WO2015168469A1 - Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto - Google Patents
Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto Download PDFInfo
- Publication number
- WO2015168469A1 WO2015168469A1 PCT/US2015/028645 US2015028645W WO2015168469A1 WO 2015168469 A1 WO2015168469 A1 WO 2015168469A1 US 2015028645 W US2015028645 W US 2015028645W WO 2015168469 A1 WO2015168469 A1 WO 2015168469A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- certain embodiments
- seq
- acid sequence
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
Definitions
- VLR VARIABLE LYMPHOCYTE RECEPTORS
- VLRs variable lymphocyte receptors
- LRR leucine-rich repeat
- Binz et al. report engineering binding proteins from non-immunoglobulin domains. Nat Biotechnol., 2005, 23(10): 1257-68.
- VLRs variable lymphocyte receptors
- the disclosure relates to recombinant polypeptide VLRs disclosed herein and variants thereof.
- this disclosure relates to treating or preventing a disease or condition comprising administering an effective amount of a recombinant polypeptide or variant disclosed herein to a subject in need thereof.
- the disclosure relates to recombinant polypeptide VLRs that specifically bind human cells, such as plasma cells, B-cells, or T-cells.
- the disclosure relates to conjugating a human antibody Fc sequence to a variable lymphocyte receptor optionally modified to include humanized amino acid sequences.
- the disclosure relates to grafting amino acid positions from a variable lymphocyte receptor (VLR) of a jawless vertebrate into a human protein comprising a leucine -rich repeat (LRR) sequence.
- VLR variable lymphocyte receptor
- LRR leucine -rich repeat
- the disclosure relates to creating protein display libraries with similarity to variable lymphocyte receptors sequences that are enriched with human like sequences and identifying sequences therein compatible for use in therapeutic applications.
- the modified humanized sequence is conjugated to a human antibody Fc sequence recognized by Fc receptors and complement sufficient for activating effector functions of a human immune system.
- the disclosure relates to isolated modified human amino acid sequences that specifically bind a molecule made by a process comprising, providing an amino acid sequence of a variable lymphocyte receptors (VLR) of a jawless vertebrate that binds an molecule; estimating which amino acids in the variable lymphocyte receptor that are in closest spatial proximity to the bound molecule and/or provide ionic interactions, and/or hydrogen bonding and/or provide Van der Waals force to the bound molecule providing target amino acids in the variable lymphocyte receptor; providing a known human amino acid sequence with greater than 20, 25, or 30% or more sequence identity to the variable lymphocyte receptor (VLR) amino acid sequence; substituting the target amino acids and a sufficient number of amino acids surrounding the target amino acids in the variable lymphocyte receptor within the known human amino acid sequence to provide a modified human amino acid sequence configured to specifically bind the molecule; and expressing the modified human amino acid sequence from a recombinant nucleic acid.
- VLR variable lymphocyte receptors
- the disclosure relates to recombinant vectors comprising nucleic acids that encode modified known human amino acid sequences made by processes disclosed herein.
- the disclosure relates to expression system comprising recombinant vectors comprising nucleic acids that encode modified known human amino acid sequences made by processes disclosed herein.
- this disclosure relates to fusion proteins comprising a modified human amino acid sequence disclosed herein and a human Fc sequence or fragment thereof that are able to institute adaptive immune functions.
- this disclosure relates to recombinant polypeptide comprising the sequence XLXLXXNKLQTIAKGTFSPLRAIQXMXLXX (SEQ ID NO: 38) wherein X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- recombinant polypeptide further comprises a human Fc sequence.
- recombinant polypeptide has the sequence YLDLNNNKLQTIAKGTFGTFSPLRAIQHMWLY (SEQ ID NO: 66),
- recombinant polypeptide is capable of specifically binding plasma cells but not B cells.
- the disclosure relates to recombinant polypeptide comprising the MM3 sequence SEQ ID NO: 56 or variants thereof. In certain embodiments, the disclosure relates to a recombinant vector comprising a nucleic acid encoding the recombinant polypeptide. In certain embodiments, the disclosure relates to an expression system comprising the vector.
- FIG 1 illustrates human Slit2-D2 as a humanized scaffold for VLRs.
- the second VLR- like RRR domain of Slit2 (Slit-D2) has been co-crystallized with its ligand Robol, which binds to the beta-strands of the concave surface in the same way that antigen bind VLRs.
- Figure 2 illustrates alignment of VLR and Slit2-D2 showing substantial overlap.
- Figure 3 illustrates the tertiary structure of lamprey VLRB antibodies and human LRR receptors.
- (Right) Humans express many leucine -rich repeat receptors with tertiary structures similar to lamprey VLRB. For example, Slit-D2, CD42b, and Nogo-66 receptors have the same crescent-shape as VLRB, including a concave surface composed of parallel beta- sheets.
- FIG. 4 illustrates coupling of VLRB specificity to human immune effector mechanisms.
- Human IgGl antibodies are composed of a heavy chain with three constant domains (CH1- CH3) and one variable (VH) and a light chain with one constant domain (CL) and one variable domain (VL).
- the variable domains are responsible for antigen binding, while the CH2 and CH3 domains function to link the antibodies to immune effector functions including complement- dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC), and phagocytosis of antibody-coated cells by macrophages ( ⁇ ).
- CDC complement- dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- ⁇ phagocytosis of antibody-coated cells by macrophages
- the heavy chain constant region also enhances the half-life of antibodies in circulation by interaction with FcRn, which recycles the antibodies from endosomes.
- Fusion of the VLRB variable domain to the CH2 and CH3 domains of IgGl will couple VLRB specificity to human mechanisms of immune clearance.
- FIG. 5 illustrates mammalian expression vectors.
- Figure 6 shows data indicating humanized RB36 binds to the H-trisaccharide.
- Human Slit2- D2 wild-type (left), Lamprey RBC36 VLR (center) and SLIT2-RBC36 mutant (right) were expressed as IgGl -Fc fusion proteins secreted from HEK-293T cells and used to stain CHO cells engineered to express the H-trisaccharide.
- Gray shading indicates unstained cells, and line indicates staining with fusion proteins.
- Figure 7 shows a sequence a lamprey VLRB monoclonal antibody (RBC36) (SEQ ID NO: 73).
- Human Slit2-D2 contains four VLR-like LRR domains, and the crystal structure of the second domain of Slit2 (Slit-D2) has been solved, which allowed for structural comparison with lamprey VLRB.
- the structure of RBC36 in complex with its antigen, the H-trisaccharide, has been determined. Residues that contact the antigen are indicated by gray shaded boxes.
- Slit2-D2 lacks the LRRCT variable insert loop that is present in VLRB and forms part of the antigen-binding site, but the sequence allows one to insert the residues in the gray boxes into the locations in Slit2-D2 as provided in SEQ ID NO: 1.
- Figure 8 shows a comparison of SEQ ID NO: 1 (query) and a segment of Slit2-D2 (subject), homo sapiens (SEQ ID NO: 72).
- FIG. 9 data indicating the VLR MM3 is human plasma cell-specific. MM3 binds to human plasma cells, but not other B lineage cells including germinal center and memory B cells.
- Figure 10 shows data on high density surface staining observed on subpopulations of plasma cells in human bone marrow.
- FIG 11 shows VLR antigen-contacting amino acid residue signature. Over or under usage of each amino acid in the contact residues relative to the total amino acids found in the full VLR.
- Figure 12 illustrates a humanized Slit-MM3 Sequence alignment of the LRRVe and the LRRCP domains of the lamprey MM3 VLR mAB (partial sequence SEQ ID NO: 69), human Slit2- D2 (partial sequence SEQ ID NO: 70) and the merged sequence (huMM3-l)(SEQ ID NO: 71). Gray boxes highlight variable amino acid residues from lamprey MM3.
- Figure 13 illustrates a comparison of LRRCT loops.
- Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of immunology, medicine, organic chemistry, biochemistry, molecular biology, pharmacology, physiology, and the like, which are within the skill of the art. Such techniques are explained fully in the literature.
- protein and “polypeptide” refer to compounds comprising amino acids joined via peptide bonds and are used interchangeably.
- the N-terminus may be substituted with one or more acetyl or alkanoyl, groups, and the C-terminus may be an amide.
- variant and mutant when used in reference to a polypeptide refer to an amino acid sequence that differs by one or more amino acids from another, usually related polypeptide.
- the variant may have "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties.
- conservative amino acid substitutions refers to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic -hydroxyl side chains is serine and threonine; a group of amino acids having amide -containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine -tyrosine, lysine-arginine, alanine-valine, and asparagine- glutamine. More rarely, a variant may have "non-conservative" changes (e.g., replacement of a glycine with a tryptophan). Similar minor variations may also include amino acid deletions or insertions (in other words, additions), or both. Guidance in determining which and how many amino acid residues may be substituted, inserted or deleted without abolishing biological activity may be found using computer programs well known in the art, for example, DNAStar software. Variants can be tested in functional assays. Preferred variants have less than 10%, and preferably less than 5%, and still more preferably less than 2% changes (whether substitutions, deletions, and so on).
- nucleic acid refers to a polymer of nucleotides, or a polynucleotide, as described above. The term is used to designate a single molecule, or a collection of molecules. Nucleic acids may be single stranded or double stranded, and may include coding regions and regions of various control elements, as described below.
- a nucleic acid sequence encoding refers to a nucleic acid sequence comprising the coding region of a gene or in other words the nucleic acid sequence which encodes a gene product.
- the coding region may be present in cDNA, genomic DNA or RNA form.
- the oligonucleotide, polynucleotide, or nucleic acid may be single- stranded (i.e., the sense strand) or double-stranded.
- Suitable control elements such as
- enhancers/promoters, splice junctions, polyadenylation signals, etc. may be placed in close proximity to the coding region of the gene if needed to permit proper initiation of transcription and/or correct processing of the primary RNA transcript.
- the coding region utilized in the expression vectors of the present disclosure may contain endogenous enhancers/promoters, splice junctions, intervening sequences, polyadenylation signals, etc. or a combination of both endogenous and exogenous control elements.
- sequence “identity” refers to the number of exactly matching amino acids (expressed as a percentage) in a sequence alignment between two sequences of the alignment calculated using the number of identical positions divided by the greater of the shortest sequence or the number of equivalent positions excluding overhangs wherein internal gaps are counted as an equivalent position.
- polypeptides GGGGGG and GGGGT have a sequence identity of 4 out of 5 or 80%.
- polypeptides GGGPPP and GGGAPPP have a sequence identity of 6 out of 7 or 85%.
- any recitation of sequence identity expressed herein may be substituted for sequence similarity. Percent "similarity" is used to quantify the similarity between two sequences of the alignment.
- This method is identical to determining the identity except that certain amino acids do not have to be identical to have a match.
- Amino acids are classified as matches if they are among a group with similar properties according to the following amino acid groups: Aromatic - F Y W; hydrophobic-A V I L; Charged positive: R K H;
- conjugate refers to the joining of two molecular entities by covalent bonds.
- the molecular entities may be covalently bonded directly or through linking groups using standard synthetic coupling procedures.
- two peptides may be linked together by simultaneous polypeptide expression typically referred to as a fusion or chimeric protein.
- One or more amino acids may be inserted into polypeptide as a linking group by incorporation of corresponding nucleic acid sequences into the expression vector.
- Other contemplated linking groups include polyethylene glycols or hydrocarbons terminally substituted with amino or carboxylic acid groups to allow for amide coupling with proteins having amino acids side chains with carboxylic acid or amino groups respectively.
- amino and carboxylic acid groups can be substituted with other binding partners such as an azide and an alkyne which undergo copper catalyzed formation of triazoles.
- polypeptides are expressed to contain naturally or non-naturally occurring amino acids containing a thiol group.
- the thiol group can be substituted for an amino group in coupling reactions with carboxylic acids, or two thiol groups when exposed to oxidative conditions react to form disulfides.
- nucleic acid molecule when made in reference to a nucleic acid molecule refers to a nucleic acid molecule which is comprised of segments of nucleic acid joined together by means of molecular biological techniques.
- recombinant when made in reference to a protein or a polypeptide refers to a protein molecule which is expressed using a recombinant nucleic acid molecule.
- vector refers to a recombinant nucleic acid containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism or expression system, e.g., cellular or cell-free.
- Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences.
- Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
- Protein "expression systems” refer to in vivo and in vitro (cell free) systems.
- Systems for recombinant protein expression typically utilize cells transfecting with a DNA expression vector that contains the template. The cells are cultured under conditions such that they translate the desired protein. Expressed proteins are extracted for subsequent purification.
- In vivo protein expression systems using prokaryotic and eukaryotic cells are well known. Also, some proteins are recovered using denaturants and protein-refolding procedures.
- In vitro (cell-free) protein expression systems typically use translation-compatible extracts of whole cells or compositions that contain components sufficient for transcription, translation and optionally post-translational modifications such as RNA polymerase, regulatory protein factors, transcription factors, ribosomes, tRNA cofactors, amino acids and nucleotides.
- a “selectable marker” is a nucleic acid introduced into a recombinant vector that encodes a polypeptide that confers a trait suitable for artificial selection or identification (report gene), e.g., beta-lactamase confers antibiotic resistance, which allows an organism expressing beta-lactamase to survive in the presence antibiotic in a growth medium.
- a trait suitable for artificial selection or identification e.g., beta-lactamase confers antibiotic resistance, which allows an organism expressing beta-lactamase to survive in the presence antibiotic in a growth medium.
- Another example is thymidine kinase, which makes the host sensitive to ganciclovir selection. It may be a screenable marker that allows one to distinguish between wanted and unwanted cells based on the presence or absence of an expected color.
- the lac-z-gene produces a beta-galactosidase enzyme which confers a blue color in the presence of X-gal (5-bromo-4-chloro-3-indolyl- -D-galactoside). If recombinant insertion inactivates the lac-z-gene, then the resulting colonies are colorless.
- selectable markers e.g., an enzyme that can complement to the inability of an expression organism to synthesize a particular compound required for its growth (auxotrophic) and one able to convert a compound to another that is toxic for growth.
- URA3 an orotidine-5' phosphate decarboxylase, is necessary for uracil biosynthesis and can complement ura3 mutants that are auxotrophic for uracil. URA3 also converts 5-fluoroorotic acid into the toxic compound 5-fluorouracil. Additional contemplated selectable markers include any genes that impart antibacterial resistance or express a fluorescent protein.
- Examples include, but are not limited to, the following genes: amp r , cam r , te , blasticidin r , neo r , hyg r , abx r , neomycin phosphotransferase type II gene (nptll), p-glucuronidase (gus), green fluorescent protein (gfp), egfp, yfp, mCherry, p-galactosidase (lacZ), lacZa, lacZAM15, chloramphenicol acetyltransferase (cat), alkaline phosphatase (phoA), bacterial luciferase (luxAB), bialaphos resistance gene (bar), phosphomannose isomerase (pmi), xylose isomerase (xylA), arabitol dehydrogenase (atlD), UDP-glucose:galactose-l -phosphate uridyltrans
- benzyladenine-N-3-glucuronide E. coli threonine deaminase, glutamate 1 -semialdehyde aminotransferase (GSA-AT), D-amino acidoxidase (DAAO), salt-tolerance gene (rstB), ferredoxin- like protein (pflp), trehalose-6-P synthase gene (AtTPSl), lysine racemase (lyr), dihydrodipicolinate synthase (dapA), tryptophan synthase beta 1 (AtTSBl), dehalogenase (dhlA), mannose-6-phosphate reductase gene (M6PR), hygromycin phosphotransferase (HPT), and D-serine ammonialyase (dsdA).
- GSA-AT glutamate 1 -semialdehyde aminotransferase
- DAAO D-amino
- label refers to a detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody or a protein, to facilitate detection of that molecule.
- labels include fluorescent tags, enzymatic linkages, and radioactive isotopes.
- a "label receptor” refers to incorporation of a heterologous polypeptide in the receptor.
- a label includes the incorporation of a radiolabeled amino acid or the covalent attachment of biotinyl moieties to a polypeptide that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
- labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as 35 S or 131 I) fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as gadolinium chelates.
- labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
- the disclosure relates to recombinant polypeptides comprising sequences disclosed herein or variants or fusions thereof wherein the amino terminal end or the carbon terminal end of the amino acid sequence are optionally attached to a heterologous amino acid sequence, label, or reporter molecule.
- the disclosure relates to the recombinant vectors comprising a nucleic acid encoding a polypeptide disclosed herein or chimeric protein thereof.
- the recombinant vector optionally comprises a mammalian, human, insect, viral, bacterial, bacterial plasmid, yeast associated origin of replication or gene such as a gene or retroviral gene or lentiviral LTR, TAR, RRE, PE, SLIP, CRS, and INS nucleotide segment or gene.
- the recombinant vector optionally comprises a gene vector element (nucleic acid) such as a selectable marker region, lac operon, a CMV promoter, a hybrid chicken B- actin/CMV enhancer (CAG) promoter, tac promoter, T7 RNA polymerase promoter, SP6 RNA polymerase promoter, SV40 promoter, internal ribosome entry site (IRES) sequence, cis-acting woodchuck post regulatory element (WPRE), scaffold-attachment region (SAR), inverted terminal repeats (ITR), FLAG tag coding region, c-myc tag coding region, metal affinity tag coding region, streptavidin binding peptide tag coding region, polyHis tag coding region, HA tag coding region, MBP tag coding region, GST tag coding region, polyadenylation coding region, SV40
- a gene vector element such as a selectable marker region, lac operon, a CMV promoter, a hybrid chicken B- actin/CMV
- polyadenylation signal SV40 origin of replication, Col El origin of replication, fl origin, pBR322 origin, or pUC origin, TEV protease recognition site, loxP site, Cre recombinase coding region, or a multiple cloning site such as having 5, 6, or 7 or more restriction sites within a continuous segment of less than 50 or 60 nucleotides or having 3 or 4 or more restriction sites with a continuous segment of less than 20 or 30 nucleotides.
- VLR Variable lymphocyte receptor
- the disclosure relates to methods of producing a specific binding agent to an molecule comprising, administering an molecule to a jawless vertebrate under conditions such that a cell containing a variable lymphocyte receptor (VLR) binds the molecule and plasmacytes of the jawless vertebrate produce an variable lymphocyte receptor (VLR) that binds the molecule.
- VLR variable lymphocyte receptor
- Providing an amino acid sequence of the variable lymphocyte receptors (VLR) that binds a target molecule can be accomplished by a variety of methods. Yu et al.
- the disclosure relates to recombinant polypeptides comprising a
- VLR having VLR amino acid sequences disclosed herein, sequence or variants thereof.
- the disclosure relates to recombinant polypeptides comprising VLR sequences and other polypeptide sequences such as fluorescent proteins, tags, or markers such that the recombinant peptide is not naturally occurring.
- the disclosure relates to recombinant proteins made by the process of exposing a jawless vertebrate to an antigen under conditions such that an antibody is formed, wherein the antigen is such that the jawless vertebrate does not naturally experience exposure to such antigen.
- the variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions or has more than 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99 % identity or similarity thereof.
- the variants provide a non-naturally occurring sequence.
- the amino acid substitutions are conserved amino acid substitutions. In certain embodiments, the amino acid substitutions are not within a
- a recombinant vector comprises a nucleic acid encoding VLR disclosed herein or variants thereof.
- the disclosure relates to an expression system comprising a recombinant vector of disclosed herein.
- the disclosure relates to a recombinant VLR disclosed herein or variant thereof made by the processes of expressing a nucleic acid encoding the protein or variant thereof in an expression system. Modified human sequences from VLR by grafting target sequences
- the disclosure relates to isolated modified human amino acid sequences that specifically binds a molecule made by a process comprising, providing an amino acid sequence of a variable lymphocyte receptors (VLR) of a jawless vertebrate that binds an molecule; estimating which amino acids in the variable lymphocyte receptor that are in closest spatial proximity to the bound molecule and/or provide ionic interactions, and/or hydrogen bonding and/or provide Van der Waals force to the bound molecule providing target amino acids in the variable lymphocyte receptor; providing a known human amino acid sequence with greater than 20, 25, or 30% or more sequence identity to the variable lymphocyte receptor (VLR) amino acid sequence; substituting the target amino acids and a sufficient number of amino acids surrounding the target amino acids in the variable lymphocyte receptor within the known human amino acid sequence to provide a modified human amino acid sequence configured to specifically bind the molecule; and expressing the modified human amino acid sequence from a recombinant nucleic acid.
- VLR variable lymphocyte receptors
- the jawless vertebrates, lamprey and hagfish have an adaptive immune system composed of clonally diverse lymphocytes that express variable lymphocyte receptors (VLRs).
- VLRs variable lymphocyte receptors
- the germ-line VLRB gene is incomplete, consisting of invariant 5' and 3' constant regions separated by a non- coding intervening sequence.
- the 5' constant region encodes a signal peptide and part of the N- terminal LRR (LRR-NT).
- LRR-NT N- terminal LRR
- the 3' constant region encodes for a portion of the LRR-CT and an invariant stalk region.
- the incomplete germ-line gene is flanked by hundreds of partial LRR gene segments. In developing lymphocytes, the flanking LRR gene segments are randomly and sequentially copied into the incomplete VLRB gene.
- each LRR gene segment is copied into the locus, it replaces a portion of the intervening sequence.
- the assembly mechanism continues until all of the intervening sequence is replaced with LRR modules and a functional VLRB is expressed.
- VLRB gene assembly occurs on only one allele, such that each lymphocyte expresses one VLRB gene.
- the VLRB gene assembly mechanism can produce greater than 10 14 unique antigen receptors, which rivals the theoretical diversity of the human antibody repertoire.
- the mature VLRB gene encodes for a crescent-shaped protein, with amino acid sequence diversity concentrated on the concave surface.
- the concave surface is composed of parallel ⁇ - strands and a C-terminal variable loop.
- Each LRR subunit contributes one ⁇ -strand, and each ⁇ - strand has five variable amino acid positions.
- VLRB antibodies also have variable numbers of LRR subunits. The smallest VLRB antibodies have 4 LRR subunits and the largest have 11 LRR subunits.
- Each LRR subunit increases the curvature of the concave surface by about 10° and increases the concave surface area by about 220 A.
- the C-terminal LRR, LRR-CT encodes a loop of variable length and sequence composition that projects above the concave surface.
- VLRB+ cells bind to particulate antigens, such as Bacillus anthracis exosporium or human red blood cells (RBCs).
- the plasmacytes secrete multivalent VLRB antibodies that circulate in the blood.
- Each secreted VLRB antibody is composed of identical VLRB polypeptide chains arranged into a pentamer or tetramer of dimers that is held together by disulfide bonds at the C-terminus of the flexible, invariant stalk region. Due to this multivalency, VLRB antibodies bind to their antigens with high avidity.
- VLRB cDNAs expressed in mammalian cells lines are secreted into the tissue culture supernatant as disulfide-linked, multivalent antibodies, like VLRB in vivo.
- the recombinant VLRB antibodies are extraordinarily stable. They retain their antigen binding ability after exposure to extremes of pH ( ⁇ 1.5 and >12) and temperature (36 hours at 55°C).
- a VLRB cDNA library is prepared from the lymphocytes of immunized lampreys. The VLRB cDNAs are transfected into HEK-293T, and the VLRB-containing tissue culture supernatants are screened for antigen binding.
- VLRB antibodies are highly specific for the immunizing antigen.
- VLRB antibodies specific for the BclA spore -coat protein of B. anthracis faithfully (7 of 7) discriminated between BclA of B. anthracis and B. cereus despite 90% amino acid sequence identity.
- X-ray crystallography of a VLRB antibody (RBC-36) complexed with the human erythrocyte H-trisaccharide antigen confirmed that the concave surface is the site of antigen binding.
- the H-trisaccharide interaction was stabilized by hydrogen bonds and van der Waals contacts with amino acids in six of the seven ⁇ -strands on the concave VLRB surface.
- the LRR-CT of RBC-36 forms an extended loop that contributes a key interaction with the galactose ring of the H- trisaccharide via a tryptophan (TRP204) residue near the tip of the loop.
- VLRB proteins were immunogenic in mice after repeated immunization.
- the immunogenicity of VLRB antibodies limits their potential as therapeutic reagents in humans.
- VLRB Leucine-rich repeat receptors structurally similar to VLRB are found in vertebrates, invertebrates, plants, and prokaryotes. Several human leucine-rich repeat receptors, such as Slit-family proteins (Slit 1, 2, and 3), CD42b, and Nogo-66 have structural overlap to VLRB. Sequences of VLRB antibody (RBC36) responsible for antigen binding can be grafted onto a structurally similar human LRR receptor (Slit2-D2) to "humanize" the VLRB. In practice, not all of the amino acids on the beta-sheets of the concave surface would have to be substituted because select amino acids are likely to participate in antigen binding.
- VLRB a high affinity VLRB that exists primarily in the antigen-bound state in vivo would mainly expose the fully humanized convex surface to the humoral immune system.
- Slit2-D2 and CD42b are secreted proteins in humans and bind to their natural ligands, Robol and von Willebrand Factor (vWF) respectively, on the concave surface.
- vWF von Willebrand Factor
- Van der Waals forces refer to attractive or repulsive forces between molecules other than those due to covalent bonds, the hydrogen bonds, or the electrostatic interaction of ions with one another or with neutral molecules or charged molecules.
- the term includes force between two permanent dipoles (Keesom force), force between a permanent dipole and a corresponding induced dipole (Debye force), force between two instantaneously induced dipoles (London dispersion force). These forces are typically estimated through computer simulations. See Ohue et al., MEGADOCK: An All-to-all Protein- protein Interaction Prediction System Using Tertiary Structure Data, Protein Pept Lett, 2013;
- one utilizes a combination of computer simulations and X-ray crystallography, NMR spectroscopy or cryo-electron microscopy experiments.
- the structures of variable lymphocyte receptor and binding molecule of interest form a crystallized complex.
- two dimensional NMR techniques optionally in combination with computational methods, can be used to estimate molecular interactions and spatial relationships. See Nishida & Shimada, An NMR method to study protein-protein interactions, Methods Mol Biol, 2012, 757: 129- 37 and O'Connell et al., The structural analysis of protein-protein interactions by NMR
- VLR variable lymphocyte receptor
- Substituting the target amino acids in the variable lymphocyte receptor within the known human amino acid sequence that correlate in position, if different, in the known human amino acid sequence is typically accomplished by making a sequence alignment followed by the substitutions.
- one, both, or more of the amino acids on the N- or C- sides of the target amino acid may also be substituted, if different.
- two on the N- side and one on the C-side, two on the C-side and one on the N-side, or two on the N- side and two on the C-side of each target amino acids are substituted.
- the disclosure relates to isolated modified human amino acid sequences that specifically binds an molecule
- VLR variable lymphocyte receptors
- the disclosure relates to isolated modified human amino acid sequences that specifically binds an molecule comprising, providing an amino acid sequence of a variable lymphocyte receptors (VLR) of a jawless vertebrate that binds a molecule; determining, selecting or estimating 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids in the variable lymphocyte receptor that hydrogen bond with the molecule and/or have ionic interacts with and/or are in closest spatial proximity to the bound molecule providing target amino acids in the variable lymphocyte receptor; providing a known human amino acid sequence with greater than 20, 25, 30, or 40% or more sequence identity to the variable lymphocyte receptor (VLR) amino acid sequence;
- VLR variable lymphocyte receptor
- the molecule comprises a polypeptide sequence or polysaccharide.
- the jawless vertebrate is a lamprey or hagfish.
- the variable lymphocyte receptor is a lamprey variable lymphocyte receptor B (VLRB).
- the 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids in the variable lymphocyte receptor that hydrogen bond with the molecule and/or are in closest spatial proximity to the molecule are selected from within variable amino acid positions of ⁇ -strands and a C-terminal variable loop of the concave surface of the crescent-shaped VLR.
- the molecule is a viral or microbial associated molecule.
- the viral or microbial associated molecule is Bacillus anthracis, Influenza, or HIV-1 antigen.
- the molecule is a molecule associated with specific normal or malignant human cell.
- the normal or malignant human cell is a blood group O erythrocytes, B cell leukemia cell, B lymphoma cell line.
- the known human amino acid sequence is human leucine -rich repeat receptor.
- the known human amino acid sequence is Slit-family protein (Slit 1, 2, and 3), CD42b, or Nogo-66.
- the disclosure relates to recombinant vectors comprising nucleic acids that encode the isolated modified human amino acid sequences made by processes disclosed herein.
- the disclosure relates to expression system comprising recombinant vectors comprising nucleic acids that encode the isolated modified human amino acid sequences made by processes disclosed herein.
- the disclosure relates to methods of producing a specific binding agent to an molecule comprising, administering an molecule to a jawless vertebrate under conditions such that a cell containing a variable lymphocyte receptor (VLR) binds the molecule and plasmacytes of the jawless vertebrate produce an variable lymphocyte receptor (VLR) that binds the molecule; providing an amino acid sequence of the variable lymphocyte receptors (VLR) that binds the molecule; estimating 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids in the variable lymphocyte receptor that are in closest spatial proximity to the molecule and/or hydrogen bond with the molecule providing target amino acids in the variable lymphocyte receptor; providing a known human amino acid sequence with greater than 20, 25, 30, 35, or 40% or more sequence identity to the variable lymphocyte receptor (VLR) amino acid sequence; aligning the VLR sequence and the known human amino acid sequence; substituting the target amino acids in the variable lymphocyte receptor within the known human amino acid sequence that correlate in position if different in the known human amino acid sequence; substituting at
- Variable lymphocyte receptors typically contain an N-terminal LRR sequence, a C-terminal LRR sequence, and multiple interior LRR modules of approximately 12-25 amino acids.
- the C- terminal LRR sequence typically contains a variable loop (highly variable insert).
- seven amino acids typically contain one or two leucine or isoleucine, if two, separated by a single amino acid, e.g., (SEQ ID NO: 21) XXLXLXX, that are typically located on the concave surface, wherein X may be any amino acid and L may be leucine or isoleucine.
- one L (leucine or isoleucine) may be substituted with any amino acid.
- the target amino acids for grafting into human sequences are 2, 3, 4, 5, 6, or 7 amino acids are within the associated seven residues for at least 1, 2, 3, or all of the LRR modules and optionally all or a portion of the amino acids in the C-terminal highly variable insert.
- the variable lymphocyte receptor has a sequence VXCXXXXLXSVPAXIPTTT XXLXXXXNXITKXXPGVFDXLXXLXXXXLXXNXLXXXPXGXFD (SEQ ID NO: 25) wherein X may be any amino acid.
- the disclosure relates to a composition
- a composition comprising a polypeptide comprising SEQ ID NO: 1 or 10 or variant thereof with greater than 83, 85, 90, 95, 97, 98, or 99% sequence identity or greater than 85, 90, 95, 97, 98, or 99% sequence similarity.
- the variant comprises one, two, three, four, five, six, seven, eight, nine, or ten amino acid substitutions.
- the amino acid substitutions are conserved substitutions.
- the variant comprises amino acid substitutions that are not within
- SEQ ID NO: 3 (IIYLHD), SEQ ID NO: 4 (EIYLGS), SEQ ID NO: 5 (VLDLGT), SEQ ID NO: 6 (ELFLCC), SEQ ID NO: 7 (HLALDQ), SEQ ID NO: 8 (HMYLFG), SEQ ID NO: 9
- the variant comprises two, three, four, five, or six of the following sequences SEQ ID NO: 3 (IIYLHD), SEQ ID NO: 4 (EIYLGS), SEQ ID NO: 5 (VLDLGT), SEQ ID NO: 6 (ELFLCC), SEQ ID NO: 7 (HLALDQ), SEQ ID NO: 8 (HMYLFG), SEQ ID NO: 9 (IAMRWDGKAVNDPDS).
- the variant optionally comprises one conserved amino acid substitution within each of the following sequences SEQ ID NO: 3 (IIYLHD), SEQ ID NO: 4 (EIYLGS), SEQ ID NO: 5 (VLDLGT), SEQ ID NO: 6 (ELFLCC), SEQ ID NO: 7 (HLALDQ), SEQ ID NO: 8 (HMYLFG), SEQ ID NO: 9 (IAMRWDGKAVNDPDS).
- polypeptide comprises SEQ ID NO: 9
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 10) or variants thereof,
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 26) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, five, six or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 1 1) IVDCRG, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- [X]n is [X] m -[Loop Sequence of VLR or MM3] or [X] m -[Loop Sequence of VLR or MM3]A wherein [X] m is opitonally X 1 , X'X 2 , X ⁇ X 3 , X l X 2 X 3 X 4 wherein X 1 is H, X 2 is T, X 3 is N, and X 4 is P.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 27) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, five, or all of the following wild-type
- Slit2- D2 sequences selected from (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDL
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 28) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 29) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 30) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 31) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 32) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 33) or variants thereof, GLTEIPTNLPETIT X I XXXXNTIKVIPPGAFSPYKKLR X I XXXX NQISELAPDAFQGLRSLN X L X L XX NKITELPKSLFEGLFSLO X L X L XX NKJNCLRVDAFODLHNLN X L X L XX NKLQTIAKGTF SPLRAIQ X M X LXX NPFICDCHLKWLADYL [XI n ARCTSPRRLAN
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, five, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 12) EIRLEQ, (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 34) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 13) RIDLSN, (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 35) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, four, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 36) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, three, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 14) SLVLYG, (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 37) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one, two, or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 38) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16 optionally provided that the polypeptide does not contain at least one or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 23) or variants thereof,
- X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, provided the amino acid substitutions are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 65) or variants thereof,
- X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one, two or all of the following wild-type Slit2- D2 sequences selected from (SEQ ID NO: 15) LLLLNA, (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.
- the variants contain one, two, or three amino acid substitutions, provided the amino acid substitutions are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 39) or variants thereof,
- [X]n is [X]m-[Loop Sequence of VLR or MM3] or [X] m -[Loop Sequence of VLR or MM3]A wherein [X] m is opitonally X 1 , X'X 2 , X ⁇ X 3 , X l X 2 X 3 X 4 wherein X 1 is H, X 2 is T, X 3 is N, and X 4 is P.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 40) or variants thereof,
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 41) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 42) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 43) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 44) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 45) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 46) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 47) or variants thereof, AFSPYKKLR X I XXXX NOISELAPD AFQGLRSLN X L X L XX NKITELPKSLFEGLFSLQ X L X L XX NKINCLRVDAFQDLHNLN YLDLNNNKLQTIAKGTFSPLRAIQHMWLY X NPFICDCHLKWLADYL ⁇ ] ⁇ RCTSPRRLAN
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 48) or variants thereof,
- X at each position is individually and independently any amino acid and n is between 5 and 20 or n is between 10 and 18, or n is 14, 15, or 16.
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 49) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 50) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids.
- the substitutions are conserved substitutions.
- the disclosure contemplates isolated recombinant polypeptides comprising (SEQ ID NO: 51) or variants thereof,
- the variants contain one, two, or three amino acid substitutions, deletions or insertions, provided the amino acid substitutions, deletions or insertions, are not X amino acids. In certain embodiments, the substitutions are conserved substitutions.
- the disclosure contemplates fusions or Slit2-MM3 polypeptides comprising (SEQ ID NO: 58-63) or variants thereof,
- Humanized specific binding agents may be isolated from combinatorial libraries of variant proteins using protein display technologies, e.g., phage display, yeast surface display, bacterial display, or cell-free systems. See Finlay et al., Methods Mol. Biol., 2011, 681 :87-101 ; Daugherty, Curr. Opin. Struct. Biol., 2007,17:474-480; Gai & Wittrup, Curr. Opin. Struct. Biol., 2007, 17: 467- 473; Zhou et al., MAbs., 2010, 2:508-518 ; Shen et al., Proc. Nat. Acad. Sci. USA, 2005, 102: 5969-5974.
- protein display technologies e.g., phage display, yeast surface display, bacterial display, or cell-free systems. See Finlay et al., Methods Mol. Biol., 2011, 681 :87-101 ; Daugherty, Curr. Op
- a collection of unique variant proteins are linked through the display platform by expression from corresponding mutated nucleic acids. After exposing/mixing the variant proteins expressed on the display platform with the target molecule, molecule bound variants are identified and/or separated for analysis.
- the protein sequence is determined by sequencing an associated nucleic acid in the display platform.
- yeast surface display recombinant yeast cells express variant proteins wherein the yeast cell expresses the variant protein conjugated to a cell wall protein.
- the yeast cell can contain a plasmid DNA that encodes the variant protein which is expressed on the surface of the yeast cell, and sequencing the plasmid DNA provides the protein sequence of the variant protein.
- variant proteins are typically conjugated to a bacteriophage coat protein.
- Cell-based systems also typically rely on the expression of variant proteins conjugated to cell surface proteins, e.g., in bacterial, yeast, and mammalian cells, and the host cell carries a plasmid vector that encodes the variant proteins.
- Cell-free systems have also been developed wherein the variant protein is conjugated directly to its encoding mRNA, termed ribosome display or mRNA display.
- the disclosure contemplates methods of producing a humanized specific binding agent comprising one or more of the following steps,
- the comparison window is or is as least or is more than 50, 100, 250, 500, or 1000 amino acids in length. In certain embodiments, the comparison window is over one, two, three, four, five, six, seven, or more/all of the following domains LRRNT, LRRl, LRRVl, LRRV2, LRRV3, (LRRVX) n , LRRVe, LRRCP, and LRRCT, wherein X and n refer to an integer, e.g., 0, 1, 2, 3, 4, 5, or 6.
- the disclosure contemplates multiple humanized specific binding agents are identified and one selects desirable candidates by balancing factors such as maximizing binding affinity and maximizing the number of overlapping human amino acid locations.
- the amino acids are conserved substitutions if they are among a group with similar properties according to the following amino acid groups: Aromatic - F Y W; hydrophobic-A V I L; Charged positive - R K H; Charged negative - D E; Polar - S T N Q.
- the human leucine rich repeat sequence is Slit-D2.
- a polypeptide library can be assigned amino acids at respective locations for identifying a humanized binding agent wherein the library express a LRRNT domain comprising the following sequences CPX 1 X 2 CTCSX 3 NX 4 VDCRGKX 5 X 6 (SEQ ID NO: 22), wherein X 1 to X 6 is any amino acid.
- X 1 is A or S
- X 2 is A or Q
- X 3 is N or G
- X 4 is I or T
- X 5 is G or R
- X 6 is L or H.
- the human leucine rich repeat sequence comprises one, two, three, four, five, six, seven, or more of the following domains LRRNT, LRRl, LRRVl, LRRV2, LRRV3, LRRV4, LRRV5, LRRV6, LRRV7, LRRV8, LRRV9, LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one, two, three, four, five, six, seven, or all of the following domains LRRNT, LRRl, LRRVl, LRRV2, LRRV3, LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one, two, three, four, five, or all of the following domains LRRVl, LRRV2, LRRV3, LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one, two, three, four, or all of the following domains LRRV2, LRRV3, LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one, two, three, or all of the following domains LRRV3, LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one, two, or all of the following domains LRRVe, LRRCP, and LRRCT.
- the human leucine rich repeat sequence comprises one or both of the following domains LRRCP and LRRCT.
- libraries of human leucine rich repeat sequences may contain combinations of domains such as LRRNT, LRRl, LRRVl, LRRV2, LRRV3, LRRVe, LRRCP, and LRRCT which have been substituted with desirable sequences to allow for high levels of expression in peptide library expression systems.
- LRRNT Long et al. Proc Natl Acad Sci U S A, 2009, 106(31): 12891 -6, report the substitution of LRRNT, LRR1, and LRRV1 of Internalin B allows for a high level of expression in bacteria.
- this disclosure contemplates libraries which contain LRRNT, LRRl, and LRRVl of Internalin B conjugated to domains (LRRVX) n , LRRVe, LRRCP, and LRRCT of a human leucine rich repeat library as produced herein, wherein X and n refer to an integer, e.g., 3, 4, 5, 6, 7, or 8.
- variable lymphocyte receptor optionally modified to include humanized amino acid sequences as disclosed herein conjugated to a human antibody constant region recognized by Fc receptors and complement sufficient for effector functions of a human immune system.
- this disclosure relates to fusion proteins comprising a modified human amino acid sequence disclosed herein and a Fc sequence or fragment thereof that are able to provide effector functions, e.g., elicit antibody-dependent cellular cytotoxicity in vivo or in vitro, and optionally a halve-life comparable to wild type human antibodies.
- Therapeutics antibodies typically employ intact IgG molecules.
- IgGl Fc can interact with Fc gamma receptors that instigate effector functions.
- Fc contains binding sites for the complement activator Clq. The binding site for neonatal Fc receptor (FcRn) effects half-life.
- Naturally produced antibodies contain Fab antigen-binding site arms attached to a Fc region.
- the IgG Fc region is a homodimer containing a CH3 domain and CH2 domain.
- the CH2 domains are typically glycosylated through at Asn297.
- IgG Fc CH2 domains contain interactions sites for FcgammaRl, FcgammaRll, FcgammaRlll and Clq effector ligands that are responsible for effector mechanisms such as antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the disclosure contemplates Fc fusion proteins wherein the Fc sequence is able to elicit antibody-dependent cellular cytotoxicity and contains binding sites for FcgammaRl, FcgammaRll, FcgammaRlll, the complement activator Clq, the neonatal Fc receptor (FcRn), and combinations thereof.
- the disclosure contemplates that that the fusion protein is a single chain fusion of the modified human sequence and a Fc sequence. Powers et al. report single-chain Fv-Fc fusions are capable of mediating antibody-dependent cellular cytotoxicity against tumor target cells using human peripheral blood mononuclear cells as effectors. J Immunol Methods, 2001, 251(1 -2): 123 -35.
- the disclosure contemplates that that the Fc sequence may contain certain deletions or mutations, e.g., the CH3 domain.
- Wozniak-Knopp et al. report human IgGl Fc regions were prepared in which loop sequences at the C-terminal tip of the CH3 domain were randomized. These proteins were able to provide antigen binding, effector functions and an in vivo half-life similar to wild-type antibodies. Protein Engineering, Design and Selection, 2010, 23 (4): 289-297.
- the disclosure contemplates recombinant vectors comprising the fusion proteins disclosed herein and expression systems comprising the vectors.
- the disclosure relates to a composition
- a composition comprising a polypeptide comprising SEQ ID NO: 19, 20, 24 or variants thereof with greater than 83, 85, 90, 95, 97, 98, or 99% sequence identity or greater than 85, 90, 95, 97, 98, or 99% sequence similarity.
- the variant comprises one, two, three, four, five, six, seven, eight, nine, or ten amino acid substitutions.
- the amino acid substitutions are conserved substitutions.
- the VLRs or modified VLRs or fragments may be fused to a signal- transduction component of the T-cell antigen receptor such as CD3-zeta.
- the signal-transduction component of the T-cell antigen receptor is a peptide with an
- YXXLXXXXXXXYXXL (SEQ ID NO: 52) wherein X is any amino acid L is leucine or isoleucine, wherein SEQ ID NO: 15 optionally has one or two X amino acid deletions within the middle segment XXXXXXX (SEQ ID NO: 53).
- the immunoreceptor tyrosine -based activation motif (underlined) is in the partial CD3-zeta sequence DPKLCYLLDGILFIYGVIL
- the signal-transduction component of the T-cell antigen receptor is a peptide with a immunoreceptor tyrosine -based activation motif (underlined) with the sequence of immunoglobulin epsilon receptor subunit gamma precursor EPQLCYILDAILFLYGIVLTLL
- YCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHE fragments or variants thereof variants or a sequence with greater than 50, 60, 70, 80, 90, 95% or greater identity thereto.
- B cells present antigen to T cells typically stimulating B cells to differentiate into more specialized cells such as immature and mature plasma cells.
- Plasma cells produce large amounts of antibodies.
- Multiple myeloma is cancer that forms in plasma cells.
- B cell malignancies are effectively treated by therapeutic antibodies specific for the CD20 surface antigen, which results in depletion of normal and malignant B cells.
- anti-CD20 antibodies are not effective in treating multiple myeloma, because CD20 surface expression is lost as mature B cells differentiate into plasma cells.
- Other plasma cell surface antigens currently under investigation for targeting multiple myeloma plasma cells are also expressed by many other cell types and tissues, which complicates plasma cell targeting because of the potential for unacceptable side effects.
- the disclosure contemplates treating plasma cell malignancies, such as multiple myeloma by administering and effective amount of a fusion protein or polypeptide disclosed herein or fragment thereof to a subject in need thereof.
- the fusion protein comprises a MM3 sequence or humanized MM3 sequence and a signal-transduction component of the T-cell antigen receptor such as a human Fc sequence.
- the fusion protein is administered in combination with lenalidomide and dexamethasone, bortezomib, or combinations thereof.
- the treatment is in combination with autologous or allogeneic stem cell transplantation.
- the disclosure contemplates treating or preventing cancer comprising administering an effective amount of a VLR based fusion protein comprising a modified human sequence disclosed herein that binds to a tumor associated antigen to a subject in need thereof.
- the fusion protein may comprise a VLR or modified VLR sequences, or humanized VLR sequence, Slit2-VLR sequence, generated using methods reported herein.
- the VLR based fusion proteins bind a tumor associates antigen selected from CD20, CD20, CD30, CD33, CD52, EpCAM, epithelial cell adhesion molecule, gpA33, glycoprotein A33, Mucins, TAG-72, tumour-associated glycoprotein 72, Folate -binding protein, VEGF, vascular endothelial growth factor, integrin ⁇ 3, integrin ⁇ 5 ⁇ 1, FAP, fibroblast activation protein, CEA, carcinoembryonic antigen, tenascin, Le y , Lewis Y antigen, CAIX, carbonic anhydrase IX, epidermal growth factor receptor (EGFR; also known as ERBBl), ERBB2 (also known as HER2), ERBB3, MET (also known as HGFR), insulin-like growth factor 1 receptor (IGF1R), ephrin receptor A3 (EPHA3), tumour necrosis factor (TNF)-related a tumor associates anti
- TNFRSF10B receptor activator of nuclear factor- ⁇ ligand (RANKL; also known as
- TNFSF11 TNFSF11
- fragments thereof TNFSF11
- the subject is at risk of, exhibiting symptoms of, or diagnosed with lymphoma, B cell lymphoma, breast cancer, prostate cancer, colorectal cancer, gastric cancer, lung cancer, skin cancer, bladder cancer, brain cancer, kidney cancer, endometrial cancer, pancreatic cancer, and thyroid cancer.
- contemplated methods include further administering a second anticancer agent such as bevacizumab, gefitinib, erlotinib, temazolamide, docetaxel, cis-platin, 5- fluorouracil, gemcitabine, tegafur, raltitrexed, methotrexate, cytosine arabinoside, hydroxyurea, adriamycin, bleomycin, doxorubicin, daunomycin, epirubicin, idarubicin, mitomycin-C, dactinomycin, mithramycin, vincristine, vinblastine, vindesine, vinorelbine taxol, taxotere, etoposide, teniposide, amsacrine, topotecan, camptothecin, bortezomib, anegrilide, tamoxifen, toremifene, raloxifene, droloxif
- the disclosure contemplates treating or preventing breast cancer using fusion protein disclosed herein and one more other anti-cancer agents.
- the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and trastuzumab and/or lapatinib. In certain embodiments, the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and docetaxel and cyclophosphamide. In certain embodiments, the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and docetaxel, carboplatin, and trastuzumab. In certain embodiments, the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and cyclophosphamide, doxorubicin, and 5- fluorouracil (5-FU). In certain embodiments, the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and docetaxel, doxorubicin, and
- the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and doxorubicin and cyclophosphamide followed by paclitaxel or docetaxel. In certain embodiments, the disclosure contemplates treating or preventing breast cancer using fusion proteins disclosed herein and 5-FU, epirubicin, and cyclophosphamide followed by docetaxel or paclitaxel.
- the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and one more other anti-cancer agents. In certain embodiments, the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and one more other anti-cancer agents.
- the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and leuprolide, goserelin, or buserelin. In certain embodiments, the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and flutamide, bicalutamide, enzalutamide, or nilutamide. In certain embodiments, the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and ketoconazole or aminoglutethimide.
- the disclosure contemplates treating or preventing prostate cancer using fusion proteins disclosed herein and abiraterone, bicalutamide, cabazitaxel, bicalutamide, degarelix, denosumab, docetaxel, enzalutamide, cabazitaxel, leuprolide, prednisone, denosumab, sipuleucel-T, or radium 223 dichloride and combinations thereof.
- the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and one more other anti -cancer agents.
- the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and 5-FU, leucovorin, or capecitabine or combinations thereof. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and capecitabine and oxaliplatin. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and 5-FU, leucovorin, and oxaliplatin. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and leucovorin, 5-FU, and irinotecan. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and leucovorin, 5-FU, oxaliplatin, and irinotecan.
- the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and bevacizumab or cetuximab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and 5-FU and leucovorin optionally with bevacizumab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and capecitabine optionally with bevacizumab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and irinotecan optionally with cetuximab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and cetuximab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and panitumumab. In certain embodiments, the disclosure contemplates treating or preventing colon cancer using fusion proteins disclosed herein and regorafenib.
- the disclosure contemplates treating or preventing lung cancer using fusion proteins disclosed herein and a chemotherapy agent is selected from vinorelbine, etoposide, mitomycin C, gemcitabine, irinotecan, pemetrexed, gefitinib, erlotinib, lapatinib, crizotinib, and a vinca alkaloid or combinations thereof.
- a chemotherapy agent is selected from vinorelbine, etoposide, mitomycin C, gemcitabine, irinotecan, pemetrexed, gefitinib, erlotinib, lapatinib, crizotinib, and a vinca alkaloid or combinations thereof.
- the vinca alkaloid is vinblastine, vincristine, vindesine, or vinorelbine.
- the disclosure contemplates treating or preventing lung cancer using fusion proteins disclosed herein and chemotherapy agent is bevacizumab panitumumab, zalutumumab, nimotuzumab, matuzumab, or cetuximab.
- the disclosure contemplates treating or preventing lung cancer using fusion proteins disclosed herein and a platinum based agent and/or a taxane e.g., paclitaxel and docetaxel or combinations thereof.
- the disclosure contemplates treating or preventing brain cancer, glioblastoma multiforme, oligodendroglioma, primitive neuroectodermal tumours, ependymomas, or glioma.
- the fusion protein is optionally administered in combination with temozolomide, procarbazine, carmustine (BCNU), lomustine (CCNU), vincristine, and
- procarbazine, lomustine (CCNU) and vincristine are combined.
- the fusion protein is optionally administered in combination with irinotecan, cis-platin, carboplatin, methotrexate, etoposide, bleomycin, vinblastine, actinomycin (Dactinomycin), cyclophosphamide, or ifosfamide.
- the disclosure contemplates administering combinations of fusion proteins disclosed herein with temozolomide.
- Treatment of glioblastoma includes chemotherapy during and after radiotherapy. On average, chemotherapy after surgery and radiotherapy can initially reduce the tumor size. The use of temozolomide both during radiotherapy and for six months post radiotherapy results in a significant increase in median survival with minimal additional toxicity. This treatment regime is now standard for most cases of glioblastoma where the patient is not enrolled in a clinical trial. Temozolomide seems to work by sensitizing the tumor cells to radiation. The U.S. Food and Drug Administration approved Avastin (bevacizumab) to treat patients with glioblastoma at progression after standard therapy.
- Avastin bevacizumab
- the disclosure relates to administering compositions disclosed herein for the management of cancers or tumors in the brain by convection-enhanced delivery (CED).
- CED is a method of administrating compositions by direct infusion into the brain interstitial spaces utilizing a fluid pressure gradient after catheter placement.
- depletion of antibody secreting plasma cells could also be used to treat antibody-mediated autoimmune (e.g., lupus erythematosis) and allergic diseases such as those that are not alleviated by B cell depletion with anti-CD20 monoclonal antibodies, because the harmful autoantibodies and allergen-reactive antibodies are produced by long-lived plasma cells lacking the CD20 antigen.
- antibody-mediated autoimmune e.g., lupus erythematosis
- allergic diseases such as those that are not alleviated by B cell depletion with anti-CD20 monoclonal antibodies, because the harmful autoantibodies and allergen-reactive antibodies are produced by long-lived plasma cells lacking the CD20 antigen.
- the disclosure relates to treating an autoimmune disease comprising administering an effective amount of a MM3 fusion or humanized Slit2-MM3 fusion to a subject in need thereof.
- the autoimmune disease is lupus erythematosus, multiple sclerosis, amyotrophic lateral sclerosis, autoimmune hepatitis, autoimmune pancreatitis, Behcet's disease, celiac disease, diabetes mellitus type 1 , Guillain-Barre syndrome, psoriatic arthritis, and rheumatoid arthritis.
- VLR antibodies may detect antigens that cannot be detected by conventional antibodies for architectural or tolerogenic reasons (i.e., the need of the host to prevent the generation of antibodies that recognize "self and thus lead to autoimmune complications).
- the evolutionary distance of lampreys and the radically different protein architecture of VLR antibodies make them ideal reagents for the discovery of biomarkers which cannot be detected using conventional antibodies for structural or tolerogenic reasons.
- the binding characteristics of VLR antibody MM3 does not correspond to any known cell surface antigens, thereby supporting the unique antigen recognition properties of VLR antibodies.
- Monoclonal lamprey VLR antibodies that bind specific human hematopoietic cell populations have been identified. The analysis of binding specificities of several of these VLR antibodies indicates that they recognize antigenic structures to which no conventional mammalian monoclonal antibodies have been raised.
- Recombinant VLR antibodies are generated by transfection of the cDNA encoding the antibodies into human HEK293 cells.
- the recombinant VLR antibodies are secreted into the cell supernatant and subsequently used to determine cell specificity.
- the recombinant versions of these VLR sequences include incorporated stretches of 6 codons encoding histidine residues for efficient purification of monoclonal VLR antibodies as well as for flow cytometry detection of bound VLR antibodies.
- variable amino acid positions from RBC36 are grafted onto the corresponding positions on Slit-D2 (See figure 7), resulting in the following sequence (SEQ ID NO: 1),
- Wild-type Slit-D2 (See figure 7, top, SEQ ID NO: 2) is composed of 206 amino acids, underlined, some of the amino acids were removed from the LRRCT region.
- GSLHCPAACT CSNNIVDCRG KGLTEIPTNL PETITEIRLE QNTIKVIPPG AFSPYKKLRR IDLSNNQISE LAPDAFOGLR SLNSLVLYGN KITELPKSLF EGLFSLQLLL LNANKINXLR VDAFQDLHNL NLLSLYDNKL QTIAKGTFSP LRAIQTMHLA QNPFICDCHL KWLADYLHTN PIETSGARCT SPRRLANKRI GQIKSKKFRC SAAAHHHHHH.
- SEQ ID NO: 24 contains a loop of RBC38 and three amino acids grafted into Slit2-D2, designated "Slit- M4."
- Slit-M4 binds to the type II H-antigen trisaccharide is a-l-Fuc/ (l ⁇ 2)-P-d-Gal/ (l ⁇ 4)-P-d- GlcNac/ OH,
- Each ⁇ -strand on the VLR concave surface (encoded by LRRNT, LRR1, LRRV, LRRVe and LRRCP) has 4 variable positions, defined by xLxLxx motif, where x is any amino acid (note that leucine residues in this motif are occasionally replaced by other hydrophobic amino acids including isoleucine, valine and methionine).
- the leucines in this motif do not make antigen contacts, and instead face the interior of the protein to form the hydrophobic core of the LRR solenoid by packing against a conserved phenylalanine residue located on the convex surface that also faces the interior.
- variable amino acid positions face outward on the concave surface and collectively form the antigen binding surface, along with the variable insert loop in the LRRCT. Since the variable amino acids are located on ⁇ -strands that form rigid secondary structures, and they are always located in one of the four positions in the xLxLxx motif, the corresponding position of the a residue from a VLR to the Slit2-D2 scaffold can be determined from the primary amino acid sequence, even without structural data.
- Aspl53 is in the third variable position of the LRRVe LRR motif (HLALDQ).
- the LRR motif sequence in the LRRVe of Slit2-D2 is LLSLYD, such that to graft Aspl53 from RBC36 onto the Slit2-D2 scaffold, it is only necessary to exchange the corresponding amino acid at the third position of the LRRVe xLxLXx motif. In this case the substitution would be the aspartic acid of RBC36 for the tyrosine of Slit2-D2 (e.g., the LRRVe from Slit2-D2 is changed from LLSLYD to LLSLDD).
- Tyrosine is the most frequently used amino acid, followed by other aromatic amino acids (phenylalanine (Phe), tryptophan (Trp) and histidine (His)), asparagines (Asn) and aspartic acid (Asp).
- Phe phenylalanine
- Trp tryptophan
- His histidine
- Asparagines Aminogen
- Asp aspartic acid
- Fig. 1 antigen crystal structures, the majority of antigen contacts are formed by this subset of amino acids (Fig. 1 1).
- VLRB LRRCT loop on the SLIT2 scaffold may be amenable to variants.
- the LRRCT loop in both the VLR and SLIT structures is preceded by an alpha-helix (shown in figure 13).
- Specifically contemplated variants may be in the addition or deletion of 1 , 2, 3, or 4 amino acids wherein the SLIT2 sequences end and the VLR loop sequence begins after the alpha-helix.
- the LRRCT loops of VLRs can vary in length and sequence composition, so one can add amino acids and determined experimentally an optimal sequence - additional residues at the alpha- helix:loop junction to get the loop in the right orientation for binding.
- the disclosure relates to variant which included the addition or deletion of 1 , 2, 3, or 4 amino acids at the end of the LRRCT loop.
- the disclosure contemplates variants of the Slit2-D2 sequences herein wherein the humanized Slit2 VLR sequences or humanized Slit2-MM3 sequences comprise a segment (SEQ ID NO: 78) CDCHLKWLADYL-[X] m -[Loop Sequence of VLR or MM3]-X 5 C or CDCHLKWLADYL-[X] m -[Loop Sequence of VLR or MM3]-AX 5 C, wherein bolded is the alpha-helix, [X] m is optionally X 1 , X'x 2 , X ⁇ X 3 , X l X 2 X 3 X 4 wherein X 1 is H, X 2 is T, X 3 is N, X 4 is P, and X 5 is an R or K.
- VLRs Humanization of VLRs will not be limited to Slit-family proteins. There are many other human LRR-based receptors with structural similarity (e.g., greater than 30-40% sequence identity) to lamprey VLRs that could also be used as scaffolds. This example only serves to illustrate the general humanization concept. Besides substitution of variable amino acid positions, it may also be necessary to make minor changes to amino acids away from the antigen-binding site in order to optimize the conformation and surface complementarity of the humanized VLR.
- the clearance of tumor cells in vivo by many therapeutic antibodies is mediated by the constant region (Fc) of the antibody.
- the constant region of human IgGl binds to complement and Fey receptors (FcyR) via the CH2 domain, which facilitates killing of target cells via complement dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC), and phagocytic engulfment of antibody-opsonized cells by FcyR-bearing macrophages.
- Fusion proteins consisting of the antigen-binding domain of the VLR and the constant region of human antibodies, such as IgGl, will couple the unique antigen detection of VLR antibodies with human mechanisms of immune clearance.
- the constant regions of human IgG antibodies also increase the half-life of the antibodies in human plasma.
- FcRn binds to the CH2 and CH3 domains of the IgG constant region and facilitates recycling of the antibodies from endocytic compartments, which extends their presence in circulation and increases their efficacy as therapeutics
- VLRs were made for expression of VLRs fused to the Fc region of (1) rhesus macaque IgGl, (2) human IgGl and (3) mouse IgG2a (Fig. 5).
- the expression constructs are in lentivirus- based vectors under the control of the elongation factor la (EFla) promoter that allows for expression by transient transfection or stable lentiviral transduction after transfection of the construct in packaging cell lines. Both approaches were used to express VLRs in HEK-293 and
- the expression vector also contains an IRES-GFP sequence for sorting cells with highly expression.
- MM3 VLR-IgGl -Fc protein was obtained using a stationary culture CELLine bioreactor flask (Integra Biosciences).
- the disclosure contemplates conjugating modified human amino acid sequences, a humanized VLRB sequence, with a human Fc sequence, typically the consensus sequences, to express them in E. coli as fusions to human IgGl Fc.
- the amino acid sequence of a human IgGl Fc sequence portion of certain embodied Fc fusion proteins are as follows:
- VLRB sequence -Fc sequence M- humanized VLRB sequence -Fc sequence MCPAACTCSN TVDCRSKGLTEIPTNLPETITIIYLHDNTIKVIPPGAFSPYKKLREIYLGSNQI SELAPDAFQGLRSL1WLDLGTNKITELPKSLFEGLFSLQELFLCCNKI CLRVDAFQDLHNL NHLALDQNKLQTIAKGTFSPLRAIQHMYLFGNPFICDCHLKWLADYLHIAMRWDGKAVND PDSARCTSPRRLANKRIGQIKSKKFRCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPEN YKTTPPV
- coli cells expressing humanized VLRB sequence and Fc sequence fusion proteins using high-pressure homogenization, and inclusion bodies After subsequent protein folding, selective precipitation, and filtration, one may employ chromatographic purification steps (e.g., ion exchange chromatography, Protein A, or hydroxyapatite chromatography).
- chromatographic purification steps e.g., ion exchange chromatography, Protein A, or hydroxyapatite chromatography.
- the VLRs or modified VLRs or fragments may be fused to a signal- transduction component of the T-cell antigen receptor such as CD3-zeta.
- the signal-transduction component of the T-cell antigen receptor is a peptide with an
- YXXLXXXXXXXXYXXL (SEQ ID NO: 52) wherein X is any amino acid L is leucine or isoleucine, wherein SEQ ID NO: 52 optionally has one or two X amino acid deletions within the middle segment XXXXXXX (SEQ ID NO: 53).
- the immunoreceptor tyrosine -based activation motif (underlined) is in the partial CD3-zeta sequence AQLPITEAQSFGLLDPKLCYLLD
- the signal-transduction component of the T-cell antigen receptor is a peptide with a immunoreceptor tyrosine -based activation motif (underlined) with the sequence of immunoglobulin epsilon receptor subunit gamma precursor IPAVVLLLLLLVEQAAAL
- GEPOLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKH EKPPQ (SEQ ID NO: 55) fragments or variants thereof variants or a sequence with greater than 50, 60, 70, 80, 90, 95% or greater identity thereto.
- the Slit2-D2 mutants were cloned into the lentiviral expression vector containing the IgGl -
- a plasma cell-specific VLR mAb (MM3) were produced by immunizing lampreys with human multiple myeloma cells. Mouse antibodies against human plasma cell antigens have been previously made, but none are plasma cell specific. MM3 VLR mAb binds to both normal (25 of 25 donor samples tested) and malignant human plasma cells (27 of 32 myeloma patients), but does not bind to other B or hematopoietic lineage cells (Fig. 9). MM3 also recognizes plasma cells in non- human primates (rhesus macaque and sooty mangabes), but it does not bind to mouse plasma cells.
- MM3 + cells from rhesus macaque bone marrow were plasma cells, they were sorted by flow cytometry and analyzed by transmission electron microscopy.
- the MM3+ cells had a small, dense eccentric nucleus and large cytoplasmic volume with greatly expanded rough endoplasmic reticulum and golgi, which are characteristic features of plasma cells.
- the conservation of the MM3 antigen on plasma cells in non-human primates provides a model system for evaluation of the ability of VLR antibodies to target and deplete plasma cells in vivo. Multiparameter flow cytometry was used to analyze expression of the MM3 on human bone marrow-derived plasma cell subsets from healthy human donors based on the expression of CD19 and CD138 (Fig. 10).
- the MM3 VLR mAb stained all four CD38hi plasma cell subsets, including the long-lived plasma cell population (CD 19-, CD27+, CD138+, CD38hi). It also stains subpopulations of Ab-secreting cells in human bone marrow that do not express CD 138, the most widely used plasma cell marker.
- the disclosure relates to a polypeptide or fusion comprising a MM3 antigen binding domain sequence (SEQ ID NO: 56)
- the variants are those with greater than 80, 85, 90, 95, 97, 98 % percent identity or similarity thereto. In certain embodiments, the variants contain one, two, or three amino acid substitutions, deletions or insertions. In certain embodiments, the substitutions are conserved substitutions.
- MM3 full sequence including signal peptide and stalk (underlined) (SEQ ID NO: 57) MWIKWIATLVAFGALVOSAVACPSOCSCPGTDVNCHERRLASVPAEIPTTT ILRLYINQI TKLEPGVFDRLTQLTQLGLWDNQLQALPEGVFDRLVNLQKLYLNQNQLLALPVGVFDKLT QLTYLDLNN QLKSIPRGAFDNLKSLTHIWLYGNPWDCECSDILYLK WIVQHASIVNPHP YGGVD VKCSGTNTPVRAVTEASTSPSKCPGYVATTTTPTTTTPEFIPETTTSPOPVITTO KPKPLWNFNCTSIOERKNDGGDCGKPACTTLLNCANFLSCLCSTCALCRKR
- the disclosure contemplates a Slit2-MM3 polypeptides comprising (SEQ ID NO: 64) or variants thereof, CPAACTCSNNIVDCRGKGLTEIPTNLPETIT
- EIRLEQNTI VIPPGAF S P Y KLR ILRLYI NQISELAPDAFQGLRSLN OLVLWD NKITELPKSLFEGLFSLQ LLYLNA NKINCLRVDAFQDLHNLN YLDLNN NKLQTIAKGTFSPLRAIQ HIWLYG NPFICDCHLKWLADYL HASIVNPHPYGGVDN ARCTSPRRLAN; (SEQ ID NO: 74) or variants thereof, CPAACTCSNNTVDCRGKGLTEIPTNLPETIT
- EIRLEQNTIKVIPPGAFSPYKKLR ILRLYI NQISELAPDAFQGLRSLN OLVLWD NKITELPKSLFEGLFSLQ LLYLNA NKINCLRVDAFQDLHNLN YLDLNN NKLQTIAKGTFSPLRAIQ HIWLYG NPFICDCHLKWLADYLH HASIVNPHPYGGVDN ARCTSPRRLAN;
- EIRLEQNTIKVIPPGAFSPYKKLR ILRLYI NQISELAPDAFQGLRSLN OLVLWD NKITELPKSLFEGLFSLQ LLYLNA NKINCLRVDAFQDLHNLN YLDLNN NKLQTIAKGTFSPLRAIQ HIWLYG NPFICDCHLKWLADYLHT HASIVNPHPYGGVDN RCTSPRRLAN;
- EIRLEQNTIKVIPPGAFSPYKKLR ILRLYI NQISELAPDAFQGLRSLN OLVLWD NKITELPKSLFEGLFSLQ LLYLNA NKINCLRVDAFQDLHNLN YLDLNN
- NKLQTIAKGTFSPLRAIQ HIWLYG NPFICDCHLKWLADYLHTNP HASIVNPHPYGGVDN RCTSPRRLAN As described figure 11, a subset of amino acids in VLR variable positions make the majority of antigen contacts.
- the ⁇ -strands on the concave surface of the MM3 VLR mAb contain a total of 13 of these amino acid residues (4 Tyr, 2 Trp, 4 Asn, 2 Asp and 1 His).
- Humanized MM3 (huMM3- 1) will contain these residues substituted into the corresponding positions on the Slit2-D2 scaffold and the MM3 LRRCT insert grafted at the same location as the RBC36 LRRCT insert.
- Figure 12 shows how this approach will be applied to the two most C-terminal LRR modules of MM3 (LRRVe and LRRCP).
- the figure shows an alignment of MM3 and the human Slit2-D2 scaffold for these modules and VLR the variable amino positions are shaded in gray.
- Tyr, Asp and two Asn residues from the MM3 LRRVe and His, Trp and Tyr from the MM3 LRRCP are substituted onto the Slit2-D2 scaffold.
- the Gin residue in the MM3 LRRCP will not be substituted in the initial construct, because it does not fall into the subset of VLR amino acids that most frequently contact antigen, but it may be added.
- This approach is applied to the other LRR modules (LRRV, LRR1 and LRRNT).
- HuMM3-l both as a soluble IgG-Fc fusion protein and in yeast surface display format to evaluate antigen binding.
- yeast display format antigen binding will be determined by staining yeast expressing huMM3 with biotinylated lysates from MM3+ cells and using streptavidin-PE for detection.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15786773.0A EP3137496A4 (en) | 2014-05-02 | 2015-04-30 | Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto |
| CN201580021759.0A CN106459173A (zh) | 2014-05-02 | 2015-04-30 | 人源化可变淋巴细胞受体(vlr)及其相关组合物和用途 |
| CA2947429A CA2947429A1 (en) | 2014-05-02 | 2015-04-30 | Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto |
| US15/308,535 US10167330B2 (en) | 2014-05-02 | 2015-04-30 | Modified recombinant variable lymphocyte receptors (VLR) |
| KR1020167030600A KR20160147787A (ko) | 2014-05-02 | 2015-04-30 | 인간화 가변 림프구 수용체(vlr) 및 이와 관련된 조성물 및 용도 |
| JP2017510445A JP2017514522A (ja) | 2014-05-02 | 2015-04-30 | ヒト化可変性リンパ球受容体(vlr)および組成物ならびにそれに関連する使用 |
| IL248327A IL248327A0 (en) | 2014-05-02 | 2016-10-13 | Human variable lymphocyte receptors and related compositions and uses |
| US16/183,340 US20190202887A1 (en) | 2014-05-02 | 2018-11-07 | Humanized Variable Lymphocyte Receptors (VLR) and Compositions and Uses Related Thereto |
| US16/857,130 US11384134B2 (en) | 2014-05-02 | 2020-04-23 | Recombinant vector and expression system comprising a nucleic acid encoding a variable lymphocyte receptor (VLR) |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201461987566P | 2014-05-02 | 2014-05-02 | |
| US61/987,566 | 2014-05-02 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/308,535 A-371-Of-International US10167330B2 (en) | 2014-05-02 | 2015-04-30 | Modified recombinant variable lymphocyte receptors (VLR) |
| US16/183,340 Division US20190202887A1 (en) | 2014-05-02 | 2018-11-07 | Humanized Variable Lymphocyte Receptors (VLR) and Compositions and Uses Related Thereto |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015168469A1 true WO2015168469A1 (en) | 2015-11-05 |
Family
ID=54359347
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/028645 Ceased WO2015168469A1 (en) | 2014-05-02 | 2015-04-30 | Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US10167330B2 (enExample) |
| EP (1) | EP3137496A4 (enExample) |
| JP (1) | JP2017514522A (enExample) |
| KR (1) | KR20160147787A (enExample) |
| CN (1) | CN106459173A (enExample) |
| CA (1) | CA2947429A1 (enExample) |
| IL (1) | IL248327A0 (enExample) |
| WO (1) | WO2015168469A1 (enExample) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106543278A (zh) * | 2016-12-06 | 2017-03-29 | 李华顺 | 融合蛋白Slit2D2(C386S)‑HSA及其在治疗纤维化疾病中的应用 |
| WO2017074235A1 (en) * | 2015-10-29 | 2017-05-04 | Theravac Pharmaceuticals Ab | A novel fusion partner for safe vaccines |
| WO2018140857A3 (en) * | 2017-01-27 | 2018-09-20 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Bifunctional small peptide for autoimmune diabetes |
| JP2020515289A (ja) * | 2017-03-24 | 2020-05-28 | オルフェウス バイオサイエンス インコーポレイテッド | 自己免疫障害の治療のためのpantid |
| WO2020132301A1 (en) * | 2018-12-21 | 2020-06-25 | Wisconsin Alumni Research Foundation | Variable lymphocyte receptors that target the brain extracellular matrix and methods of use |
| WO2023010060A3 (en) * | 2021-07-27 | 2023-07-06 | Novab, Inc. | Engineered vlrb antibodies with immune effector functions |
| US12195533B2 (en) | 2018-07-24 | 2025-01-14 | Inhibrx Biosciences, Inc. | Multispecific polypeptide constructs containing a constrained CD3 binding domain and a receptor binding region and methods of using the same |
| US12331132B2 (en) | 2018-04-11 | 2025-06-17 | Inhibrx Biosciences, Inc. | Multispecific polypeptide constructs having constrained CD3 binding and related methods and uses |
| US12365728B2 (en) | 2018-10-11 | 2025-07-22 | Inhibrx Biosciences, Inc. | DLL3 single domain antibodies and therapeutic compositions thereof |
| US12371468B2 (en) | 2019-02-11 | 2025-07-29 | Wisconsin Alumni Research Foundation | Variable lymphocyte receptors that target the blood brain barrier and methods of use |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2947429A1 (en) | 2014-05-02 | 2015-11-05 | Emory University | Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto |
| CN107365387B (zh) | 2016-05-12 | 2022-03-15 | 阿思科力(苏州)生物科技有限公司 | 一种双特异性抗原结合构建体及其制备方法和应用 |
| US11339225B2 (en) * | 2016-05-12 | 2022-05-24 | Asclepius (Suzhou) Technology Company Group, Co., Ltd. | Bispecific antigen-binding construct and preparation method and use thereof |
| SG11201909160WA (en) * | 2017-04-11 | 2019-10-30 | Inhibrx Inc | Multispecific polypeptide constructs having constrained cd3 binding and methods of using the same |
| KR101972894B1 (ko) * | 2017-05-18 | 2019-04-29 | 경상대학교산학협력단 | 소수성 테일 도메인이 제거된 먹장어 유래 vlrb 단백질에 칠성장어 유래 vlrb 단백질의 c 말단 서열이 연결된 융합 단백질 및 이의 용도 |
| CN114891799B (zh) * | 2022-05-20 | 2024-10-11 | 宁波大学 | 中华绒螯蟹可变淋巴受体vlr2基因及其编码的蛋白和应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008016854A2 (en) | 2006-08-02 | 2008-02-07 | The Uab Research Foundation | Methods and compositions related to soluble monoclonal variable lymphocyte receptors of defined antigen specificity |
| WO2010065407A2 (en) | 2008-12-01 | 2010-06-10 | University Of Maryland Biotechnology Institute | High affinity recombinant sea lamprey antibodies selected by a yeast surface display platform |
| US8039588B2 (en) * | 2004-05-21 | 2011-10-18 | The Uab Research Foundation | Variable lymphocyte receptors |
| WO2013078425A1 (en) | 2011-11-22 | 2013-05-30 | University Of Maryland, Baltimore | Lambodies with high affinity and selectivity for glycans and uses therefor |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH1118777A (ja) * | 1997-07-09 | 1999-01-26 | Asahi Chem Ind Co Ltd | 新規スリット様ポリペプチド |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| CN103033617B (zh) * | 2012-11-30 | 2014-12-03 | 辽宁师范大学 | 基于可变淋巴细胞受体的肿瘤标志物检测试剂盒及其制备方法 |
| TWI654206B (zh) | 2013-03-16 | 2019-03-21 | 諾華公司 | 使用人類化抗-cd19嵌合抗原受體治療癌症 |
| CA2947429A1 (en) | 2014-05-02 | 2015-11-05 | Emory University | Humanized variable lymphocyte receptors (vlr) and compositions and uses related thereto |
-
2015
- 2015-04-30 CA CA2947429A patent/CA2947429A1/en not_active Abandoned
- 2015-04-30 US US15/308,535 patent/US10167330B2/en active Active
- 2015-04-30 WO PCT/US2015/028645 patent/WO2015168469A1/en not_active Ceased
- 2015-04-30 JP JP2017510445A patent/JP2017514522A/ja active Pending
- 2015-04-30 KR KR1020167030600A patent/KR20160147787A/ko not_active Ceased
- 2015-04-30 EP EP15786773.0A patent/EP3137496A4/en not_active Withdrawn
- 2015-04-30 CN CN201580021759.0A patent/CN106459173A/zh active Pending
-
2016
- 2016-10-13 IL IL248327A patent/IL248327A0/en unknown
-
2018
- 2018-11-07 US US16/183,340 patent/US20190202887A1/en not_active Abandoned
-
2020
- 2020-04-23 US US16/857,130 patent/US11384134B2/en active Active
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8039588B2 (en) * | 2004-05-21 | 2011-10-18 | The Uab Research Foundation | Variable lymphocyte receptors |
| WO2008016854A2 (en) | 2006-08-02 | 2008-02-07 | The Uab Research Foundation | Methods and compositions related to soluble monoclonal variable lymphocyte receptors of defined antigen specificity |
| WO2010065407A2 (en) | 2008-12-01 | 2010-06-10 | University Of Maryland Biotechnology Institute | High affinity recombinant sea lamprey antibodies selected by a yeast surface display platform |
| US20110230374A1 (en) | 2008-12-01 | 2011-09-22 | Zeev Pancer | High affinity recombinant sea lamprey antibodies selected by a yeast surface display platform |
| WO2013078425A1 (en) | 2011-11-22 | 2013-05-30 | University Of Maryland, Baltimore | Lambodies with high affinity and selectivity for glycans and uses therefor |
Non-Patent Citations (36)
| Title |
|---|
| ANTES: "DynaDock: A new molecular dynamics-based algorithm for protein-peptide docking including receptor flexibility", PROTEINS, vol. 78, no. 5, 2010, pages 1084 - 104 |
| ASAHARACHONG, NUCLEIC ACIDS RESEARCH, vol. 38, no. 13, 2010, pages e141 |
| BINZ ET AL.: "report engineering binding proteins from non-immunoglobulin domains", NAT BIOTECHNOL., vol. 23, no. 10, 2005, pages 1257 - 68 |
| CERQUEIRA ET AL.: "MADAMM: a multistaged docking with an automated molecular modeling protocol", PROTEINS, vol. 74, no. 1, 2009, pages 192 - 206 |
| CLAUSSEN ET AL.: "FlexE: efficient molecular docking considering protein structure variations", J MOL BIOL, vol. 308, no. 2, 2001, pages 377 - 95, XP003003165, DOI: 10.1006/jmbi.2001.4551 |
| DAS ET AL.: "Organization of lamprey variable lymphocyte receptor C locus and repertoire development", PNAS, vol. 110, no. 15, 2013, pages 6043 - 6048, XP055234998, ISSN: 0027-8424 * |
| DATABASE GenBank [O] 9 August 2011 (2011-08-09), KASAMATSU,J: "variable lymphocyte receptor B [Lethenteron camtschaticum", XP055235001, retrieved from ncbi Database accession no. BAJ14925.1 * |
| FINLAY ET AL., METHODS MOL. BIOL., vol. 681, 2011, pages 87 - 101 |
| GAIWITTRUP, CURR. OPIN. STRUCT. BIOL., vol. 17, 2007, pages 467 - 473 |
| GANGLOFF ET AL.: "Functional insights from the crystal structure of the N-terminal domain of the prototypical toll receptor", STRUCTURE, vol. 21, no. Issue 1, 2013, pages 143 - 153, XP055234997, ISSN: 0969-2126 * |
| GERA ET AL.: "Protein selection using yeast surface display", METHODS, vol. 60, no. 1, 2013, pages 15 - 26 |
| GUO ET AL.: "report the adaptive immune system in lampreys", NATURE, vol. 459, no. 7248, 2009, pages 796 - 80 |
| HAN ET AL., SCIENCE, vol. 321, 2008, pages 1834 - 183 |
| HAN ET AL.: "Antigen recognition by variable lymphocyte receptors", SCIENCE, vol. 321, 2008, pages 1834 - 183 |
| HAN ET AL.: "Antigen recognition by variable lymphocyte receptors", SCIENCE, vol. 321, no. 5897, 2008, pages 1834 - 1837, XP055234996, ISSN: 0036-8075 * |
| HIRANO ET AL.: "The evolution of adaptive immunity in vertebrates", ADV IMMUNOL, vol. 109, 2011, pages 125 - 57 |
| J IMMUNOL METHODS, vol. 386, no. 1-2, 2012, pages 43 - 9 |
| KIRCHDOERFER ET AL.: "Variable lymphocyte receptor recognition of the immunodominant glycoprotein of Bacillus anthracis spores", STRUCTURE, vol. 20, no. Issue 3, 2012, pages 479 - 486, XP028466155 * |
| LEE ET AL., PROC NATL ACAD SCI U S A, vol. 106, no. 31, 2009, pages 12891 - 6 |
| LEE ET AL.: "report a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering", PROC NATL ACAD SCI USA, vol. 109, no. 9, 2012, pages 3299 - 304 |
| MATSUZAKI ET AL.: "MEGADOCK 3.0: a high-performance protein-protein interaction prediction software using hybrid parallel computing for petascale supercomputing environments", SOURCE CODE BIOL MED, vol. 8, no. 1, 2013, pages 18, XP021161762, DOI: 10.1186/1751-0473-8-18 |
| NAKAHARA ET AL.: "report chronic lymphocytic leukemia monitoring with a lamprey idiotope-specific antibody", CANCER IMMUNOL RES, vol. 1, no. 4, 2013, pages 223 - 228, XP055397133, DOI: 10.1158/2326-6066.CIR-13-0052 |
| NISHIDASHIMADA: "An NMR method to study protein-protein interactions", METHODS MOL BIOL, vol. 757, 2012, pages 129 - 37 |
| O'CONNELL ET AL.: "The structural analysis of protein-protein interactions by NMR spectroscopy", PROTEOMICS, vol. 9, no. 23, 2009, pages 5224 - 32 |
| OHUE ET AL.: "MEGADOCK: An All-to-all Protein-protein Interaction Prediction System Using Tertiary Structure Data", PROTEIN PEPT LETT, 2013 |
| POWERS ET AL.: "report single-chain Fv-Fc fusions are capable of mediating antibody-dependent cellular cytotoxicity against tumor target cells using human peripheral blood mononuclear cells as effectors", J IMMUNOL METHODS, vol. 251, no. 1-2, 2001, pages 123 - 35 |
| See also references of EP3137496A4 |
| SHEN ET AL., PROC. NAT. ACAD. SCI. USA, vol. 102, 2005, pages 5969 - 5974 |
| SHIMIZU ET AL.: "Cell-free translation reconstituted with purified components", NAT. BIOTECHNOL., vol. 19, 2001, pages 751 - 755, XP037163597, DOI: 10.1038/90802 |
| SOLERNOUFERNANDEZ- RECIO: "pyDockCG: new coarse-grained potential for protein-protein docking", J PHYS CHEM B, vol. 115, no. 19, 2011, pages 6032 - 9 |
| TASUMI ET AL.: "report high-affinity lamprey VLRA and VLRB monoclonal antibodies", PROC NATL ACAD SCI USA, vol. 106, no. 31, 2009, pages 12891 - 6, XP055049062, DOI: 10.1073/pnas.0904443106 |
| TUNCBAG ET AL.: "Predicting protein-protein interactions on a proteome scale by matching evolutionary and structural similarities at interfaces using PRISM", NAT PROTOC, vol. 6, no. 9, 2011, pages 1341 - 54 |
| WANG ET AL.: "Protein recognition and selection through conformational and mutually induced fit", PROC NATL ACAD SCI U S A, vol. 110, no. 51, 2013, pages 20545 - 50 |
| WOZNIAK-KNOPP ET AL.: "report human IgGl Fc regions were prepared in which loop sequences at the C-terminal tip of the CH3 domain were randomized. These proteins were able to provide antigen binding, effector functions and an in vivo half-life similar to wild-type antibodies", PROTEIN ENGINEERING, DESIGN AND SELECTION, vol. 23, no. 4, 2010, pages 289 - 297 |
| YU ET AL.: "Purification and identification of cell surface antigens using lamprey monoclonal antibodies", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 386, no. Issues 1-2, 2012, pages 43 - 49, XP028945331, ISSN: 0022-1759 * |
| ZHOU ET AL., MABS., vol. 2, 2010, pages 508 - 518 |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017074235A1 (en) * | 2015-10-29 | 2017-05-04 | Theravac Pharmaceuticals Ab | A novel fusion partner for safe vaccines |
| US10947296B2 (en) | 2016-12-06 | 2021-03-16 | Suzhou Thinking Power Biotechnology Co., Ltd. | Fusion protein Slit2D2(C386S)-HSA and use thereof in treatment of fibrotic diseases |
| WO2018103631A1 (zh) * | 2016-12-06 | 2018-06-14 | 李华顺 | 融合蛋白Slit2D2(C386S)-HSA及其在治疗纤维化疾病中的应用 |
| CN106543278B (zh) * | 2016-12-06 | 2019-04-12 | 阿思科力(苏州)生物科技有限公司 | 融合蛋白Slit2D2(C386S)-HSA及其在治疗纤维化疾病中的应用 |
| CN106543278A (zh) * | 2016-12-06 | 2017-03-29 | 李华顺 | 融合蛋白Slit2D2(C386S)‑HSA及其在治疗纤维化疾病中的应用 |
| WO2018140857A3 (en) * | 2017-01-27 | 2018-09-20 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Bifunctional small peptide for autoimmune diabetes |
| JP2020505472A (ja) * | 2017-01-27 | 2020-02-20 | ボード オブ スーパーバイザーズ オブ ルイジアナ ステート ユニバーシティ アンド アグリカルチュアル アンド メカニカル カレッジ | 自己免疫性糖尿病のための二官能性低分子ペプチド |
| JP2020515289A (ja) * | 2017-03-24 | 2020-05-28 | オルフェウス バイオサイエンス インコーポレイテッド | 自己免疫障害の治療のためのpantid |
| US12331132B2 (en) | 2018-04-11 | 2025-06-17 | Inhibrx Biosciences, Inc. | Multispecific polypeptide constructs having constrained CD3 binding and related methods and uses |
| US12195533B2 (en) | 2018-07-24 | 2025-01-14 | Inhibrx Biosciences, Inc. | Multispecific polypeptide constructs containing a constrained CD3 binding domain and a receptor binding region and methods of using the same |
| US12365728B2 (en) | 2018-10-11 | 2025-07-22 | Inhibrx Biosciences, Inc. | DLL3 single domain antibodies and therapeutic compositions thereof |
| WO2020132301A1 (en) * | 2018-12-21 | 2020-06-25 | Wisconsin Alumni Research Foundation | Variable lymphocyte receptors that target the brain extracellular matrix and methods of use |
| US12077609B2 (en) | 2018-12-21 | 2024-09-03 | Wisconsin Alumni Research Foundation | Variable lymphocyte receptors that target the brain extracellular matrix and methods of use |
| US12371468B2 (en) | 2019-02-11 | 2025-07-29 | Wisconsin Alumni Research Foundation | Variable lymphocyte receptors that target the blood brain barrier and methods of use |
| WO2023010060A3 (en) * | 2021-07-27 | 2023-07-06 | Novab, Inc. | Engineered vlrb antibodies with immune effector functions |
Also Published As
| Publication number | Publication date |
|---|---|
| US20170081385A1 (en) | 2017-03-23 |
| JP2017514522A (ja) | 2017-06-08 |
| EP3137496A4 (en) | 2017-10-11 |
| US10167330B2 (en) | 2019-01-01 |
| US20190202887A1 (en) | 2019-07-04 |
| CA2947429A1 (en) | 2015-11-05 |
| CN106459173A (zh) | 2017-02-22 |
| US20200308247A1 (en) | 2020-10-01 |
| KR20160147787A (ko) | 2016-12-23 |
| IL248327A0 (en) | 2016-11-30 |
| US11384134B2 (en) | 2022-07-12 |
| EP3137496A1 (en) | 2017-03-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11384134B2 (en) | Recombinant vector and expression system comprising a nucleic acid encoding a variable lymphocyte receptor (VLR) | |
| US11136369B2 (en) | Expression of chimeric polypeptide with variable lymphocyte receptors on immune cells and uses for treating cancer | |
| JP7642010B2 (ja) | 改良された抗原結合受容体 | |
| US11919970B2 (en) | Antibodies and chimeric antigen receptors specific for ROR1 | |
| US20240018256A1 (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| JP2019193652A (ja) | 前立腺特異幹細胞抗原に対する抗体およびその使用 | |
| CN111448314B (zh) | 根据可开发性选择真核细胞展示系统中的多肽药物 | |
| EP4341702A2 (en) | Structure based isolation of pmhc-restricted antibodies | |
| EP4247856A1 (en) | Chimeric antigen receptor t cell and method | |
| WO2025059589A1 (en) | Immune cell engaging molecules | |
| WO2024231348A1 (en) | Slc4a4/nbce1 inhibitors | |
| HK40117019A (zh) | 紧密连接蛋白6结合部分及其用途 | |
| HK40049993A (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| HK40042566A (en) | Antibodies and chimeric antigen receptors specific for ror1 | |
| HK40094778A (zh) | Cd20结合分子及其用途 | |
| HK40019803B (zh) | 改进的抗原结合受体 | |
| HK1240239B (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| HK1240239A1 (en) | Antibodies and chimeric antigen receptors specific for cd19 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15786773 Country of ref document: EP Kind code of ref document: A1 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015786773 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015786773 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 248327 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2947429 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 20167030600 Country of ref document: KR Kind code of ref document: A Ref document number: 2017510445 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15308535 Country of ref document: US |