 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2024186819A1 (en) | 2023-03-06 | 2024-09-12 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2025071996A1 (en) | 2023-09-28 | 2025-04-03 | Danisco Us Inc. | Variant cutinase enzymes with improved solubility and uses thereof |
| WO2025085351A1 (en) | 2023-10-20 | 2025-04-24 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2026024921A1 (en) | 2024-07-25 | 2026-01-29 | The Procter & Gamble Company | Detergent composition comprising a subtilisin variant and methods of use |
| WO2026050315A1 (en) | 2024-08-29 | 2026-03-05 | Danisco Us Inc. | Subtilisin variants and methods of use |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107937378B (zh) * | 2017-11-28 | 2021-03-19 | 嘉兴温华环保科技有限公司 | 一种中性内切果胶酸裂解酶的制备方法 |
| CN107760525A (zh) * | 2017-11-30 | 2018-03-06 | 泸州向林老窖股份有限公司 | 一种人工窖泥及其培养方法 |
| CN112533614A (zh) * | 2018-03-28 | 2021-03-19 | 美国康宝莱国际公司 | 多糖的乙酰化 |
| CN109055333A (zh) * | 2018-07-26 | 2018-12-21 | 天津科技大学 | 一种糖苷水解酶及其复合酶在半乳甘露聚糖降解中的应用 |
| CN110295154A (zh) * | 2019-06-11 | 2019-10-01 | 海南久纳生物科技开发有限公司 | 一种水果酵素发酵剂 |
| WO2021058453A1 (en) * | 2019-09-23 | 2021-04-01 | Basf Se | Mannanase for formulations having ph 5-12 |
| CN113774042B (zh) * | 2020-06-10 | 2024-11-26 | 绿谷(上海)医药科技有限公司 | 一种二糖外切型β-甘露聚糖水解酶及其应用 |
| CN113881516A (zh) * | 2020-07-02 | 2022-01-04 | 北京世城双清科技有限公司 | 一种复合酶清洗剂 |
| CN113881645A (zh) * | 2020-07-02 | 2022-01-04 | 北京世城双清科技有限公司 | 一种复合酶清洗剂及其应用 |
| WO2022060942A1 (en) | 2020-09-16 | 2022-03-24 | Danisco Us Inc | Esterase and methods of use, thereof |
| CN113337557B (zh) * | 2021-05-20 | 2022-11-15 | 天津科技大学 | 葡苷寡糖及其制备方法和应用 |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2261359B1 (en) * | 1998-06-10 | 2014-08-20 | Novozymes A/S | Mannanases |
| JP2002065257A (ja) * | 2000-08-30 | 2002-03-05 | Akita Prefecture | β−マンナナーゼ、その生産菌並びにその製造法 |
| CN100410380C (zh) * | 2005-07-26 | 2008-08-13 | 中国农业科学院饲料研究所 | 一种β-甘露糖酶及其编码基因和应用 |
| US10676751B2 (en) * | 2008-02-29 | 2020-06-09 | The Trustees Of The University Of Pennsylvania | Production and use of plant degrading materials |
| JP5539657B2 (ja) * | 2009-02-24 | 2014-07-02 | 株式会社ダスキン | 食品食器用透明洗剤 |
| EP2588494B1 (en) * | 2010-06-29 | 2018-03-07 | DSM IP Assets B.V. | Polypeptide having beta-glucosidase activity and uses thereof |
| PL2588492T3 (pl) * | 2010-06-29 | 2016-09-30 | Polipeptyd mający aktywność beta-glukozydazy i jego zastosowania | |
| WO2012146317A1 (en) | 2011-04-27 | 2012-11-01 | Uztek Endustri Tesisleri Insaat Imalat Ve Montaj Sanayi Ve Ticaret Limited Sirketi | Tower production method |
| EP2712363A1 (en) * | 2011-04-29 | 2014-04-02 | Danisco US Inc. | Detergent compositions containing geobacillus tepidamans mannanase and methods of use thereof |
| CN103608356A (zh) * | 2011-04-29 | 2014-02-26 | 丹尼斯科美国公司 | 包含黏琼脂芽孢杆菌(Bacillus agaradhaerens)甘露聚糖酶的洗涤剂组合物及其使用方法 |
| CN103534266A (zh) * | 2011-04-29 | 2014-01-22 | 丹尼斯科美国公司 | 包含喜温地芽孢杆菌(geobacillus tepidamans)甘露聚糖酶的洗涤剂组合物及其使用方法 |
| CN103502445A (zh) * | 2011-04-29 | 2014-01-08 | 丹尼斯科美国公司 | 包含芽孢杆菌甘露聚糖酶的洗涤剂组合物及其使用方法 |
| WO2012149333A1 (en) * | 2011-04-29 | 2012-11-01 | Danisco Us Inc. | Detergent compositions containing bacillus sp. mannanase and methods of use thereof |
| US8802388B2 (en) * | 2011-04-29 | 2014-08-12 | Danisco Us Inc. | Detergent compositions containing Bacillus agaradhaerens mannanase and methods of use thereof |
| US20150344858A1 (en) * | 2012-12-19 | 2015-12-03 | Danisco Us Inc. | Novel mannanase, compositions and methods of use thereof |
-
2015
- 2015-07-10 EP EP15744426.6A patent/EP3166419B1/en active Active
- 2015-07-10 BR BR112017000505A patent/BR112017000505A2/pt not_active Application Discontinuation
- 2015-07-10 DK DK15744426T patent/DK3166419T3/da active
- 2015-07-10 CN CN201580048728.4A patent/CN107072250A/zh active Pending
- 2015-07-10 JP JP2017501229A patent/JP7255832B2/ja active Active
- 2015-07-10 WO PCT/US2015/040057 patent/WO2016007929A2/en not_active Ceased
- 2015-07-10 US US15/325,305 patent/US20170159036A1/en not_active Abandoned
-
2019
- 2019-09-20 US US16/577,096 patent/US20200277590A1/en not_active Abandoned
-
2020
- 2020-10-16 JP JP2020174562A patent/JP7269907B2/ja active Active
Cited By (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4234693A2 (en) | 2015-06-17 | 2023-08-30 | Danisco US Inc | Bacillus gibsonii-clade serine proteases |
| WO2016205755A1 (en) | 2015-06-17 | 2016-12-22 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
| EP4483721A2 (en) | 2015-11-05 | 2025-01-01 | Danisco US Inc. | Paenibacillus and bacillus spp. mannanases |
| WO2017079751A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus sp. mannanases |
| WO2017079756A1 (en) | 2015-11-05 | 2017-05-11 | Danisco Us Inc | Paenibacillus and bacillus spp. mannanases |
| EP4483721A3 (en) * | 2015-11-05 | 2025-04-16 | Danisco US Inc. | Paenibacillus and bacillus spp. mannanases |
| EP4141113A1 (en) | 2015-11-05 | 2023-03-01 | Danisco US Inc | Paenibacillus sp. mannanases |
| WO2017106676A1 (en) | 2015-12-18 | 2017-06-22 | Danisco Us Inc | Polypeptides with endoglucanase activity and uses thereof |
| WO2017192692A1 (en) | 2016-05-03 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
| WO2017192300A1 (en) | 2016-05-05 | 2017-11-09 | Danisco Us Inc | Protease variants and uses thereof |
| EP3845642A1 (en) | 2016-05-05 | 2021-07-07 | Danisco US Inc. | Protease variants and uses thereof |
| WO2017210295A1 (en) | 2016-05-31 | 2017-12-07 | Danisco Us Inc. | Protease variants and uses thereof |
| EP4151726A1 (en) | 2016-06-17 | 2023-03-22 | Danisco US Inc | Protease variants and uses thereof |
| EP4527923A2 (en) | 2016-06-17 | 2025-03-26 | Danisco US Inc | Protease variants and uses thereof |
| WO2017219011A1 (en) | 2016-06-17 | 2017-12-21 | Danisco Us Inc | Protease variants and uses thereof |
| WO2018085524A2 (en) | 2016-11-07 | 2018-05-11 | Danisco Us Inc | Laundry detergent composition |
| WO2018112123A1 (en) | 2016-12-15 | 2018-06-21 | Danisco Us Inc. | Polypeptides with endoglucanase activity and uses thereof |
| EP4520820A2 (en) | 2016-12-21 | 2025-03-12 | Danisco Us Inc | Protease variants and uses thereof |
| EP4212622A2 (en) | 2016-12-21 | 2023-07-19 | Danisco US Inc. | Bacillus gibsonii-clade serine proteases |
| EP4424805A2 (en) | 2016-12-21 | 2024-09-04 | Danisco Us Inc | Bacillus gibsonii-clade serine proteases |
| WO2018118917A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Protease variants and uses thereof |
| WO2018118950A1 (en) | 2016-12-21 | 2018-06-28 | Danisco Us Inc. | Bacillus gibsonii-clade serine proteases |
| WO2018169750A1 (en) | 2017-03-15 | 2018-09-20 | Danisco Us Inc | Trypsin-like serine proteases and uses thereof |
| WO2018184004A1 (en) | 2017-03-31 | 2018-10-04 | Danisco Us Inc | Alpha-amylase combinatorial variants |
| KR20230056061A (ko) * | 2017-04-05 | 2023-04-26 | 에이비 엔자임스 게엠베하 | 박테리아 만나나아제를 포함하는 세제 조성물 |
| EP3622064B1 (en) * | 2017-05-08 | 2025-05-14 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| EP3622064A1 (en) * | 2017-05-08 | 2020-03-18 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| US12018235B2 (en) | 2017-05-08 | 2024-06-25 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2018206300A1 (en) * | 2017-05-08 | 2018-11-15 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2018206302A1 (en) * | 2017-05-08 | 2018-11-15 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| CN110741084A (zh) * | 2017-05-08 | 2020-01-31 | 诺维信公司 | 甘露聚糖酶变体和对其编码的多核苷酸 |
| CN110741084B (zh) * | 2017-05-08 | 2024-04-12 | 诺维信公司 | 甘露聚糖酶变体和对其编码的多核苷酸 |
| US11492605B2 (en) | 2017-05-08 | 2022-11-08 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| EP4570894A3 (en) * | 2017-05-08 | 2025-09-03 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| CN110869499B (zh) * | 2017-05-30 | 2024-06-11 | 生化酶股份有限公司 | 甘露聚糖酶变体 |
| CN110869499A (zh) * | 2017-05-30 | 2020-03-06 | 生化酶股份有限公司 | 甘露聚糖酶变体 |
| WO2019036721A2 (en) | 2017-08-18 | 2019-02-21 | Danisco Us Inc | VARIANTS OF ALPHA-AMYLASES |
| US11866748B2 (en) * | 2017-10-24 | 2024-01-09 | Novozymes A/S | Compositions comprising polypeptides having mannanase activity |
| WO2019108599A1 (en) | 2017-11-29 | 2019-06-06 | Danisco Us Inc | Subtilisin variants having improved stability |
| CN108220271B (zh) * | 2018-01-25 | 2020-05-19 | 中国农业大学 | 蛋白质AxMan113A作为β-甘露聚糖酶的应用 |
| CN108220271A (zh) * | 2018-01-25 | 2018-06-29 | 中国农业大学 | 蛋白质AxMan113A作为β-甘露聚糖酶的应用 |
| US20210024910A1 (en) * | 2018-03-29 | 2021-01-28 | Novozymes A/S | Mannanase Variants and Polynucleotides Encoding Same |
| WO2019185726A1 (en) * | 2018-03-29 | 2019-10-03 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| US11535837B2 (en) | 2018-03-29 | 2022-12-27 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| WO2019245705A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
| WO2019245704A1 (en) | 2018-06-19 | 2019-12-26 | Danisco Us Inc | Subtilisin variants |
| WO2020028443A1 (en) | 2018-07-31 | 2020-02-06 | Danisco Us Inc | Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid |
| WO2020068486A1 (en) | 2018-09-27 | 2020-04-02 | Danisco Us Inc | Compositions for medical instrument cleaning |
| WO2020070199A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same |
| WO2020077331A2 (en) | 2018-10-12 | 2020-04-16 | Danisco Us Inc | Alpha-amylases with mutations that improve stability in the presence of chelants |
| WO2020112599A1 (en) | 2018-11-28 | 2020-06-04 | Danisco Us Inc | Subtilisin variants having improved stability |
| EP3715444B1 (en) | 2019-03-29 | 2023-11-29 | The Procter & Gamble Company | Laundry detergent compositions with stain removal |
| WO2020242858A1 (en) | 2019-05-24 | 2020-12-03 | Danisco Us Inc | Subtilisin variants and methods of use |
| WO2020247582A1 (en) | 2019-06-06 | 2020-12-10 | Danisco Us Inc | Methods and compositions for cleaning |
| WO2021080948A2 (en) | 2019-10-24 | 2021-04-29 | Danisco Us Inc | Variant maltopentaose/maltohexaose-forming alpha-amylases |
| WO2022047149A1 (en) | 2020-08-27 | 2022-03-03 | Danisco Us Inc | Enzymes and enzyme compositions for cleaning |
| WO2022165107A1 (en) | 2021-01-29 | 2022-08-04 | Danisco Us Inc | Compositions for cleaning and methods related thereto |
| WO2023278297A1 (en) | 2021-06-30 | 2023-01-05 | Danisco Us Inc | Variant lipases and uses thereof |
| WO2023114988A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Variant maltopentaose/maltohexaose-forming alpha-amylases |
| WO2023114936A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023114939A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023114932A2 (en) | 2021-12-16 | 2023-06-22 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2023168234A1 (en) | 2022-03-01 | 2023-09-07 | Danisco Us Inc. | Enzymes and enzyme compositions for cleaning |
| WO2023250301A1 (en) | 2022-06-21 | 2023-12-28 | Danisco Us Inc. | Methods and compositions for cleaning comprising a polypeptide having thermolysin activity |
| WO2024050346A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Detergent compositions and methods related thereto |
| WO2024050343A1 (en) | 2022-09-02 | 2024-03-07 | Danisco Us Inc. | Subtilisin variants and methods related thereto |
| WO2024102698A1 (en) | 2022-11-09 | 2024-05-16 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2024163584A1 (en) | 2023-02-01 | 2024-08-08 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2024186819A1 (en) | 2023-03-06 | 2024-09-12 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2025071996A1 (en) | 2023-09-28 | 2025-04-03 | Danisco Us Inc. | Variant cutinase enzymes with improved solubility and uses thereof |
| WO2025085351A1 (en) | 2023-10-20 | 2025-04-24 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2026024921A1 (en) | 2024-07-25 | 2026-01-29 | The Procter & Gamble Company | Detergent composition comprising a subtilisin variant and methods of use |
| WO2026024922A1 (en) | 2024-07-25 | 2026-01-29 | Danisco Us Inc. | Subtilisin variants and methods of use |
| WO2026050315A1 (en) | 2024-08-29 | 2026-03-05 | Danisco Us Inc. | Subtilisin variants and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3166419B1 (en) | 2019-09-18 |
| DK3166419T3 (da) | 2019-12-09 |
| JP7269907B2 (ja) | 2023-05-09 |
| JP2021035368A (ja) | 2021-03-04 |
| EP3166419A2 (en) | 2017-05-17 |
| CN107072250A (zh) | 2017-08-18 |
| WO2016007929A3 (en) | 2016-03-17 |
| JP2017522870A (ja) | 2017-08-17 |
| US20200277590A1 (en) | 2020-09-03 |
| JP7255832B2 (ja) | 2023-04-11 |
| US20170159036A1 (en) | 2017-06-08 |
| BR112017000505A2 (pt) | 2018-06-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7269907B2 (ja) | パエニバチルス(Paenibacillus)及びバチルス(Bacillus)種のマンナナーゼ | |
| US8986970B2 (en) | Detergent compositions containing Bacillus agaradhaerens mannanase and methods of use thereof | |
| US20200362324A1 (en) | Paenibacillus sp. mannanases | |
| EP3371307B1 (en) | Paenibacillus and bacillus spp. mannanases | |
| US20140135252A1 (en) | Detergent compositions containing geobacillus tepidamans mannanase and methods of use thereof | |
| US20140073548A1 (en) | Detergent compositions containing bacillus sp. mannanase and methods of use thereof | |
| CN103502445A (zh) | 包含芽孢杆菌甘露聚糖酶的洗涤剂组合物及其使用方法 | |
| CN103608356A (zh) | 包含黏琼脂芽孢杆菌(Bacillus agaradhaerens)甘露聚糖酶的洗涤剂组合物及其使用方法 | |
| CN103534266A (zh) | 包含喜温地芽孢杆菌(geobacillus tepidamans)甘露聚糖酶的洗涤剂组合物及其使用方法 | |
| WO2024050339A1 (en) | Mannanase variants and methods of use | |
| BR112018009050B1 (pt) | Variantes de mananases, seu método de produção, composição de limpeza, método de limpeza, polinucleotídeo, vetor de expressão e célula hospedeira | |
| BR112018008946B1 (pt) | Variante de mananase ou um polipeptídeo recombinante, método de produção dos mesmos, composição de limpeza, método de limpeza, polinucleotídeo, vetor de expressão e célula hospedeira |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15744426 Country of ref document: EP Kind code of ref document: A2 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2017501229 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15325305 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017000505 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015744426 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015744426 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112017000505 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017000505 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170110 |