WO2015161311A2 - Humanized anti-tf-antigen antibodies - Google Patents
Humanized anti-tf-antigen antibodies Download PDFInfo
- Publication number
- WO2015161311A2 WO2015161311A2 PCT/US2015/026595 US2015026595W WO2015161311A2 WO 2015161311 A2 WO2015161311 A2 WO 2015161311A2 US 2015026595 W US2015026595 W US 2015026595W WO 2015161311 A2 WO2015161311 A2 WO 2015161311A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- jaa
- mouse
- seq
- humanized
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure relates generally to humanized antibodies that recognize the Thomsen-Friedenheim (TF) human tumor antigen, and methods for using the monoclonal antibodies.
- TF Thomsen-Friedenheim
- TF-Ag also known as T antigen
- T antigen has been associated with several human carcinomas, including those found in the pancreas, colon, and breast, and on this basis has been referred to as a pan-carcinoma marker.
- TF-Ag is concealed from the immune system in normal adult tissues by extension with larger glycan chains.
- the present disclosure comprises in various embodiments compositions and methods for therapy of TF+ cancers.
- the disclosure comprises partially humanized monoclonal antibodies (mAbs) or fragments thereof that bind with specificity to TF-Ag.
- the mAb or fragment thereof comprises a heavy chain and a light chain, wherein the heavy chain comprises a sequence selected from the group consisting of:
- WGQGTTVTVSS (SEQ ID NO:8) (H2); and EVQLVESGAEVKKPGASVKVSCKASGYTFTTYWMHWVKQAPGQGLEWIGFI SPNTDYTEY QKFRDKATMTADTSISTAYMELSRLRSDDTAVYYCARSFIGY FDF WGQGTTLTVSS (SEQ ID NO:9) (H3), and combinations thereof.
- the light chain comprises a sequence selected from the group consisting of:
- the mAb comprises a human IgG constant region.
- the mAb or the TF-Ag binding fragment thereof is conjugated to an agent selected from the group consisting of chemotherapeutic drugs, toxins and radioactive isotopes
- the disclosure comprises a method for prophylaxis and/or therapy of cancer in an individual, wherein the cancer comprises cancer cells expressing TF- Ag.
- the method comprises administering to the individual one or more mAbs or the fragments as described above, wherein the growth, or survival, or metastasis, or a combination thereof, of the cancer cells in the individual is inhibited subsequent to the administration.
- compositions comprising the partially humanized mAb or fragment thereof are provided.
- the disclosure provides an in vitro cell culture, wherein cells in the cell culture express the partially humanized mAb or fragments thereof.
- the disclosure provides polynucleotide sequences encoding the mAbs and TF-Ag binding fragments thereof, expression vectors comprising such polynucleotides, and in vitro cell cultures comprising such expression vectors.
- the mAb or TF-Ag binding fragment thereof is encoded by more than one expression vector.
- methods of making the mAbs and TF-Ag binding fragments thereof are provided, and generally comprise expressing the mAbs or TF-Ag binding fragments, or combinations therof in an in vitro cell culture, and separating the mAbs or TF- Ag binding fragments, or combinations therof, from the cell culture.
- Kits comprising the mAbs and TF-Ag binding fragments thereof are also provided.
- Figure 1 provides the amino acid sequence alignments of JAA-F1 1 heavy variable and the three VH variants (HI, H2, and H3) regions that are included in this disclosure.
- Bold indicates identical amino acids between JAA-F1 1 and the designed, humanized H chains; bold and shaded amino acids indicate differences among the designed humanized chains and mouse JAA-F 1 1.
- Alanine at position 72 shown in bold and italicized is a mouse residue that was retained to avoid steric clashes.
- the complementarity determining regions (CDRs) are italicized. Numbering is according to the Kabat system.
- the mJAAFl l sequence is SEQ ID NO: 17.
- the HI sequence is SEQ ID NO:7; the H2 sequence is SEQ ID NO:8; the H3 sequence is SEQ ID N0:9.
- Figure 2 depicts amino acid sequence alignments of mJAA-Fl l light variable
- JAA-F1 1VH JAA-F1 1VH
- VL variants L2, and L3 regions.
- Bold indicates mouse amino acids or amino acids identical to the mouse sequence, bold and shaded amino acids are differences among the designed humanized JAA-F1 1 variants and mouse JAA-F11.
- Leucine at position 51, shown as bold and italicized is a mouse residue that was retained to avoid steric clashes.
- the mJAAFl l sequence is SEQ ID NO: 17.
- the LI sequence is SEQ ID NO: 10;
- the L2 sequence is SEQ ID NO: l 1 ;
- the L3 sequence is SEQ ID NO: 12.
- Figure 4 Binding of hJAA-Fl 1, chimeric and mouse JAA-F11 (50 ⁇ g/mL) to
- the cell lines include triple negative (HCC 70, BT 549, MDA- MB-231, MDA-MB-468, DU 4475), ER/PR-positive (HCC 1419, AU 565, MDA-kb2), and HER2 -positive (CAMA-1, HCC 1428).
- HCC 70, BT 549, MDA- MB-231, MDA-MB-468, DU 4475 ER/PR-positive
- HCC 1419, AU 565, MDA-kb2 HER2 -positive
- binding to hJAA-Fl 1, chimeric or mouse JAA-F1 1 was significantly higher (p ⁇ 0.05) (Student's T- test) than that of the TF-Ag negative control myeloma.
- Each error bar represents ⁇ 1 standard deviation.
- FIG. 6A ADCC activity of mouse, chimeric, and 4 hJAA-F 1 1 constructs against a TF-Ag positive human breast cancer cell line (BT 549). Results are presented as percent cell lysis in antibody treated cells compared to 100% lysis of cells. H2L2 and H3L3 showed statistically more ADCC activity than chimeric or mouse antibodies (p ⁇ 0.05) in all cases in the human cell line. This is representative average of all experiments on PBMCs from Donor # 1 and Donor # 2 (more than 3 independent experiments). Error bars represent ⁇ 1 standard error.
- FIG. 6B ADCC activity of mouse, chimeric, and 4 hJAA-Fl l constructs against a TF-Ag positive human breast cancer cell line (BT 549) on PBMCs Donor #1.
- Results are presented as percent cell lysis in antibody treated cells compared to 100% lysis of cells.
- H2L2 and H3L3 showed statistically more ADCC activity than chimeric or mouse antibodies (p ⁇ 0.05) in all cases in the human cell line. This is average of at least 3 independent experiments. Error bars represent ⁇ 1 standard error.
- FIG. 6C ADCC activity of mouse, chimeric, and 4 hJAA-Fl l constructs against a TF-Ag positive human breast cancer cell line (BT 549) on PBMCs from Donor #2. Results are presented as percent cell lysis in antibody treated cells compared to 100% lysis of cells. H2L2 and H3L3 showed statistically more ADCC activity than chimeric or mouse antibodies (p ⁇ 0.05) in all cases in the human cell line. This is the average of at least 3 independent experiments. Error bars represent ⁇ 1 standard error.
- FIG. 6D ADCC activity of mouse, chimeric, and 3 hJAA-Fl l constructs against 4T1 TF-Ag positive mouse breast cancer cell line. Results are presented as percent cell lysis in antibody treated cells compared to 100% lysis of cells. H3L3 and chimeric showed statistically more ADCC activity than mouse antibody (p ⁇ 0.05). Error bars represent ⁇ 1 standard error. ADCC was performed only once with PBMCS from Donor #3.
- FIG. 7 Humanized, Chimeric and Mouse JAA-F11 do not induce complement dependent cytotoxicity (CDC). CDC activity of mouse, chimeric, and 2 hJAA- F l l constructs against the human HCC 1428 breast cancer cell line were tested. Results are presented as percent cell lysis in antibody treated cells compared to 100% lysis of cells. Positive control: LDH positive cells included in the reagent kit showed lysis. Error bars represent ⁇ 1 standard error.
- FIG. 8 Internalization of mouse, chimeric, and 4 hJAA-F l l antibodies using an enzyme immunoassay to measure surface binding. Internalization was analyzed by incubation of mouse 4T1 breast cancer cells with antibodies at 37°C or 4°C. As expected, the pattern was opposite the ADCC pattern shown for H3L3 in Figure 20 but was unexpected for H2L2 which induced ADCC and internalized. Mouse, H2L2, chimeric Ab, H2L3, and H1L1 internalized significantly (p ⁇ 0.05). Error bars represent ⁇ 1 Standard error.
- Figure 9 MicroPET images showing immunolocalization of hJAA-Fl l antibody in 4T1 tumor bearing mouse.
- FIG. 10 MicroPET images showing localization of free 124Iodine to the thyroid in 4T 1 tumor bearing mouse.
- the present disclosure comprises distinct humanized monoclonal antibodies
- mAbs and fragments thereof which specifically recognize TF-Ag, methods of making the mAbs, and methods of using the mAbs for prophylaxis and/or therapeutic purposes, and for diagnostic imaging.
- the amino acid sequences of the mAbs provided by this disclosure were developed using a novel approach to change the amino acid sequences in the mAb produced by a hybridoma deposited under ATCC Catalog number CRL-2381, such that the framework regions of the mAbs incorporate both murine and human immunoglobulin (Ig) sequences in a guided way that maintains specificity and reduces immunogenicity.
- the hybridoma produces a mAb known as JAA-F 11.
- Changes introduced into JAA-F 1 1 sequence in the context of the murine framework regions result in an ensemble of three distinct heavy and three distinct light variable chains that can be combined to produce twenty five distinct mAbs that are suitable for combating any of variety of cancers that comprise cancer cells that express TF- Ag.
- the mAbs have desirable characteristics that render them particularly suited for preferentially inducing distinct anti-cancer mechanisms in an individual.
- the disclosure includes providing for stimulating enhanced antibody-dependent cytotoxicity, or complement dependent cytotoxicity, or internalization of the mAb.
- Embodiments of the disclosure include CDR sequences from the JAA-F 1 1 mAb. These are: VH chain: CDR1 : SGYTFTTYWMH; (SEQ ID NO: l); CDR2: FISPNTDYTEYNQKFRD; (SEQ ID NO:2); CDR3 : RSFIGY FDFWGQGT; (SEQ ID NO:3); and VL chain: CDR1 : CRSSQTIVYSNGNTYLEW; (SEQ ID NO:4); CDR2: KVSNRFSGVPD; (SEQ ID NO:5); and CDR3 : CFQGSHVPFTGSG; (SEQ ID NO:6).
- VH chain CDR1 : SGYTFTTYWMH; (SEQ ID NO: l); CDR2: FISPNTDYTEYNQKFRD; (SEQ ID NO:2); CDR3 : RSFIGY FDFWGQGT; (SEQ ID NO:3); and V
- the CDR sequences are placed in the context of modified framework sequences.
- the mAbs and TF-Ag binding fragments thereof comprise a heavy chain selected from:
- TKLEIK (SEQ ID NO: 11);
- Heavy variable region H3 a
- the disclosure encompasses mAbs and TF-Ag binding fragments thereof comprising amino acid sequences that comprise or consist of the foregoing sequences.
- the disclosure comprises mAbs and TF-Ag binding fragments thereof, wherein the framework and CDR sequences consist of SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- Hl-Ll H1-L2; Hl-L2a; H1-L3; Hl-L3a; H2-L1 ; H2-L2; H2-L2a; H2-L3; H2-L3a; H3-L1; H3-L2; H3-L2a; H3-L3; H3-L3a; H2a-Ll; H2a-L2; H2a-L2a; H2a-L3; H2a- L3a; H3a-Ll; H3a-L2; H3a-L2a; H3a-L2a; H3a-L2a; H3a-L2a; H3a-L2a; H3a-L3; and H3a-L3a.
- the disclosure includes mAbs and TF-Ag binding fragments thereof comprising a combination of H1L1, H2L2, H3L3, H2L3, H2a and L2a, and H3a and L3a.
- mAbs and TF-Ag binding fragments thereof comprising a combination of H1L1, H2L2, H3L3, H2L3, H2a and L2a, and H3a and L3a.
- H2a-L2a and H3aL3a were made and tested, and the results for these two combinations were similar to those reported for H2-L2 and H3-L3, respectively.
- H2a-L2a and H3a-L3a combinations were made as a result of subcloning procedures, allowing for selection of additional subclones with further enhanced binding characteristics for TF-Ag, as determined by the highest reactivity in enzyme immunoassays (EIA).
- EIA enzyme immunoassays
- Figure 1 provides the amino acid sequence alignments of JAA-F1 1 heavy variable and the three VH variants (HI, H2, and H3) regions that are included in this disclosure.
- Bold indicates identical amino acids between JAA-F1 1 and the designed, humanized H chains; bold and shaded amino acids indicate differences among the designed humanized chains and mouse JAA-F 1 1.
- Alanine at position 72 shown in bold and italicized is a mouse residue that was retained to avoid steric clashes.
- the CDRs are italicized. Numbering is according to the Kabat system. It will thus be recognized that, while the mAbs described herein are referred to as "humanized" they do comprise certain murine residues, and thus can be considered partially humanized.
- Figure 2 depicts amino acid sequence alignments of mJAA-F 1 1 light variable
- JAA-F 1 1VH JAA-F 1 1VH
- VL variants L2, and L3 regions.
- Bold indicates mouse amino acids or amino acids identical to the mouse sequence, bold and shaded amino acids are differences among the designed humanized JAA-F 1 1 variants and mouse JAA-F 11.
- Leucine at position 51, shown as bold and italicized is a mouse residue that was retained to avoid steric clashes.
- Figures 1 and 2 that the presently provided, humanized H and L chains comprise differences from the JAA-F 1 1 mouse antibody and differences among themselves, but certain murine amino acids have been retained to maintain the specificity of the humanized mAbs.
- fragments of the humanized mAbs described herein are also included in the invention.
- suitable antibody fragments include Fab, Fab', F(ab')2, ScFv and Fv fragments.
- Various techniques have been developed for the production of antibody fragments and are included in the scope of this disclosure.
- the mAbs or fragments thereof are produced host cells by way of recombinant expression vectors.
- the present disclosure includes all polynucleotide sequences encoding the amino acid sequences described herein, expression vectors comprising such polynucleotide sequences, and in vitro cell cultures comprising such expression vectors.
- the cell cultures are eukaryotic cells.
- the cell cultures are mammalian cells.
- the cells are CHO cells.
- Kits comprising the mAbs and/or TF-Ag binding fragments thereof, and/or cell cultures expressing the mAbs and/or TF-Ag binding fragments thereof, are provided by this disclosure.
- the kits comprise one or more sealed containers that contain the mAbs and/or TF-Ag binding fragments thereof, or cells expressing them. Instructions for using the mAbs and/or TF-Ag binding fragments for therapeutic and/or imaging purposes can be included in the kits.
- the disclosure includes a method of making the mAbs or TF-
- Ag binding fragments thereof comprising culturing cells comprising an expression vector or other polynucleotide sequence encoding the mAbs or TF-Ag binding fragments thereof, allowing expression of the mAbs or TF-Ag binding fragments thereof, and separating the mAbs or TF-Ag binding fragments thereof from the cell culture.
- Nucleotide sequences encoding the mAbs or TF-Ag binding fragments thereof can be expressed using any suitable expression vector, many of which are known in the art and/or are commercially available, in one embodiment, the heavy and light chains are expressed on a single expression vector, such as a plasmid.
- the heavy and light chaines are expressed on distinct plasmids in the same cell, after which the expressed heavy and light chains form the conventional mAb architecture.
- the mAbs or TF-Ag binding fragments thereof can be isolated and/or purified using conventional techniques, given the benefit of the present disclosure.
- the disclosure provides a method of inhibiting the growth of cancer cells in an individual, and/or inhibiting metastasis of cancer cells in an individual, which cancer cells express TF-Ag molecules.
- the method comprises administering to the individual a therapeutic amount of the humanized mAbs and/or fragments thereof, wherein the administration inhibits the growth and/or inhibits the metastasis of the TF-Ag expressing cancer cells.
- practicing the method of the invention reduced the volume of a tumor, and/or reduces the formation of metastatic foci, or secondary tumors.
- the method is provided for an individual in need thereof.
- the individual in need has been diagnosed with, is suspected of having, or is at risk for developing or having a recurrence of cancer.
- a therapeutically effective amount of a mAb or TF-Ag binding fragment therof is used.
- therapeutically effective means that the amount of the mAb or TF-Ag binding fragment therof administered is of sufficient quantity to inhibit the growth, survival and/or metastasis of TF+ cancer cells.
- the humanized mAbs and/or fragments thereof can be conjugated to a chemotherapeutic agent to enable localization of the chemotherapeutic agent to cancer cells via binding to cells expressing TF-Ag.
- Chemotherapeutic agents useful in the generation of such antibody conjugates include enzymatically active toxins and fragments thereof.
- Suitable enzymatically active toxins include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes.
- the chemotherapeutic agents can be covalently attached to the mAb or TF-Ag binding fragment thereof by any suitable chemical conjugation approach.
- the chemotherapeutic agent can comprise a segment of a fusion protein with the mAb or TF-Ag binding fragment.
- the disclosure provides a method for identifying in an individual metastatic foci, tumors, or combinations thereof, wherein the metastatic foci or tumors comprise cells expressing TF-Ag.
- the method comprises the steps of administering to the individual humanized mAbs and/or fragments thereof, wherein the humanized mAbs and/or fragments thereof have been conjugated to a detectable label, and detecting the detectable label to identify metastatic foci, tumors, or combinations thereof.
- the humanized mAbs and/or fragments thereof may be conjugated to a detectable label, such as a radioactive agent.
- JAA-F 11 mAbs A variety of radioactive isotopes are available for conjugating to JAA-F 11 mAbs such that cells to which the JAA-F11 mAbs bind may be imaged or selectively destroyed.
- the JAA-F1 1 mAbs may be conjugated to a highly radioactive atom, such as Inl l l, At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu.
- a highly radioactive atom such as Inl l l, At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu.
- the humanized mAbs and/or fragments thereof are used for identifying cells expressing TF-Ag in metastatic foci or in tumors, they may comprise a radioactive atom for scintigraphic studies, for example Tc99m (metastable technetium-99), 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, or "MRI"), such as 1123, 1131, 1124, F19, CI 3, 15, 017 or Gadlinium (III) or Manganese (II).
- NMR nuclear magnetic resonance
- MRI magnetic resonance imaging
- Labeled humanized mAbs and/or fragments thereof can be injected into patients diagnosed with or suspected of having a metastatic disease to identify mestatstic foci and/or tumors.
- Information from such imaging can be used for diagnosing or staging of the disease status of the patient.
- the label used can be selected in accordance with the imaging system to be used.
- Indiuml l l, Technetium99 or Iodinel31 can be used for planar scans or single photon emission computed tomography (SPECT).
- Positron emitting labels such as Fluorinel9 Iodine 123 and Iodine 124 can be used in positron emission tomography.
- Paramagnetic ions such as Gadlinium (III) or Manganese (II) can used in magnetic resonance imaging (MRI). Localization of the label within a particular tissue of the individual permits localization of metastatic foci or tumors which comprise cells expressing TF-Ag.
- a concentration of label at a particular location greater than background permits identification of the presence of metastasized cells.
- a suitable period of time is allowed to pass such that unbound humanized mAbs and/or fragments thereof are cleared from the individual such that background label is greatly reduced.
- Therapeutic formulations comprising conjugated or unconjugated humanized mAbs and/or fragments thereof may be prepared by mixing with pharmaceutically acceptable carriers, excipients or stabilizers (Remington 's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- the humanized mAbs and/or fragments thereof may be combined with other chemotherapeutic agents in pharamceutical compositions.
- the humanized mAbs and/or TF-binding fragments thereof may be administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, intralymphatic or subcutaneous administration.
- the humanized mAbs and/or fragments thereof may suitably be administered by pulse infusion, e.g., with declining doses of the antibody.
- the dosing is given by injections, most preferably intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
- the humanized mAbs and/or fragments thereof are administered to an individual diagnosed with or suspected of having breast, colon, prostate, ovarian, bladder or other TF Ag+ cancers to inhibit metastasis or to inhibit the growth of the cancer cells.
- chemotherapeutic agents such as chemotherapeutic agents, immunosuppressive agents and/or cytokines can also be administered.
- the combined administration can include co-administration, using separate formulations or a single pharmaceutical formulation, and can also include consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
- the humanized mAbs and/or fragments thereof may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to inhibit metastasis and/or growth of cells expressing TF-Ag.
- the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables, such as the size of the individual and the stage of the disease.
- CDRs were defined so as to maintain specificity and affinity for TF-Ag.
- the inclusive CDRs were defined according to both Kabat et al [139] and Chothia et al [141] based on sequence and structural variability, respectively.
- Two amino acids are considered to contact one another in a protein structure if both contain a pair of atoms separated by 6A or less [138].
- X-ray crystallography and computational carbohydrate threading studies on mouse JAA-F 11 [142] identified amino acid residues within 5-6A from the binding site. These amino acids as well as two cysteine residues at position L23 and L88 of the light chain that are important for conformational structure were included in the final inclusive definition of the CDRs used in JAA-F 1 1 humanization.
- a BLAST search was performed separately comparing the VH and VL sequence of the mJAA-F 11 (mouse antibody) against human immunoglobulin sequences.
- the top 10 most homologous human VH and VL sequences were aligned with the corresponding variable regions of mJAA-F l l using the Seaview Sequence Alignment program.
- the amino acid sequence of the framework regions were chosen based on the amino acid most often seen at each position in the top 10 most homologous human IgG variable sequences.
- the amino acid sequence of the framework regions were chosen as follows: if the amino acid in any of the top 10 human sequences matched the corresponding amino acid in the mouse immunoglobulin then that amino acid was chosen, in the remaining positions the amino acid most often seen in the human sequences was chosen.
- the amino acid sequence of the framework region contained 3 mouse amino acids on either side of each CDR while the rest of the sequence is made up of amino acids most often seen in the top 10 human sequences.
- JAA-F 11 variable region attached to human constant regions.
- the chimeric was made to verify that the correct mouse variable regions have been cloned and sequenced and also to serve as a positive control when evaluating the humanized JAA-F 11 antibodies.
- the chimeric is expected to maintain the same binding characteristics as the mouse JAA-F 11, while having the human constant region.
- T20 score is used to measure the "humanness" of monoclonal antibody variable region sequences. This scoring system was developed by Gao et al [Monoclonal antibody humanness score and its applications. 2013. BMC Biotechnology, 13:55], using a database of over 38,000 human antibody sequences. In this method, a protein BLAST of this database is performed and the test humanized Ab is compared against these human sequences. The humanized antibody is compared to the top 20 human Ab BLAST matches and scored for similarity to these sequences. The highest possible score is 100 (most human-like).
- the hJAA-F 11 and chimeric VH and VL genes were cloned into two different mammalian expression vectors containing the human IgGl heavy chain constant region (6307 pAH) and the human kappa light chain constant region (6714 pAN) respectively to produce plasmids containing complete IgGl and kappa genes.
- the correct sequence and orientation of the each of cloned VH and VL regions in 6307 pAH and 6714 pAN expression vectors were verified by sequencing.
- Humanized JAA-Fl l constructs and chimeric JAA-Fl l were purified from culture supematants by protein A column chromatography individually.
- a chimeric antibody, as well as H1L1, H2L2, H3L3 and H2L3, H2aL3a, and H3aL3a, have been produced. Given the benefit of the present disclosure the skilled artisan can readily produce the remaining antibody H and L chain combinations that are encompassed in the present invention.
- the chemical specificity of the hJAA-Fl l and chimeric JAA-Fl l variants were determined using a glycan array by the Consortium for Functional Glycomics. These data were compared to data obtained for mouse JAA-F1 1.
- the glycan array analysis is an indirect immunofluorescent method to determine glycan binding reactivity of lectins and antibodies.
- An earlier glycan array was utilized to demonstrate the chemical specificity of mouse JAA-F l l . This method was used to analyze the reactivity of the antibody candidates with 610 different glycans.
- the hJAA-Fl l HlLl, H2L2, H3L3, and the chimeric antibody showed the same fine specificity of binding as the mouse antibody including the limitation of binding to the Galpl-3GalNAc-a (TF-Ag) linked structures, and the lack of binding with a2-3 sialylated structures.
- the glycan array shows that out of 610 glycans, the humanized antibodies, the chimeric, and mouse JAA-F11 only bind TF-Ag and four other TF-Ag containing saccharide structures.
- Neu5Aca2-6(Gal l-3GalNAc , GlcNAcpl-6(Galpl-3)GalNAcp and Galpl-4GlcNAcpl- 6(Gal l-3)GalNAc unsubstituted have only been found in excreted fluids, in cancer or other disease states.
- the Neu5Acp2-6 Galpl-3GalNAc is not a natural structure and is not in humans.
- H2L3 shows statistically (p ⁇ 0.05 by ANOVA) less binding with any addition to TF-Ag, and HlLl and H2L2 do not permit a disaccharide to be added to the C-6 hydroxyl of the GalNAc and this is statistically different (p ⁇ 0.05) from the other antibodies.
- TF-Ag The well-known elongation of TF-Ag on normal tissues is carried out by l-3N-acetylglucosaminyl-transferase adding GlcNAc l-3 on the Gal, forming GlcNAc l-3Gal l-3GalNAca-Sp8, or by a 2-3 sialyltransferase forming Neu5Aca2-3Gal l-3GalNAc (sialyl-TF) or with a second sialyltransferase forming Neu5Ac2-3Gal l-3(Neu5Aca2-6)GalNAc (disialyl-TF) all of which do not bind the mouse, chimeric or the humanized JAA-F 1 1.
- normal tissue binding is not expected for JAA- F 11 or the hJAA-F 1 1 constructs.
- the relative binding affinities of the four hJAA-F 1 1 and chimeric antibodies to TF-Ag were determined by comparing the ability of the mouse antibody to compete with the humanized antibodies in an enzyme immunoassay.
- the 3 ⁇ g of each humanized Ab is mixed with serial dilutions of the mouse anti TF-Ag antibody (mJAA-F l l).
- Binding of the human anti-TF-Ag to the TF-Ag coated plate is measured using a species specific anti-human IgG.
- the amount of mouse mJAA-F 1 1 required to inhibit 1 ⁇ g of hJAA- Fl 1 to 50% is extrapolated and taken as a measure of relative affinity. The higher the amount of mouse antibody required for inhibition, the higher the relative affinity of the antibody.
- Table 2 shows the half maximal inhibitory concentration of mouse JAA-Fl l required (IC50) by the different antibodies to compete with 1 ⁇ g of this humanized antibody.
- H2L2 is shown with the highest relative affinity to TF-Ag among the antibodies, with an IC50 2.31 ⁇ g of mouse antibody.
- H2L3 is not significantly different from H1L1, H2L2, H3L3 and chimeric antibody. The relative affinities of H1L1, H3L3 and the chimeric antibody are not significantly different from each other.
- Binding of hJAA-F 1 1 and chimeric JAA-F 11 antibodies to various human breast tumor cell lines was assessed using whole cell ELISA.
- the TF-Ag positive mouse mammary tumor 4T1 cell line served as a positive control while the P3-X63-Ag8 Myeloma cell line served as the TF-Ag negative control.
- the assays were performed on three different days and 3 to 4 cell lines were assayed at a time in quadruplicates with the control cell lines.
- a cell line was considered positive if the relative binding due to hJAA-F 11 or chimeric JAA- F l l (at 5C ⁇ g/mL) was significantly higher (p ⁇ 0.05) than that of the TF-Ag negative control myeloma. Results are shown in Figure 4.
- the cancer cell lines tested consist of the different subgroups of breast cancers, hormone receptor positive or negative, Her2-positive or negative, and triple negative.
- the estrogen receptor (ER) and progesterone receptor (PR) positive cell lines tested were CAMA-1 and HCC-1428. Two Her2/neu receptor positive cell lines, HCC-1419 and AU-565 were tested.
- the triple negative breast cancer (TNBC) cell lines tested were HCC-70, MDA-MB-231, MDA-MB-468, DU-4475, AND BT-549.
- One cell line, MDA-kb2 expresses androgen receptor but is estrogen receptor negative.
- results show that the hJAA-Fl l and chimeric JAA-Fl l antibodies bind to all 10 breast cancer cell lines examined, confirming the expression of TF- Ag on these cell lines.
- the data obtained indicate a therapeutic role of TF-Ag in targeting the aggressive TNBC and the use of hJAA-F l l antibodies to treat and increase survival of breast cancer patients regardless of receptor status.
- Table 4 summarizes the types of breast cancers and the expression of TF-Ag of each cell line tested.
- Table 4 Table of breast cancer cell lines tested in whole cell ELISA.
- Table shows hormone receptor, Her2/neu receptor, and expression of TF-Ag. Triple negative (bold), ER/PR positive (italics), and HER2-positive (bold and italics).
- DA-kb2* is negative for estrogen receptor but expresses androgen receptor.
- Antibody-dependent cell mediated cytotoxicity was performed on human breast tumor cell lines using the CytoTox 96 Non-Radioactive Cytotoxicity assay; Promega, Madison, WI) based on the lactate dehydrogenase (LDH) release assay according to standard techniques with the following adaptations.
- Fresh human peripheral blood mononuclear cells were isolated from EDTA anti-coagulated whole blood for use with the humanized antibody and 4T1 mouse breast cancer cells in an effector to target ratio of 100: 1. The release of LDH was used to quantify cytotoxicity.
- Figure 6A shows the amount of ADCC facilitated by the mouse, chimeric
- H1L1 and H3L3 antibodies compared on a human breast cancer cell lines, BT 549.
- the experiments were repeated more than three times.
- H2L2 and H3L3 showed significantly more (p ⁇ 0.5) ADCC than either the chimeric or the mouse antibody in the human cell lines.
- More than 20% of the TF-Ag bearing BT549 and HCC70 target cells were lysed by H2L2 and H3L3 antibody at 200 ⁇ g/mL at a 100: 1 effector to target (E:T) ratio.
- E:T effector to target
- H3L3 antibody showed significantly more (p ⁇ 0.05) ADCC than either the chimeric or the mouse antibody.
- hJAA-F l l and chimeric antibodies were determined by the lactate dehydrogenase (LDH) release assay using human breast cancer cell HCC-1428 cells as the target cells.
- LDH lactate dehydrogenase
- the LDH positive control provided with the reagent kit was used as a positive control and showed lysis.
- the mouse JAA-F 1 1, chimeric, H1L1, H3L3, H2L3 antibodies did not induce complement- dependent cytotoxicity as no lysis occurred as shown in Figure 7.
- H1L1, H2L3, chimeric and mJAA-Fl l all showed statistically significant internalization and did not perform ADCC well.
- An unexpected result was observed for H2L2 antibody which induced high ADCC similar to H3L3 but showed the highest internalization percent activity compared to the chimeric and other humanized antibodies.
- Table 5 Summary of internalization, ADCC and glycan specificity of mouse, humanized and chimeric JAA-F 1 1.
- MicroPET imaging was performed serially on one mouse each that was injected with 124Iodine-hJAA-F l l H2L2 antibody, and with free 124Iodine. Imaging was performed at 24, 48, 72, 96, 168, and 192 hours.
- Figure 9 shows the coronal view of a mouse injected with 124Iodine-hJAA-Fl 1 H2L2 antibody at different time points, while Figure 10 is of a control mouse injected with free 124Iodine. Uptake of the radiolabeled antibody by the tumor was observed at 24, 48, 72, and 96 hours after injection. Uptake of antibody was also seen in the spleen at 48 hours ( Figure 9).
- the negative control mouse bearing the 4T1 TF-Ag positive tumor, which received free 124Iodine only showed that there was no localization to any organs or tumor except to the thyroid throughout the study ( Figure 10).
- the fully murine JAA-F1 1 has potential for passive humoral immunotherapy and drug conjugate therapy in breast cancer patients.
- mouse antibodies in humans had been shown to be limited by the development of human anti-murine antibody (HAMA) responses and a short half-life in patients
- humanization is desirable to decrease the immunogenicity of the mouse JAA-F 11 antibody and also allow it to remain in circulation for a longer time.
- any of the 3 heavy chains (VH) can pair with any of the 3 light chains (VL) to create a total of 9 possible hJAA- Fl 1 VH/VL combination variants.
- a chimeric JAA-F 1 1 which has the whole mouse variable region and a human IgGl and kappa constant regions was also generated, and used as a control.
- T20 score method developed by Gao et al [Monoclonal antibody humanness score and its applications. 2013. BMC Biotechnology, 13:55], and validated with analysis of 90 antibodies that have been utilized in patients, was used to predict the immunogenicity of the humanized JAA- Fl lvariants.
- the T20 scores of the humanized JAA-F 11 variants are all higher (improved) (>85) than the chimeric JAA-F1 1 ( ⁇ 85), indicating that humanization of heavy and light variable chains by all three of the present methods created hJAA-F 1 1 variants that will be less immunogenic than the chimeric variant.
- Antibody humanization by CDR-grafting can cause a decrease in affinity or loss of antigen binding, which may be due to the CDRs conformation and antigen binding site being negatively affected by changes in some framework amino acid residues in the humanized antibody.
- CDRs are made up of residues that interact with the framework regions and other CDRs.
- some framework residues that can affect antigen binding directly or indirectly include the Vernier zone residues and residues at the VL/VH interface.
- Vernier zone residues are residues in the ⁇ -sheet framework underlying the CDRs which provide a foundation for the conformation of loop structures.
- Vernier residues on the light chain are at position 2, 4, 35, 36, 46, 48, 49, 64, 67, 69, and 71, while on the heavy chain they are identified at position 2, 27, 28, 29, 30, 47, 48, 49, 67, 69, 71, 73, 78, 93, 94, and 103.
- Residues at the VL/VH interface have been identified by Chothia and co-workers [Chothia C, et al. The packing of variable domains. 1989. J. Mol. Biol.
- H2L2 antibody has the highest affinity antibody, followed by H2L3 antibody.
- H2L2 antibody has the highest relative affinity to TF-Ag among the antibodies, requiring over 2 mg of mouse antibody for the inhibition of 1 mg of H2L2 antibody.
- the H2L3 antibody also had higher affinity than HlLl and the chimeric antibody although not significantly, while the relative affinities of HlLl, H3L3 and the chimeric antibody to TF-Ag are not significantly different from each other.
- framework residues affecting antigen binding include the Vernier zone and VL/VH interface residues.
- the mAbs of this disclosure retain most of the Vernier zone and VL/VH interface residues that may be important for the binding site conformation, however some changes were made to create the less immunogenic humanized variants.
- the amino acids that were changed that were in the Vernier zone or in the VH/VL interface, and changes have been made to amino acids within 4 amino acids (sequentially) to the CDRs, are as indicated by the asterisks.
- H2 retains mouse residues but differs between HI and H3 constructs at eight positions 5, 11, 69, 73, 75, 82b, 83, and 85. Of these eight residues, two are Vernier zone residues, at positions 69 and 73. At the same time, H2 and HI have substitutions at two Vernier zone positions, that is, at residue 48 and 67, which are maintained as mouse residues on H3. Since there is no difference in affinity between H1L1 and H3L3, this suggest that the Vernier zone positions at 48 and 67 may not likely contribute to the affinity difference as they are maintained in H3, but changed in HI.
- H2 retains the mouse Vernier zone residues at positions 69 and 73, unlike HI and H3, suggesting the changes at these two Vernier zone positions may contribute to the differences in affinity.
- These two Vernier zone residues that underlie the CDR2 may have enhanced H2 binding compared to HI and H3.
- positions 69 and 108 are the closest to the binding site.
- the amino acid in position 69 in H2 (like in the mouse antibody) is Leucine while both of the other humanized constructs have Methionine.
- changes at amino acids 38, 48, 66, 67, and 109 are nearest the CDRs and also may affect the affinity.
- H2L2 has a higher affinity than H2L3 the comparison of L2 and L3 may help further delineate the reason for this difference.
- VL/VH residues There were no changes for the VL/VH residues and most of the Vernier zone residues on the light chain were maintained among the 3 humanized constructs, except for Vernier positions 2 and 36.
- the higher affinity L2 has a Phenylalanine rather than Tyrosine at Vernier position 36.
- the amino acids at position 36 and 37 may influence the conformation in a favorable way, since they are within 5 A of the binding site, and are part of the amino acids in positions 24-35 which were found to be important in the maintenance of the alpha linkage requirement at the reducing terminus of the GalNAc.
- TF-Ag Gal l -3 Gal Ac-beta linked structures that are normally found in the central nervous system, on NK cells, and peripheral nerve tissue, thus maintenance of fine specificity is the key feature in this humanization.
- the hJAA-Fl 1 H1L1, H2L2, H3L3, and the chimeric antibody retained the same or improved fine specificity of antigen binding as compared to the mouse antibody including the limitation of binding to the Gal l-3GalNAc-a (TF-Ag) linked structures, and the lack of binding with a2-3 sialylated structures based on the glycan array.
- humanized JAA-F 11 constructs exhibit similar or even improved when tested against over 600 different saccharides.
- the mouse JAA-F 11 and all humanized constructs react with just 5 saccharides, TF-Ag and 3 trisaccharides with one additional sugar 1-6 linked to the GlcNAc (NeuAc in 2, and GlcNAc in the 3rd) or with one with 2 additional sugars GalGlcNAc linked 1-6 to the GalNAc .
- H2L3 showed less binding on all 4 other saccharides that bind to JAA-Fl 1, while H1L1 and H2L2 have no binding to the tetrasaccharide that binds to JAA-F l 1, when compared to the chimeric and mouse antibodies.
- these 4 other saccharides that bind to JAA-Fl 1 are not known to be expressed on normal tissues, increased specificity for the target structure is always desirable. This demonstrates the likely targeting ability for all these antibodies in human therapy. Since H2L3 has increased binding specificity as shown by less binding to 3 of the 4 saccharides compared to the other constructs, the difference between H2 and H3 may have cause this difference.
- H2L3 differs from H2L2 in its decreased binding to NeuAcalpha2-6(TF-Ag) and GlcNAcbeta2-6(TF-Ag).
- H1L1 and H2L2 do not bind at all to the tetrasaccharide may have to do with a shared difference between these antibodies when compared to the H3L3 and mouse antibodies.
- HI and H2 both have a Methionine at position 48, which is both a Vernier zone position and is sequentially within 4 amino acids of the CDR. This methionine is rather than the isoleucine of the mouse and H3 antibodies.
- whole cell EIA results highlight the ability of the hJAA-Fl l and chimeric JAA-F 11 antibodies to bind triple-negative breast cancer cell lines.
- the data obtained suggest a potential therapeutic role of TF-Ag in targeting all breast cancer but especially the aggressive triple-negative breast cancers (TNBC) as there are no targeted therapies for these types of cancers at present.
- TNBC triple-negative breast cancers
- Some lectins and antibodies which bind TF-Ag cause increased proliferation of TF-Ag expressing tumor cells. This is thought to usually be linked to whether the lectin or antibody binds both the alpha and beta anomers at the reducing end (proliferation causing) or just the alpha anomer (inhibitory). While mouse JAA-F l l only binds the alpha anomer and did not cause proliferation of tumor cells, it is important to determine if the humanized constructs had this effect on tumor cells.
- Humanized JAA-Fl l and chimeric antibodies do not cause proliferation of cancer cells in vitro, on the contrary, similar to the effect of mouse JAA-F1 1 a small ( ⁇ 6 - 1 1%) but significant inhibition of mouse 4T1 and human cancer cells growth was observed.
- ADCC is one of the major mechanisms by which antibodies eliminate tumor cells, and is important for an antibody to be utilized for cancer therapy
- the ability of the humanized JAA-Fl l variants to induce ADCC was examined.
- ADCC activity was seen with some but not all of the humanized constructs, and was seen with PBMCs of three individuals.
- Both H2L2 and H3L3 antibody induced significantly more ADCC than either the chimeric or the mouse antibody of both mouse 4T 1 and human breast cancer cell lines, indicating that currently the H2L2 and H3L3 antibody may be the preferred choices for direct passive immunotherapy.
- the mouse JAA-Fl l did not show any statistically significant ADCC abilities in any of the tests.
- Another effector function that antibodies used for killing tumor cells is CDC.
- Antibodies can potentially be used to carry drugs or toxins in the form of antibody-drug conjugates into the cell. Therefore, we assessed the ability of the humanized JAA-F1 1 variants to internalize after binding to TF-Ag on cancer cells. Mouse JAA-F11 had previously been show to internalize within 1 hour. Using an enzyme immunoassay, we showed that mouse, H2L2, chimeric, H2L3, and H1L1 antibodies internalize significantly into mouse 4T1 breast cancer cells whereas H3L3 antibody did not show significant internalization. A live cell fluorescent microscopy method confirmed the results obtained from the enzyme immunoassay.
- the mouse 124I-JAA-F11 antibody has been shown to localize to TF-Ag breast tumors in mice.
- the labeled JAA-F 11 antibody remained bound to the 4T 1 tumor for at least 20 days and 24 days for a human triple negative breast tumor implying that JAA-F 1 1 could be used to find metastasis and to treat the TF-Ag bearing tumor.
- the humanized antibody with the highest affinity, H2L2 variant, (which internalizes and performs ADCC) was utilized.
- the imaging showed preferential tumor uptake, with uptake in the thyroid and in the spleen that was blocked in a later experiment with cold rabbit immunoglobulin.
- MicroPET imaging showed that the radiolabeled humanized antibody was taken up by the tumor within 24 hours and could be seen until 96 hours. Such radiolocalization in patients could be used to find metastasis and also used to determine if there is any off target binding in a particular patient prior to either direct passive immunotherapy or antibody-drug conjugate therapy.
- the Thorns en-Friedenreich Antigen (TF-Ag) is present in more than 80% of several human carcinomas including breast cancers. It has a functional role in tumor adhesion and metastasis so the ability of an antibody to target TF-Ag suggests possible use as an immunotherapeutic, as an antibody-drug conjugate for killing cancer cells and for inhibiting metastasis.
- the JAA-F 11 antibody with its unique high specificity for the TF-Ag holds great potential as a passive anti TF-Ag response for treating breast and other cancers. In our humanization approach, we have maintain this unique specificity and have likely enhanced it with the humanized JAA-F 1 1 variants.
- an antibody should maintain its specificity for its target antigen and at the same time not generate anti- mouse immune reactions.
- the CDRs were selected using Chothia and Kabat methods as well as the x-ray crystal structure and computational carbohydrate threading.
- the resulting top ten most homologous sequences to each of the heavy and light variable chain sequence of JAA-F 11 were selected as potential human acceptor antibody frameworks for humanized JAA-F 11 (hJAA-F l 1).
- the SeaView Sequence Alignment program was used to align the ten potential human acceptor variable heavy or light frameworks sequences with mouse JAA-F l 1 variable heavy or light region sequences.
- a chimeric JAA-F1 1 was also constructed in which the entire mouse JAA-F 11 variable region was attached to a human IgGl constant region. This is to provide a baseline that should have the original specificity and affinity of the mouse antibody while having the human constant region, to be was used as a positive control for evaluating the humanized variants.
- a protein BLAST search is performed and the test humanized Ab is first compared against all these human sequences.
- the humanized antibody is then compared to the top 20 human Ab BLAST matches and scored for similarity to these sequences.
- T20 score for humanized antibody is obtained from the average of the percent identities of the top 20 matched human sequences. The highest possible score is 100 (most human-like).
- the T20 scores for the humanized JAA-F1 1 variants were calculated using the T20 Cutoff Human Databases at abanalyzer.lakepharma.com/.
- JAA-F1 1 VH and VL variants amino acid sequences the corresponding nucleotide sequences were selected manually for codon usage optimal for Cricetulus griseus (CHO) cell protein production and synthesized and inserted into pUC57 plasmid, a commonly used cloning vector.
- hJAA-Fl l and chimeric JAA-F1 1 variable heavy (VH) and light (VL) genes in mammalian expression vectors.
- the hJAA-Fl l VH genes were sub-cloned and inserted into an expression vector (pAH6307) containing a human IgGl heavy chain leader/constant region under the control of human cytomegalovirus (CMV) promoter and ampicillin (Amp) and histidinol dehydrogenase (hisD) cassettes.
- CMV cytomegalovirus
- Amp ampicillin
- hisD histidinol dehydrogenase
- VL genes were inserted into an expression vector (pAN 6714) containing a human kappa light chain leader/constant region under the control of the human CMV promoter and neomycin phosphotransferase (neoR) cassette. Similarly, the chimeric JAA-F1 1 VH and VL were expressed and used as positive control in subsequent analyses.
- Adherent Chinese hamster ovary (CHO-K1 ; ATCC #CCL-61, Manassas, VA) cells were cultured for 18 hours before transfection in Ham's F12 medium (Corning Cellgro, Manassas, VA) supplemented with 10% fetal calf serum (FCS; Hyclone) at 37°C and 5% carbon dioxide (C02) in humidified air and harvested at 50-80% confluency.
- FCS fetal calf serum
- C02 carbon dioxide
- the mammalian 6307 pAH (VH) and 6714 pAN (VL) expression vectors were co-transfected into CHO-K1 cells by electroporation (Gene Pulser System (Bio-Rad, Hercules, CA).
- each plasmid (VH and VL) was linearized using the Pvul restriction enzyme (Promega, Madison, WI) and 5 ⁇ g of each plasmid was added to 5 x 106 CHO-K1 cells in cold Ham's F 12 medium (Corning Cellgro, Manassas, VA) in a total volume of 500 ⁇ ⁇ in a 0.4 cm electroporation cuvette (Bio-Rad, Hercules, CA). The cuvette containing the mixture was electroporated at 960 ⁇ and 250 mV. The transfection mixture was then diluted with pre- warmed non-selective medium (Ham's F 12 supplemented with 10% FCS) to a concentration of 1 x 105 cells/mL.
- pre- warmed non-selective medium Ham's F 12 supplemented with 10% FCS
- tissue culture plate(s) BD Bioscience, San Jose, California
- the transfected cells were incubated at 37°C and 5% CO 2 in a tissue culture incubator.
- the non-selective medium from 96-well tissue culture plate was removed and replaced with 200 ⁇ 1 of Ham's F12 (plus 10% FCS) selective medium containing 70C ⁇ g/ml G418 (Gibco, Life Techologies, Grand Island, NY), 5mM of histidinol (Sigma-Aldrich, St Louis, MO) and lOmM of HEPES buffer (Corning Cellgro, Manassas, VA) and colonies were allowed to grow for up to 3 weeks.
- CHO-K1 cells transfected with plasmids 6307 pAH and 6714 pAN will continue to grow, while untransfected CHO-K1 cells will not grow. Every 2- 4 days for the next 14 to 21 days, the selective medium was replaced to remove debris of dead cells and colonies of resistant cells were allowed to grow in the selective medium.
- CHO-K1 culture supernatants from the 96-well plate(s) were collected and analyzed for antibody by enzyme-linked immunoassay (ELISA). Briefly, 100 of culture supernatants were added to Immulon 1 B-medium binding 96-well microtiter plate(s) (Thermo Scientific, Milford, MA) that had been coated with 1.25 ⁇ g/mL of TF-Ag-BSA conjugate in coating buffer (0.1 M Na2C03 at pH 9.6) and washed five times with TBS-brij (pH 7.2).
- Immulon 1 B-medium binding 96-well microtiter plate(s) (Thermo Scientific, Milford, MA) that had been coated with 1.25 ⁇ g/mL of TF-Ag-BSA conjugate in coating buffer (0.1 M Na2C03 at pH 9.6) and washed five times with TBS-brij (pH 7.2).
- anti-human IgG-Alkaline Phosphatase conjugate secondary antibody Sigma-Aldrich, St Louis, MO
- BSA-PBST buffer 1 dilution of
- phosphatase substrate p-nitrophenyl phosphate (pNPP)
- pNPP p-nitrophenyl phosphate
- HAM's F12 (plusl0% FCS) medium was used during the primary antibody incubation, followed by secondary antibody incubation and substrate incubation.
- Stable individual cell clones for each hJAA-F l l heavy and light chain combination from the best clone obtained above were generated through subcloning by limiting dilution. Briefly, cells were grown to confluence in a T75 tissue culture flask, harvested and counted and seeded at a 0.3 cell/well dilution in each well of 96-well plates in the selective medium. The plates were examined carefully 7 - 10 days later under a microscope and wells that showed a single focus of cells were marked and monitored until enough density of growth was seen. Supernatants from these marked wells were tested for anti-TF-Ag antibody by ELISA.
- the 4 clones that gave the highest absorbance readings were expanded as described above for obtaining the parental clones.
- the sub-clone that gave the highest absorbance was expanded and used for production of supernatant in T200 NuncTM cell culture Tripleflasks (Thermo Fisher Scientific, Inc.).
- JAA-F1 cells were cultured for 3 weeks before 1 liter of culture supernatant was harvested.
- the clone producing the chimeric JAA-Fl l was processed the same way as the humanized JAA-F1 1 variants.
- Protein A-Sepharose® 4B, Fast Flow affinity column (Sigma-Aldrich, St Louis, MO).
- Buffer A 0.02 M NaH2P04, 0.15 M NaCl, pH to 8.0
- Buffer A 20 column volumes (CV) of buffer A.
- One liter of CHO-K1 cell culture supernatant was centrifuged at 3500 rpm for 30 minutes to clear dead cells or debris and then filtered. The filtered supernatant was loaded onto the Protein A column and allowed to drip by gravity at a flow rate of 1 mL/min. The column was then washed with 10 CV of buffer A.
- the antibody was eluted from the protein A column using 3 CV of buffer B (0.2 M Na2HP04, 0.1 M Citric Acid, pH 3.9). The eluate was neutralized carefully with 0.1M NaOH to minimize the effect of low pH on the antibody.
- the Protein A column was re-equilibrated with 20-30 CV of buffer A and stored at 2-8oC. Each column was used up to five times for the same antibody.
- the purified antibody was dialyzed overnight at 4oC (Slide-A-Lyzer Dialysis Cassette; Thermo Scientific) against either; IX Phosphate Buffered Saline (PBS) or RPMI media with or without phenol red as required for subsequent assays.
- PBS IX Phosphate Buffered Saline
- RPMI media IX Phosphate Buffered Saline
- the antibody was filtered with a 0.22 ⁇ filter (Corning) and protein concentration determined by a Bio-Rad protein assay as detailed below.
- the antibody was stored at 4°C and checked for binding to TF-Ag using ELISA.
- the antibody concentration was determined using the Bio-Rad Protein Assay which is based on the Bradford dye-binding method. Briefly, the dye reagent was diluted with distilled water at 1 :4 ratio and filtered using Whatman filter paper #1. Serial dilutions of a known protein standard (1.44 mg/mL gamma globulin, Bio-Rad, Hercules, CA) and the humanized antibody sample were prepared using IX PBS buffer. 10 ⁇ , of each standard and sample solution were placed in triplicates into wells of a microtiter plate. Two hundred microliters of the diluted dye reagent was then added to all wells using a multichannel pipette and mixed thoroughly by pipetting up and down without creating bubbles. The plate was incubated at room temperature for at least 5 minutes to 1 hour. Absorbance was then read at 595 nm on the plate reader (Bio-Tek Instruments).
- the chemical specificity of the various hJAA-Fl 1 constructs and the chimeric JAA-F 11 was determined using the printed glycan array. This was compared to data obtained previously for mouse JAA-F 1 1.
- the glycan array is an indirect immunofluorescent method, described on the Consortium for Functional Glycomics website. Each construct was analyzed for reactivity with 610 different glycans. Briefly, the printed array was incubated successively with the antibody, washed, and incubated with secondary antibody labeled with FITC. After washing, the image was read in a Perkin Elmer Microscanarray XL4000 and a tiff file image stored and image analysis was performed using Imagene V.6 image analysis software. The relative binding of each binding glycan was expressed and normalized to the binding of the original glycan TF-Ag. Comparison and statistical analysis of the relative binding abilities were performed using ANOVA.
- the relative affinity binding of the hJAA-Fl l to TF-Ag was analyzed using a competitive inhibition ELISA with the mouse JAA-F 11 antibody and chimeric JAA-F 11 antibody. Briefly, 3 ⁇ g/mL hJAA-Fl l or chimeric JAA-F 11 was incubated in the presence of different concentrations of mouse JAA-F1 1 (10, 8, 6, 4, 2 ug/mL) on 1.25 ug/mL TF-Ag coated 96-well plates (Thermo Scientific, Milford, MA). Bound antibody was detected by incubation with anti-human IgG secondary antibody and substrate and absorbance reading was obtained as described in these materials and methods.
- the amount of mouse antibody required to inhibit the binding of 3 ⁇ g/mL humanized or chimeric antibodies by 50% was determined and compared.
- the relative affinity of each of the humanized antibodies and chimeric antibody was compared using ANOVA.
- Binding of hJAA-Fl l to various human breast tumor cell lines was analyzed using whole cell ELISA.
- the TF-Ag bearing mouse mammary tumor 4T1 cell line served as a positive control while the P3-X63-Ag8 Myeloma (ATCC Number: CRL-1580) cell line which was the fusion partner for producing JAA Fl l hybridoma served as the TF-antigen negative control.
- Positive binding was determined by comparing the reactivity of each antibody with each cell line to the reactivity of that antibody with the myeloma cell line using the student's T test. To standardize the data, binding to each cell line was expressed by dividing the absorbance reading of the test cell line by the absorbance reading of the myeloma cells.
- the 4T1 breast tumor and myeloma cell lines were harvested using a non- enzymatic Cellstripper (Mediatech, Inc. VA, USA). To prevent clumping of cells, media, buffer and reagents were pre-warmed before using. For adherent cells, the media was removed from the culture vessels and the cells were rinsed with IX Dulbecco's Phosphate Buffered Saline (DPBS) without calcium and magnesium (Mediatech Inc., Cellgro). Five milliliters of Cell Dissociation Solution was added to each flask and then incubated at 37°C for 10 minutes. The flasks were tapped to dislodge the cells.
- DPBS IX Dulbecco's Phosphate Buffered Saline
- the flasks were tapped well and the culture supernatant was centrifuged at 1000 x G for 10 mins.
- the cell pellets were resuspended in Cell Dissociation Solution and incubated at 37°C for 10 mins. After incubation, 20 mL of IX DPBS was added to the cells and pipetted repeatedly to remove clumps. The cell suspensions were then centrifuged at 1000 x G for 10 minutes. The supernatants were decanted and the pellets re-suspended in 5mL DPBS.
- the cells were counted using trypan blue stain and a hemocytometer. The cells were diluted to obtain 1 x 106 viable cells/ml.
- ADCC antibody - dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- ADCC was determined by the lactate dehydrogenase (LDH) release assay
- the PBMCs were prepared from whole blood by density gradient centrifugation using Ficoll-Paque.
- Whole blood collected in purple-top EDTA vacutainers was mixed with an equal volume of pre-warmed sterile DPBS.
- Twenty milliliters of diluted blood was then gently layered onto 15 mL of Ficoll-Paque Plus (GE Healthcare) in 50 mL conical tubes.
- the samples were centrifuged at 1300 rpm for 30-40min at room temperature with no brake.
- the PBMC layer was collected and sterile PBS was added to the PBMCs for a total volume of 40mL.
- the mixture was then centrifuged at 1000 rpm for lOmin at 18° to 22°C to remove any contaminating Ficoll and platelets/plasma proteins. The supernatant was discarded, the cells were resuspended in fresh sterile PBS, and the centrifugation step was repeated. The cells were resuspended in RPMI 1640 culture media (10% FCS) and counted using hemocytometer and trypan blue.
- Target cells (1 x 104; 30 ⁇ 1) and PBMCs (1 x 106; 30 ⁇ 1) were added into 96- well U-bottomed plates and incubated with hJAA-Fl l or chimeric antibodies (200 ⁇ g/mL; 30 ⁇ ) for 17 hours at 37°C in a tissue culture incubator. Forty-five minutes before completion of the 17 hours incubation, 10 ⁇ ⁇ of lysis solution (xlO) was added to the wells containing the target cell maximum LDH release control (target cells and medium) and the volume correction control (medium alone). At the end of incubation, the plate was centrifuged for 4 minutes at 1000 rpm.
- CDC was determined by the lactate dehydrogenase (LDH) release assay
- the antibodies used were dialyzed against phenol red free-RPMI media.
- 50 ⁇ of HCC 1428 cell suspension, 20 ⁇ of complement dilution (final dilution at 1 :20), and 30 ⁇ ⁇ of antibody (final concentration at 100 ⁇ g/ml) were mixed in each well in quadruplicate sets in a round-bottom 96-well culture plate. Included were control wells containing target cells and complement without antibody to control for any cytotoxicity mediated by the serum used as the complement source and the spontaneous release of LDH.
- the plate was centrifuged at 1000 rpm for 4 minutes and then incubated for 2 hours at 37°C with 5% carbon dioxide. Forty-five minutes before completion of the 2 hour incubation, 10 ⁇ ⁇ of lysis solution (xlO) was added to the wells containing the target cell maximum LDH release control and the volume correction control.
- the plate was centrifuged for 4 minutes at 1000 rpm.
- cytotoxicity (%) 100 x [(E - SE)] / [(M - SE)],
- the mouse 4T1 breast cancer cell line was tested for internalization of JAA- F l 1, hJAA-Fl 1 or chimeric JAA-F1 1.
- Five hundred thousand (5 x 105) cells were seeded in all six wells of a 6-well plate and were grown to confluence.
- two plates were prepared. Media was removed from each plate and 1 mL of antibody (200 ⁇ g/mL) was added to 3 wells of each plate, and 1 mL of PBS dilution was added to the remaining 3 wells.
- One set of plates was incubated at 37°C to allow internalization and the other plate was incubated at 4°C.
- 4T1 breast cancer cells were seeded on coverslips in the wells of two 6-well tissue culture plates at a density of 3 x 105 cells in 10% FCS RPMI 1640 media and incubated at 37°C and 5% C02 for 24 hours. Media was removed from the plates and 1.5 mL of test antibodies (5 ⁇ ⁇ ,) diluted in serum-free RPMI 1640 media was added to respective wells. Both plates were placed at 4°C for 20 minutes to allow for surface binding of antibodies. After the 20 minute incubation, the coverslips were transferred from one of the plates into a new 6-well plate.
- Antibody dilutions were removed from the second plate and pre-warmed serum- free RPMI 1640 media was added and the plate was incubated at 37°C for 1 hour in a tissue culture incubator.
- the coverslips from the first plate were washed twice with ice-cold 5%BSA/PBS, rinsed once with IX PBS and were then fixed with 4% paraformaldehyde solution (Affymetrix) for 15 min at room temperature. After the 1 hour incubation at 37°C, coverslips from the second plate were transferred to a new 6-well plate, washed, rinsed and fixed.
- Coverslips were then rinsed three times with IX PBS and incubated with anti-mouse IgG-Alexa 647 and anti-rabbit IgG Alexa 488 (mouse JAA-F1 1 coverslips) and anti-human IgG-Alexa 647 and anti-rabbit IgG Alexa 488 (chimeric and hJAA-Fl 1) secondary antibodies (Molecular Probes, Invitrogen), at a dilution of 1 :500 in 5% BSA/PBS. The anti-rabbit IgG Alexa 488 secondary antibody was used to detect the anti-LAMP 1 antibody. The coverslips were incubated for 1 hour at room temperature in the dark. Following incubation, cells were rinsed three times with IX PBS in the dark.
- Non-reacted water soluble Bolton Hunter reagent was removed by dialyzing against phosphate-buffered saline (PBS: 0.1 M sodium phosphate, 150 mM sodium chloride).
- PBS 0.1 M sodium phosphate, 150 mM sodium chloride.
- the humanized antibody contains a linker attached to some of the lysines of the antibody, and it is stable for 2 weeks.
- the modified hJAA-Fl l antibody was then labeled using the Chizzonite indirect labeling method [158]. Briefly, a Pierce pre-coated iodination tube (Thermo Fisher, Rockford, IL, USA) was prewetted with 1 mL of High Tris Iodination buffer (0.125 M Tris- HC1, pH 6.8, 0.15 M NaCl. The buffer was decanted and then 100 of HighTris Iodination Buffer was added directly to the bottom of the tube, followed by the addition of 280 of (4.59 milliCurie) of sodium 1241 iodide in 0.02 M NaOH solution (IBA Molecular, Richmond, VA).
- High Tris Iodination buffer (0.125 M Tris- HC1, pH 6.8, 0.15 M NaCl.
- the buffer was decanted and then 100 of HighTris Iodination Buffer was added directly to the bottom of the tube, followed by the addition of 280 of (4.59 milliCurie) of sodium 1241
- Tris/NaCl/EDTA buffer 25 mM Tris-HCl, pH 7.5, 0.4 M NaCl, 5 mM EDTA, 0.05% sodium azide
- the sample was then added to a 10 mL desalting column that has been pre-equilibrated with Tris/NaCl/EDTA buffer.
- the sample tube was washed with 0.5 mL Tris/NaCl/EDTA buffer and the wash added to the column.
- the sample was eluted in fifteen fractions of 500 ⁇ ⁇ each using Tris/NaCl/EDTA buffer, and was tested for radioactivity.
- Radiolabelling efficiency was determined on the fraction with the highest activity by high performance liquid chromatography (HPLC).
- HPLC high performance liquid chromatography
- the radiolabeled antibody was injected into the animals within 2 hours of labeling.
- a radioimmunoassay was also carried out.
- IACUC Institutional Animal Care and Use Committees
- mice were sacrificed by injecting 0.1 mL Sodium Pentobarbital (Fatal Plus) intraperitoneally at 72, 96, 168, and 192 hours after injection of the radiolabeled antibody.
- 0.1 mL Sodium Pentobarbital Fetal Plus
- three mice that received the labeled antibody and two mice with free iodine were sacrificed.
- Blood, muscle, spleen, lungs, kidneys, heart, liver, small and large intestines, stomach, brain, skin, tumor tissue, bone, tail, esophagus, thyroid and ovaries were harvested and placed into pre-weighed 5 ml polypropylene tubes. These tubes were re- weighed to obtain actual weight of each tissue/organ. All the tubes were capped and radioactivity was measured using a gamma counter. Radioactivity uptake for each tissue was calculated as the percentage of the injected dose per gram of tissue (%ID/g) as per the following formula as in Appendix 2.:
- a radioimmunoassay was performed.
- a microtiter plate was coated with 100 ⁇ ⁇ of 1.25 ⁇ TF-Ag-BSA conjugate in coating buffer.
- the buffer was removed from the wells and washed with 1%BSA/PBS-Tween.
- One hundred microliters of serial dilutions of radiolabeled hJAA-Fl 1 in 1%BSA/PBS-Tween were added to the wells and allowed to bind at room temperature for 1 hour. After incubation, the unbound antibody was removed by washing the wells with 1%BSA/PBS-Tween three times manually using a multi-channel pipette.
- the bound hJAA-Fl 1 was removed from the plate by incubating with 200 ⁇ ⁇ of 1M Acetic acid/0.15M NaCl buffer (pH 2.4) for 30 minutes at room temperature. After the incubation, 100 ⁇ ., solution from each well was added into separate polypropylene test tubes and the radioactivity was measured using a gamma counter.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112016024214A BR112016024214B8 (pt) | 2014-04-18 | 2015-04-20 | Anticorpo monoclonal parcialmente humanizado, composição farmacêutica e uso de um anticorpo monoclonal |
| ES15780559T ES2843546T3 (es) | 2014-04-18 | 2015-04-20 | Anticuerpos humanizados anti-antígeno-TF |
| EP20197413.6A EP3797793A1 (en) | 2014-04-18 | 2015-04-20 | Humanized anti-tf-antigen antibodies |
| RU2016143552A RU2699717C2 (ru) | 2014-04-18 | 2015-04-20 | Гуманизированные антитела к антигену Томсена-Фриденрайха |
| CA2943681A CA2943681C (en) | 2014-04-18 | 2015-04-20 | Humanized anti-tf-antigen antibodies |
| AU2015247358A AU2015247358B2 (en) | 2014-04-18 | 2015-04-20 | Humanized anti-TF-antigen antibodies |
| JP2016558558A JP6740135B2 (ja) | 2014-04-18 | 2015-04-20 | ヒト化抗−tf−抗原抗体 |
| MX2016013686A MX378944B (es) | 2014-04-18 | 2015-04-20 | Anticuerpos de antígeno anti-tf humanizado. |
| KR1020167031646A KR102413809B1 (ko) | 2014-04-18 | 2015-04-20 | 인간화 항-tf-항원 항체 |
| EP15780559.9A EP3131581B1 (en) | 2014-04-18 | 2015-04-20 | Humanized anti-tf-antigen antibodies |
| CN201580027114.8A CN106488774B (zh) | 2014-04-18 | 2015-04-20 | 人源化抗-tf-抗原抗体 |
| US15/296,411 US10023651B2 (en) | 2014-04-18 | 2016-10-18 | Humanized anti-TF-antigen antibodies |
| US15/976,500 US11130821B2 (en) | 2014-04-18 | 2018-05-10 | Humanized anti-TF-antigen antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201461981240P | 2014-04-18 | 2014-04-18 | |
| US61/981,240 | 2014-04-18 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/296,411 Continuation-In-Part US10023651B2 (en) | 2014-04-18 | 2016-10-18 | Humanized anti-TF-antigen antibodies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015161311A2 true WO2015161311A2 (en) | 2015-10-22 |
| WO2015161311A3 WO2015161311A3 (en) | 2015-12-10 |
Family
ID=54324717
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/026595 Ceased WO2015161311A2 (en) | 2014-04-18 | 2015-04-20 | Humanized anti-tf-antigen antibodies |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US11130821B2 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3131581B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP6740135B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR102413809B1 (cg-RX-API-DMAC7.html) |
| CN (1) | CN106488774B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2015247358B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112016024214B8 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2843546T3 (cg-RX-API-DMAC7.html) |
| MX (2) | MX378944B (cg-RX-API-DMAC7.html) |
| RU (1) | RU2699717C2 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2015161311A2 (cg-RX-API-DMAC7.html) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019060718A1 (en) * | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | SEPARATION OF LIGHT TRIPLE CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| WO2019231957A1 (en) * | 2018-05-30 | 2019-12-05 | National Health Research Institutes | Anti-abeta antibodies and uses thereof |
| JP2020516300A (ja) * | 2017-04-13 | 2020-06-11 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | 抗sirpアルファ抗体 |
| WO2020127369A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional molecule directed against human pd-1 |
| WO2020127366A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Humanized anti-human-pd-1 antibody |
| WO2020127373A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/sirpa molecule |
| WO2020127377A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/il-7 molecule |
| WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3094827A1 (en) * | 2018-03-28 | 2019-10-03 | Mitsubishi Tanabe Pharma Corporation | Drug conjugates of cmet monoclonal binding agents, and uses thereof |
| WO2021194942A1 (en) * | 2020-03-23 | 2021-09-30 | Bristol-Myers Squibb Company | Anti-ccr8 antibodies for treating cancer |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050260680A1 (en) | 2004-04-16 | 2005-11-24 | Vanderbilt University | Methods of diagnosing and treating autoimmune diseases |
| US20060018913A1 (en) | 2004-07-26 | 2006-01-26 | Kate Rittenhouse-Olson | Therapeutic use of anti-TF-Antigen antibody |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0510790D0 (en) * | 2005-05-26 | 2005-06-29 | Syngenta Crop Protection Ag | Anti-CD16 binding molecules |
| US20070286858A1 (en) * | 2006-03-21 | 2007-12-13 | Wyeth | Methods and Compositions for Antagonism of RAGE |
| EP2161031A1 (en) * | 2008-09-05 | 2010-03-10 | SuppreMol GmbH | Fc gamma receptor for the treatment of B cell mediated multiple sclerosis |
| NZ599971A (en) * | 2009-10-16 | 2014-12-24 | Servier Lab | Monoclonal antibodies to progastrin and their uses |
| EP2347769A1 (en) * | 2010-01-20 | 2011-07-27 | Glycotope GmbH | Cancer stem cell markers and uses thereof |
| EP2407487A1 (en) * | 2010-07-14 | 2012-01-18 | F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. | Multispecific modular antibody |
| WO2012143524A2 (en) | 2011-04-20 | 2012-10-26 | Genmab A/S | Bispecific antibodies against her2 and cd3 |
| KR20230143201A (ko) * | 2011-11-30 | 2023-10-11 | 추가이 세이야쿠 가부시키가이샤 | 면역 복합체를 형성하는 세포내로의 운반체(캐리어)를 포함하는 의약 |
| CN102796144A (zh) * | 2012-08-22 | 2012-11-28 | 山东大学 | Tf抗原及其类似物、和其化学酶法合成方法及其应用 |
| US10023651B2 (en) * | 2014-04-18 | 2018-07-17 | The Research Foundation For The State University Of New York | Humanized anti-TF-antigen antibodies |
-
2015
- 2015-04-20 WO PCT/US2015/026595 patent/WO2015161311A2/en not_active Ceased
- 2015-04-20 MX MX2016013686A patent/MX378944B/es unknown
- 2015-04-20 RU RU2016143552A patent/RU2699717C2/ru active
- 2015-04-20 AU AU2015247358A patent/AU2015247358B2/en active Active
- 2015-04-20 EP EP15780559.9A patent/EP3131581B1/en active Active
- 2015-04-20 ES ES15780559T patent/ES2843546T3/es active Active
- 2015-04-20 BR BR112016024214A patent/BR112016024214B8/pt active IP Right Grant
- 2015-04-20 KR KR1020167031646A patent/KR102413809B1/ko active Active
- 2015-04-20 CN CN201580027114.8A patent/CN106488774B/zh active Active
- 2015-04-20 JP JP2016558558A patent/JP6740135B2/ja active Active
- 2015-04-20 EP EP20197413.6A patent/EP3797793A1/en active Pending
-
2016
- 2016-10-18 MX MX2021000439A patent/MX2021000439A/es unknown
-
2018
- 2018-05-10 US US15/976,500 patent/US11130821B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050260680A1 (en) | 2004-04-16 | 2005-11-24 | Vanderbilt University | Methods of diagnosing and treating autoimmune diseases |
| US20060018913A1 (en) | 2004-07-26 | 2006-01-26 | Kate Rittenhouse-Olson | Therapeutic use of anti-TF-Antigen antibody |
Non-Patent Citations (5)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1980 |
| CHOTHIA C ET AL.: "The packing of variable domains", J. MOL. BIOL., vol. 186, 1989, pages 651 - 63, XP024011326, DOI: 10.1016/0022-2836(85)90137-8 |
| GAO ET AL.: "Monoclonal antibody humanness score and its applications", BMC BIOTECHNOLOGY, vol. 13, 2013, pages 55, XP021156542, DOI: 10.1186/1472-6750-13-55 |
| JONES ET AL.: "Replacing the complementarity-determining regions in a human antibody with those from a mouse", NATURE, vol. 321, 1986, pages 522 - 525, XP002949266, DOI: 10.1038/321522a0 |
| See also references of EP3131581A4 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2020516300A (ja) * | 2017-04-13 | 2020-06-11 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | 抗sirpアルファ抗体 |
| JP7160833B2 (ja) | 2017-04-13 | 2022-10-25 | サイロパ ビー.ブイ. | 抗sirpアルファ抗体 |
| WO2019060718A1 (en) * | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | SEPARATION OF LIGHT TRIPLE CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| CN112601550A (zh) * | 2018-05-30 | 2021-04-02 | 财团法人卫生研究院 | 抗-乙型淀粉样蛋白抗体及其用途 |
| WO2019231957A1 (en) * | 2018-05-30 | 2019-12-05 | National Health Research Institutes | Anti-abeta antibodies and uses thereof |
| CN112601550B (zh) * | 2018-05-30 | 2023-12-08 | 财团法人卫生研究院 | 抗-乙型淀粉样蛋白抗体及其用途 |
| US11084873B2 (en) | 2018-05-30 | 2021-08-10 | National Health Research Institutes | Anti-Abeta antibodies and uses thereof |
| WO2020127369A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional molecule directed against human pd-1 |
| WO2020127377A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/il-7 molecule |
| WO2020127373A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/sirpa molecule |
| WO2020127367A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Humanized anti-human-pd-1 antibody |
| EP4257199A2 (en) | 2018-12-21 | 2023-10-11 | Ose Immunotherapeutics | Humanized anti-human-pd-1 antibody |
| WO2020127366A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Humanized anti-human-pd-1 antibody |
| WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112016024214B1 (pt) | 2023-11-14 |
| KR20170010356A (ko) | 2017-01-31 |
| AU2015247358B2 (en) | 2020-02-27 |
| BR112016024214A2 (pt) | 2018-01-23 |
| RU2016143552A3 (cg-RX-API-DMAC7.html) | 2018-11-14 |
| EP3797793A1 (en) | 2021-03-31 |
| US11130821B2 (en) | 2021-09-28 |
| CN106488774A (zh) | 2017-03-08 |
| US20180258182A1 (en) | 2018-09-13 |
| ES2843546T3 (es) | 2021-07-19 |
| CA2943681A1 (en) | 2015-10-22 |
| WO2015161311A3 (en) | 2015-12-10 |
| AU2015247358A1 (en) | 2016-11-10 |
| KR102413809B1 (ko) | 2022-06-28 |
| EP3131581A4 (en) | 2018-02-21 |
| BR112016024214B8 (pt) | 2023-12-26 |
| CN106488774B (zh) | 2019-11-01 |
| RU2699717C2 (ru) | 2019-09-09 |
| JP6740135B2 (ja) | 2020-08-12 |
| JP2017518260A (ja) | 2017-07-06 |
| EP3131581A2 (en) | 2017-02-22 |
| EP3131581B1 (en) | 2020-09-23 |
| MX378944B (es) | 2025-03-10 |
| RU2016143552A (ru) | 2018-05-21 |
| MX2021000439A (es) | 2021-03-25 |
| MX2016013686A (es) | 2017-03-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11130821B2 (en) | Humanized anti-TF-antigen antibodies | |
| US20200010563A1 (en) | Anti-mcam antibodies and associated methods of use | |
| JP2022137018A (ja) | 特異的結合タンパク質およびこれらの使用 | |
| EP2351777B1 (en) | Anti-muc1 antibody | |
| JP7194985B2 (ja) | タウ認識抗体 | |
| JP7353187B2 (ja) | 抗l1-cam抗体およびその使用 | |
| KR20140102677A (ko) | in vivo 에서 항종양 활성을 갖는 항인간 TROP-2 항체 | |
| US20170129954A1 (en) | Use of Anti-MCAM Antibodies for Treatment or Prophylaxis of Giant Cell Arteritis, Polymyalgia Rheumatica or Takayasus Arteritis | |
| WO2017046774A2 (en) | Use of anti-mcam antibodies for treatment or prophylaxis of giant cell arteritis, polymyalgia rheumatica or takayasu's arteritis | |
| CN117999096A (zh) | 治疗神经学疾病的方法 | |
| AU2008255526A1 (en) | Humanized and chimeric anti-CD59 antibodies that mediate cancer cell cytotoxicity | |
| US10023651B2 (en) | Humanized anti-TF-antigen antibodies | |
| CA2943681C (en) | Humanized anti-tf-antigen antibodies | |
| HK40042631A (en) | Humanized anti-tf-antigen antibodies | |
| JP2020524527A (ja) | ヒト腫瘍幹細胞をターゲティングするモノクローナル抗体及びその使用 | |
| HK1233512B (en) | Humanized anti-tf-antigen antibodies | |
| US20170335004A1 (en) | Fn14-binding proteins and uses thereof | |
| US20100111851A1 (en) | Diagnosis and treatment of cancer by using anti-prg-3 antibody | |
| EP4635983A1 (en) | A novel antibody binding specifically to nptxr and use thereof | |
| JP2024540374A (ja) | がん胎児性抗原に対するモノクローナル抗体、及びそれらの使用 | |
| JP2018508193A (ja) | メディンを認識する抗体 | |
| EA047155B1 (ru) | Антитела, распознающие тау | |
| CN118451110A (zh) | 抗癌胚抗原的单克隆抗体及其用途 | |
| EA047896B1 (ru) | Антитела, распознающие тау | |
| EA047459B1 (ru) | Антитела, распознающие тау |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15780559 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2943681 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016558558 Country of ref document: JP Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015780559 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015780559 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/013686 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016024214 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2015247358 Country of ref document: AU Date of ref document: 20150420 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20167031646 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2016143552 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112016024214 Country of ref document: BR Kind code of ref document: A2 Effective date: 20161017 |