WO2014197624A1 - Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function - Google Patents

Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function Download PDF

Info

Publication number
WO2014197624A1
WO2014197624A1 PCT/US2014/040948 US2014040948W WO2014197624A1 WO 2014197624 A1 WO2014197624 A1 WO 2014197624A1 US 2014040948 W US2014040948 W US 2014040948W WO 2014197624 A1 WO2014197624 A1 WO 2014197624A1
Authority
WO
WIPO (PCT)
Prior art keywords
ac6mut
heart
cardiac
gene
nucleic acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/040948
Other languages
English (en)
French (fr)
Inventor
H. Kirk Hammond
Mei Hua Gao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California Berkeley
University of California San Diego UCSD
Original Assignee
University of California Berkeley
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2914029A priority Critical patent/CA2914029A1/en
Priority to KR1020167000315A priority patent/KR20160032090A/ko
Priority to RU2015155831A priority patent/RU2015155831A/ru
Priority to BR112015030355A priority patent/BR112015030355A8/pt
Priority to CN201480044190.5A priority patent/CN105452458A/zh
Priority to JP2016517971A priority patent/JP6571069B2/ja
Priority to EP14808138.3A priority patent/EP3004343B1/en
Priority to DK14808138.3T priority patent/DK3004343T3/en
Priority to US14/893,905 priority patent/US11040091B2/en
Priority to HK16111093.5A priority patent/HK1222884A1/zh
Application filed by University of California Berkeley, University of California San Diego UCSD filed Critical University of California Berkeley
Priority to AU2014274902A priority patent/AU2014274902B2/en
Publication of WO2014197624A1 publication Critical patent/WO2014197624A1/en
Priority to IL242885A priority patent/IL242885B/en
Anticipated expiration legal-status Critical
Priority to ZA2015/08942A priority patent/ZA201508942B/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/88Lyases (4.)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/51Lyases (4)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y406/00Phosphorus-oxygen lyases (4.6)
    • C12Y406/01Phosphorus-oxygen lyases (4.6.1)
    • C12Y406/01001Aodenylate cyclase (4.6.1.1)

Definitions

  • This invention relates generally to cellular and molecular biology, gene therapy and medicine; and more specifically, to compositions methods for treating a subject having or at risk of having heart failure or heart disease by administering a cyclic adenosine monophosphate-incompetent (cAMP-incompetent) adenylyl cyclase type 6 (AC6) protein or polypeptide (also called “an AC6mut”), or an AC6mut -encoding nucleic acid sequence.
  • cAMP-incompetent cyclic adenosine monophosphate-incompetent
  • AC6mut adenylyl cyclase type 6
  • Adenylyl cyclase a transmembrane protein in cardiac myocytes and other cells, is the key effector molecule that transduces p-adrenergic signaling by generation of intracellular cAMP.
  • Cyclic -AMP is the second messenger for downstream events including protein kinase A activation.
  • Heart failure is associated with impaired cAMP production, which is tightly linked to heart function. It has been shown that increased cardiac AC type 6 (AC6), a dominant AC isoform expressed in mammalian cardiac myocytes, has protean beneficial effects on the failing left ventricle (LV).
  • AC6 cardiac AC type 6
  • LV left ventricle
  • the invention provides methods for treating, ameliorating or protecting (preventing) an individual or a patient against heart disease or decreased cardiac function, comprising: providing a cyclic adenosine monophosphate- incompetent (cAMP-incompetent) adenylyl cyclase type 6 (AC6) protein or polypeptide (also called “an AC6mut"), or an AC6mut -encoding nucleic acid or a gene operatively linked to a transcriptional regulatory sequence; or an expression vehicle, a vector, a recombinant virus, or equivalent, having contained therein an AC6mut -encoding nucleic acid or gene, and the expression vehicle, vector, recombinant virus, or equivalent can express the an AC6mut -encoding nucleic acid or gene in a cell or in vivo; and administering or delivering the AC6mut, or the AC6mut-encoding nucleic acid or gene operatively linked to a transcriptional regulatory sequence, or the expression vehicle, vector, recomb
  • the AC6mut comprises an adenylyl cyclase (AC) polypeptide having a substitution of an uncharged or non-polar amino acid for a charged or an acidic amino acid in the catalytic core of the AC polypeptide.
  • AC adenylyl cyclase
  • the invention provides methods, and an in vivo method for or method of:
  • SR sarcoplasmic reticulum
  • a cyclic adenosine monophosphate-incompetent cAMP-incompetent
  • adenylyl cyclase type 6 AC6 protein or polypeptide
  • AC6mut is a recombinant, a synthetic, a peptidomimetic or an isolated AC6mut polypeptide or peptide; or
  • AC6mut-encoding nucleic acid or gene is operatively linked to a transcriptional regulatory sequence, wherein optionally the transcriptional regulatory sequence is a promoter and/or an enhancer, or a cardiac cell-specific promoter or a myocyte-specific promoter; or
  • AC6mut-encoding nucleic acid or gene is operatively linked to a transcriptional regulatory sequence, and optionally the
  • AC6mut-encoding nucleic acid or gene is contained in a delivery vehicle, a vector, an expression vector, a recombinant virus, or an equivalent, and the delivery vehicle, expression vehicle, vector, recombinant virus, or equivalent can express the AC6mut-encoding nucleic acid or gene in a cell or in vivo, wherein optionally the cell is a cardiac cell or a myocyte; wherein the AC6mut does not catalyze the breakdown of ATP to cAMP, or has impaired ability to catalyze the breakdown of ATP to cAMP, and optionally the impaired ability to catalyze the breakdown of ATP to cAMP is defined as the AC6mut having only about 1%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% of the ATP to cAMP catalytic activity of wild type AC6,
  • AC6mut expression in a cardiac myocyte increases sarcoplasmic reticulum Ca 2+ uptake
  • AC6mut expression in a cardiac myocyte reduces the EC50 for SERCA2a activation
  • AC6mut expression in a cardiac myocyte reduces expression of a phospholamban protein, ,
  • AC6mut-encoding nucleic acid is operatively linked to a transcriptional regulatory sequence, or optionally the delivery vehicle, vector, expression vector, recombinant virus, or equivalent, is delivered or administered to a cardiac myocyte cell, or to an individual or a patient in need thereof,
  • the delivering or administering of the AC6mut-encoding nucleic acid or gene to the cardiac cell or myocyte in vivo is a targeted delivery to a heart muscle or a cardiac myocyte, or comprises direct delivery or administration to a heart, or comprises an intracardiac injection or an infusion,
  • treating the subject having or at risk of having a heart disease or a heart failure treating, ameliorating or protecting (preventing) an individual or a patient against a heart disease, a heart failure, a decrease in heart function or cardiac output, a decrease in heart function or cardiac output due to a heart infection or a heart condition,
  • SR sarcoplasmic reticulum
  • heart failure patients or in individuals having a heart infection or a heart condition resulting in a decrease in heart function or cardiac output increasing heart function or cardiac output, reducing symptom and/or decreasing mortality.
  • the AC6mut comprises an adenylyl cyclase (AC) polypeptide having a substitution of an uncharged or non-polar amino acid for a charged or an acidic amino acid in the catalytic core of the AC polypeptide,
  • AC adenylyl cyclase
  • the uncharged or non-polar amino acid is an alanine (Ala), and optionally the acidic amino acid is an aspartic acid (Asp), or optionally the uncharged or non-polar amino acid is an Ala and the acidic amino acid is an Asp.
  • the AC6mut comprises:
  • AC murine adenylyl cyclase
  • a murine AC6mut polypeptide having a substitution of an alanine, or Ala for an
  • the AC6 is a mammalian AC6 polypeptide, or the AC6 is a human AC6 polypeptide.
  • the delivery vehicle, vector, expression vector, recombinant virus, or equivalent is or comprises: an adeno-associated virus (AAV); a recombinant AAV virus or vector; an AAV virion, or an adenovirus vector, or any pseudotype, hybrid or derivative thereof;
  • AAV adeno-associated virus
  • AAV virus or vector, AAV virion, or adenovirus vector is or comprises: an AAV serotype AAV5, AAV6, AAV7, AAV8 or AAV9; a rhesus macaque AAV (AAVrh), or an AAVrh 10; or any hybrid or derivative thereof;
  • the AC6mut -encoding nucleic acid or gene is operatively linked to a regulated or inducible transcriptional regulatory sequence
  • a disease, infection or condition responsive to an increased AC6mut level in vivo is a cardiac contractile dysfunction; a congestive heart failure (CHF); a cardiac fibrosis; a cardiac myocyte disease; a cardiac myocyte dysfunction or a cardiac myocyte apoptosis.
  • CHF congestive heart failure
  • the AC6mut -encoding nucleic acid or gene operatively linked to the transcriptional regulatory sequence; or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent, is administered or delivered to the individual or a patient in need thereof, by oral administration, by intramuscular (IM) injection, by intravenous (IV) injection, by subcutaneous (SC) injection, by intradermal injection, by intrathecal injection, by intra-arterial (IA) injection, by intracoronary or intracardiac injection, by intraocular injection or application, by inhalation, or by a biolistic particle delivery system, or by using a "gene gun", air pistol or a HELIOSTM gene gun (Bio-Rad Laboratories, Hercules, CA), wherein optionally the AC6mut -encoding nucleic acid or gene is delivered by intravenous (IV) injection of an AAV vector, or AAV-9 vector; or
  • the AC6mut -encoding nucleic acid or gene operatively linked to the transcriptional regulatory sequence; or the expression vehicle, vector, recombinant virus, or equivalent, is administered or delivered to the individual or a patient in need thereof, by introduction into any cell, organ, tissue or fluid space within the body that is adjacent to or is drained by the bloodstream, such that the encoded AC6mut protein may be secreted from cells in the tissue and released into the bloodstream.
  • the individual, patient or subject is administered a stimulus or signal that induces expression of the AC6mut -expressing nucleic acid or gene, or induces or activates a promoter (e.g., a promoter operably linked to the AC6mut -expressing nucleic acid or gene) that induces expression of or up-regulates expression of the AC6mut - expressing nucleic acid or gene;
  • a promoter e.g., a promoter operably linked to the AC6mut -expressing nucleic acid or gene
  • the individual, patient or subject is administered a stimulus or signal that induces synthesis of an activator of a promoter, wherein optionally the promoter is an AC gene promoter, or a myocyte cell-specific promoter;
  • the natural activator is an endogenous transcription factor
  • the synthetic activator is a zinc-finger DNA binding protein designed to specifically and selectively turn on an endogenous or exogenous target gene, wherein optionally the endogenous target is an AC6mut -expressing nucleic acid or gene or an activator of an AC6mut, or a AC6mut -expressing nucleic acid or gene, or an activator of a promoter operatively linked to a AC6mut -expressing nucleic acid or gene;
  • the individual, patient or subject is administered a stimulus or signal that stimulates or induces expression of a post-transcriptional activator of an AC6mut, or a AC6mut -expressing nucleic acid or gene, or an activator of a promoter operatively linked to a AC6mut -expressing nucleic acid or gene, or (g) the individual, patient or subject is administered a stimulus or signal that inhibits or induces inhibition of a transcriptional repressor or a post-transcriptional repressor of a AC6-expressing nucleic acid or gene.
  • the chemical or pharmaceutical that induces expression of the AC6mut, or the AC6mut -expressing nucleic acid or gene, or induces expression of the regulated or inducible promoter operatively linked to the AC6mut - expressing nucleic acid or gene is or comprises an oral antibiotic, a doxycycline or a rapamycin; or a tet-regulation system using doxycycline is used to induce expression of the AC6mut, or the AC6mut -expressing nucleic acid or gene, or an equivalent thereof.
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene, or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent is formulated in or as a lyophilate, a liquid, a gel, a hydrogel, a powder, a spray, an ointment, or an aqueous or a saline formulation.
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent comprises, or is formulated in, a vesicle, a hydrogel, a gel, a liposome, a nanoliposome, a nanoparticle or a nanolipid particle (NLP).
  • a vesicle a hydrogel, a gel, a liposome, a nanoliposome, a nanoparticle or a nanolipid particle (NLP).
  • NLP nanolipid particle
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent is formulated in an isolated or cultured cell, and optionally the cell is a mammalian cell, a cardiac cell, or a human cell, a non-human primate cell, a monkey cell, a mouse cell, a rat cell, a guinea pig cell, a rabbit cell, a hamster cell, a goat cell, a bovine cell, an equine cell, an ovine cell, a canine cell or a feline cell.
  • the cell is a mammalian cell, a cardiac cell, or a human cell, a non-human primate cell, a monkey cell, a mouse cell, a rat cell, a guinea pig cell, a rabbit cell, a hamster cell, a goat cell, a bovine cell, an equine cell, an ovine cell, a
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene, or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent is formulated as a pharmaceutical or sterile.
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent is formulated or delivered with, on, or in conjunction with a product of manufacture, an artificial organ or an implant.
  • the AC6mut, or the AC6mut -expressing nucleic acid or gene or the delivery vehicle, vector, expression vector, recombinant virus, or equivalent expresses a AC6mut polypeptide in vitro or ex vivo.
  • the invention provides methods for treating, ameliorating, reversing, protecting or preventing an individual or a patient against a AC6mut -responsive pathology, infection, disease, illness, or condition, comprising practicing a method of the invention.
  • the invention provides methods for treating, ameliorating, reversing, protecting or preventing a cardiopathy or a cardiovascular disease in an individual or a patient in need thereof, comprising practicing a method of the invention.
  • the cardiopathy or cardiovascular disease comprises: a coronary artery disease (CAD); an atherosclerosis; a thrombosis; a restenosis; a vasculitis, an autoimmune or a viral vasculitis; a polyarteritis nodosa; a Churg-Strass syndrome; a Takayasu's arteritis; a Kawasaki Disease; a Rickettsial vasculitis; an atherosclerotic aneurism; a myocardial hypertrophy; a congenital heart disease (CHD); an ischemic heart disease; an angina; an acquired valvular or an endocardial disease; a primary myocardial disease; a myocarditis; an arrhythmi
  • CHD congenital
  • the invention provides uses comprising:
  • an AC6mut an AC6mut -expressing nucleic acid or gene; a delivery vehicle, a vector, an expression vector, a recombinant virus, or equivalent; an adeno-associated virus (AAV); a recombinant AAV virus or vector; or an adenovirus vector, or any pseudotype, hybrid or derivative thereof, as set forth in any of claims 1 to 16,
  • the AAV or recombinant AAV virus or vector comprises an AAV serotype AAV5, AAV6, AAV7, AAV8 or AAV9; a rhesus macaque AAV
  • AAVrh or an AAVrhlO; or any hybrid or derivative thereof, or an AC6mut-expressing cell or cardiac myocyte,
  • a decrease in heart function or cardiac output a decrease in heart function or cardiac output due to a heart infection or a heart condition
  • CAD coronary artery disease
  • CAD coronary artery disease
  • thrombosis thrombosis
  • restenosis a vasculitis, an autoimmune or a viral vasculitis
  • a polyarteritis nodosa a Churg-Strass syndrome; a Takayasu's arteritis; a Kawasaki Disease; a Rickettsial vasculitis; an atherosclerotic aneurism
  • myocardial hypertrophy a congenital heart disease (CHD); an ischemic heart disease; an angina; an acquired valvular or an endocardial disease; a primary myocardial disease; a myocarditis; an arrhythmia; a transplant rejection; a metabolic myocardial disease; a myocardiomyopathy; a congestive, a hypertrophic or a restrictive cardiomyopathy; and/or, a heart transplant.
  • CHD congenital heart disease
  • a heart disease a heart failure, a decrease in heart function or cardiac output, a decrease in heart function or cardiac output due to a heart infection or a heart condition
  • CAD coronary artery disease
  • CAD coronary artery disease
  • thrombosis thrombosis
  • restenosis a vasculitis, an autoimmune or a viral vasculitis
  • a polyarteritis nodosa a Churg-Strass syndrome; a Takayasu's arteritis; a Kawasaki Disease; a Rickettsial vasculitis; an atherosclerotic aneurism
  • myocardial hypertrophy a congenital heart disease (CHD); an ischemic heart disease; an angina; an acquired valvular or an endocardial disease; a primary myocardial disease; a myocarditis; an arrhythmia; a transplant rejection; a metabolic myocardial disease; a myocardiomyopathy; a congestive, a hypertrophic or a restrictive cardiomyopathy; and/or, a heart transplant.
  • CHD congenital heart disease
  • Figure 1 illustrates the design, expression, activity and cellular distribution of the exemplary AC6mut of the invention:
  • Fig. IB graphically illustrates AC6mut mRNA expression as assessed by qRT-
  • Fig. 1C illustrates an immunoblot detecting AC6mut protein using anti-AC5/6 antibody and confirmed using anti-AUl tag antibody
  • Fig. ID graphically illustrates cyclic AMP production in isolated cardiac myocytes from AC6mut and control mice, before (Basal) and after stimulation with isoproterenol, as measured by cAMP Enzyme immunoassay;
  • Fig. IE illustrates a double immunofluorescence staining of AC6mut protein in cardiac myocytes isolated from AC6mut vs control mice using anti-AUl antibody (red); anti-caveolin 3 (Cav-3) antibody (green, for caveolae); anti-protein disulphide-isomerase (PDI) antibody (green, for sarcoplasmic reticulum); anti-lamin A antibody (green, for nuclear envelope), and anti-voltage dependent anion selective channel protein (VDAC) antibody (green, for mitochondria); Nucleus is blue;
  • FIG. 2 illustrates the activities and expression of PKA, PKS and PDE:
  • Fig. 2A Upper Graph graphically illustrates levels of PKA activity in isolated cardiac myocytes without stimulation (Basal) or stimulated with isoproterenol or NKH477; and Fig. 2A Lower illustration illustrates a gel immunoblot showing PKA protein in left ventricle (LV) homogenates;
  • Fig. 2B illustrates immunoblots showing the phosphorylation of key signaling proteins using left ventricular homogenates from AC6mut and control mice; shown are phospho (P) and Total (T) PKA regulatory subunits ⁇ - ⁇ and ⁇ - ⁇ , PKCa, phosphor- diesterase type 3A (PDE3A), phospho-troponin I (P22/23-TnI), and total Tnl;
  • Fig. 2C illustrates immunoblots showing the phosphorylation of RyR2, PLB and
  • Tnl before and after isoproterenol stimulation was assessed in cultured cardiac myocytes isolated from each group;
  • Fig. 2D graphically illustrates the data from Fig. 2C indicating that isoproterenol stimulation in AC6mut mice was associated with increased phosphorylation of RyR2, PLB, and Tnl in cardiac myocytes; data is normalized for loading (GAPDH);
  • FIG. 3 graphically illustrates Left Ventricular Contractile Function: isolated hearts from AC6mut TG mice (closed circles) showed preserved LV dP/dt in response to isoproterenol stimulation through a wide range of isoproterenol doses; open circles represent transgene negative control mice; as discussed in detail in Example 1, below.
  • Figure 4 illustrates SR Ca 2+ uptake, Ca 2+ signaling proteins, and transcriptional factors: Fig. 4A Upper graph, graphically illustrates Ca 2+ uptake activity in pooled LV samples from AC6mut and TG negative sibling control mice; and Fig. 4A Lower graph, graphically illustrates expression of AC6mut decreased SERCA2a affinity for Ca 2+ ;
  • Fig. 4B Upper graph graphically illustrates AC6mut expression was associated with decreased LV phospholamban (PLB) expression; and Fig. 4B Lower graph graphically illustrates AC6mut expression was associated with increased LV CREM-1 protein expression; and Fig. 4B lower illustration illustrates immunoblots of the gels showing protein levels; data is normalized for loading (GAPDH);
  • Fig. 4C Upper graph graphically illustrates AC6mut expression was associated with increased LV S100A1 protein expression; and Fig. 4C Lower graph graphically illustrates AC6mut expression was associated with increased LV P133-CREB protein expression; and Fig. 4C lower illustration illustrates immunoblots of the gels showing protein levels; data is normalized for loading (GAPDH);
  • Fig. 4D illustrates immunoblots of the gels showing AC6mut expression did not affect LV expression of SERCA2a, calreticulin, calsequestrin or phospho-S 16-PLB proteins;
  • Fig. 4E illustrates a double immunofluorescence staining of AC6mut protein in isolated cardiac myocytes from AC6mut and control mice using anti-AUl antibody (red) and anti-CREM-1 antibody (green) or anti-AUl and anti-phospho-CREB (S 133, green); nucleus was showing in blue;
  • FIG. 5 illustrates cytosolic Ca 2+ transients in isolated cardiac myocytes from AC6mut and control mice:
  • Fig. 5A graphically illustrates data showing that basal Ca 2+ released (systolic- diastolic Ca 2+ ) showed no group difference between AC6mut and control;
  • Fig. 5B graphically illustrates data showing that representative Indo-1 Ca 2+ transient recordings in cardiac myocytes stimulated with isoproterenol were higher in cardiac myocytes from AC6mut mice; summary data are displayed in Fig. 5C;
  • Fig. 5C graphically illustrates data showing that Ca 2+ released in the presence of isoproterenol was increased in cardiac myocytes from AC6mut mice;
  • Fig. 5D graphically illustrates data showing that time-to-peak Ca 2+ transient in the presence of isoproterenol was decreased in cardiac myocytes from AC6mut mice
  • Fig. 5E graphically illustrates data showing that time to 50% relaxation (tau) in the presence of isoproterenol was decreased in cardiac myocytes from AC6mut mice; as discussed in detail in Example 1, below.
  • compositions and in vivo and ex vivo methods comprising administration of a cyclic adenosine monophosphate-incompetent (cAMP-incompetent) adenylyl cyclase type 6 (AC6) protein or polypeptide (also called “an AC6mut”), or an AC6mut-encoding nucleic acid or a gene to treat, ameliorate or protect (as a preventative or a prophylaxis) individuals with a heart disease, a decreased cardiac function or output, or a heart infection or a condition responsive to decreased cAMP, increased sarcoplasmic reticulum (SR) Ca 2+ uptake and/or increased Ca 2+ transients with reduced time of relaxation in intact cardiac myocytes in vivo.
  • cAMP-incompetent cyclic adenosine monophosphate-incompetent
  • AC6mut adenylyl cyclase type 6
  • AC6mut AC6mut-encoding nucleic acid or a
  • the invention provides an AC6mut that inhibits or substantially reduces amounts of, or does not catalyze generation of, intracellular cAMP.
  • the AC6mut of the invention alters intracellular signaling in a manner that 1) enhances calcium handling in intact cardiac myocytes, 2) inhibits generation of intracellular cAMP levels in cardiac myocytes, and 3) protects cardiac myocytes from programmed cell death (apoptosis).
  • the AC6mut when the AC6mut is expressed in or delivered to the failing hearts of patients, heart function increases, symptoms are reduced, and mortality decreases. Therefore, delivery of the AC6mut of the invention to the heart increases cardiac function with no deleterious effects due to cAMP generation.
  • the invention provides an ideal therapy for heart failure and decrease heart function.
  • the invention provides compositions and methods for the delivery and expression (e.g., a controlled expression) of an AC6mut-encoding nucleic acid or gene, or an expression vehicle (e.g., vector, recombinant virus, and the like) comprising (having contained therein) an AC6mut-encoding nucleic acid or gene, that results in an AC6mut protein selectively expressed in a cardiac myocyte, or only delivered to cardiac myocytes, or alternatively, released into the bloodstream or general circulation where it can have a beneficial effect on in the body, e.g., such as the heart in the case of treating cardiovascular disease.
  • an expression vehicle e.g., vector, recombinant virus, and the like
  • the invention provides delivery vehicles, vectors, expression vectors, recombinant viruses and the like for in vivo expression of an AC6mut -encoding nucleic acid or gene to practice the methods of this invention.
  • the delivery vehicles, vectors, expression vectors, recombinant viruses and the like expressing the AC6mut or the AC6mut nucleic acid or gene can be delivered by intramuscular (IM) injection, direct injection into the heart, by intravenous (IV) injection, by subcutaneous injection, by inhalation, by a biolistic particle delivery system (e.g., a so- called "gene gun"), and the like, e.g., as an outpatient, e.g., during an office visit.
  • IM intramuscular
  • IV intravenous
  • a biolistic particle delivery system e.g., a so- called "gene gun”
  • AC6mut -encoding nucleic acids or genes are targeted to myocytes, cardiac myocytes or delivered directly to cardiac myocytes for directed cAMP- incompetent AC expression, or expression directly in the target heart organ.
  • delivery vehicles such as e.g., liposomes
  • vectors, expression vectors, recombinant viruses and the like carrying them as a "payload” are targeted to myocytes, cardiac myocytes or delivered directly to cardiac myocytes for directed cAMP- incompetent AC expression, or expression directly in the target heart organ.
  • this "peripheral" mode of delivery e.g., delivery vehicles, vectors, expression vectors, recombinant viruses and the like, are injected IM or rv, can circumvent problems encountered when genes or nucleic acids are expressed directly in an organ (e.g., the heart, lung or kidney) itself.
  • an organ e.g., the heart, lung or kidney
  • Sustained secretion of a desired AC6mut protein(s), or delivery vehicles, vectors, expression vectors, recombinant viruses and the like, in the bloodstream or general circulation also circumvents the difficulties and expense of administering proteins, delivery vehicles, vectors, expression vectors, recombinant viruses and the like, by infusion, which can be particularly problematic for many proteins, delivery vehicles, vectors, expression vectors, recombinant viruses and the like, which exhibit very short half lives in the body.
  • the invention provides methods for being able to turn on and turn off AC6mut -expressing nucleic acid or gene expression easily and efficiently for tailored treatments and insurance of optimal safety.
  • the AC6mut protein or proteins expressed by the AC6mut-expressing nucleic acid(s) or gene(s) have a beneficial or favorable effects (e.g., therapeutic or prophylactic) on a tissue or an organ, e.g., the heart, blood vessels, lungs, kidneys, or other targets, even though secreted into the blood or general circulation at a distance (e.g., anatomically remote) from their site or sites of action.
  • a beneficial or favorable effects e.g., therapeutic or prophylactic
  • a tissue or an organ e.g., the heart, blood vessels, lungs, kidneys, or other targets, even though secreted into the blood or general circulation at a distance (e.g., anatomically remote) from their site or sites of action.
  • AC6mut -expressing nucleic acids or genes encoding cAMP-incompetent AC are used to practice methods of this invention, including but not limited to, e.g., treating a heart disease, a heart failure, a congestive heart failure (CHF), any decrease in cardiac output or function, or any combination thereof.
  • CHF congestive heart failure
  • delivery vehicles, vectors, expression vectors, recombinant viruses and the like can be injected, e.g., in a systemic vein (e.g., IV), or by intramuscular (IM) injection, by inhalation, or by a biolistic particle delivery system (e.g., a so-called "gene gun"), e.g., as an outpatient, e.g., in a physician's office.
  • a systemic vein e.g., IV
  • IM intramuscular
  • a biolistic particle delivery system e.g., a so-called "gene gun”
  • days or weeks later e.g., four weeks later
  • the individual, patient or subject is administered (e.g., inhales, is injected or swallows), a chemical or pharmaceutical that induces expression of the AC6mut -expressing nucleic acids or genes; for example, an oral antibiotic (e.g., doxycycline or rapamycin) is administered once daily (or more or less often), which will activate the expression of the gene.
  • a chemical or pharmaceutical that induces expression of the AC6mut -expressing nucleic acids or genes
  • an oral antibiotic e.g., doxycycline or rapamycin
  • an AC6mut protein is synthesized and released into the subject's circulation (e.g., into the blood), and subsequently has favorable physiological effects, e.g., therapeutic or prophylactic, that benefit the individual or patient (e.g., benefit heart function).
  • physiological effects e.g., therapeutic or prophylactic, that benefit the individual or patient (e.g., benefit heart function).
  • the physician or subject desires discontinuation of the treatment the subject simply stops taking the activating chemical or pharmaceutical, e.g., antibiotic.
  • applications of the present invention include: the treatment of severe, low ejection fraction heart failure; the treatment of pulmonary hypertension; the treatment of heart failure with preserved ejection fraction; replacement of current therapies that require hospitalization and sustained intravenous infusions of vasoactive peptides for the treatment of a pulmonary hypertension and heart failure; and, the treatment of other conditions in which controlled expression of an AC6mut or an AC6mut nucleic acid or gene to promote favorable effects in the body.
  • the invention provides isolated, synthetic and/or recombinant nucleic acids or genes encoding AC6mut polypeptides.
  • the invention provides AC6mut -expressing nucleic acids or genes in recombinant form in an (e.g., spliced into) an expression vehicle for in vivo expression, e.g., in a vector, e.g., an AAV, or any pseudotype, hybrid or derivative thereof, or a recombinant virus.
  • a mammalian, e.g., human or murine, AC6mut can be used to practice this invention, wherein the AC6mut comprises an adenylyl cyclase (AC) polypeptide having a substitution of an uncharged or non-polar amino acid for a charged or an acidic amino acid in the catalytic core of the AC polypeptide.
  • the catalytic core also called the catalytic region 1 (CI)
  • the catalytic core of murine AC6 polypeptide is from amino acid residue 315 to 683.
  • the uncharged or non-polar amino acid is an alanine
  • the acidic amino acid is an aspartic acid (Asp), or optionally the uncharged or non-polar amino acid is an Ala and the acidic amino acid is an Asp.
  • the SEQ ID NO: 17 polypeptide differs from the SEQ ID NO: 12 polypeptide in that the SEQ ID NO: 17 polypeptide is missing the first ten amino acids of the SEQ ID NO: 12 polypeptide; otherwise the polypeptides are identical.
  • the isoform lacking the amino terminal is believed to be the wild type murine polypeptide, with the first ten amino acids of SEQ ID NO: l 1 and SEQ ID NO: 12 being untranslated.
  • Human AC6 nucleic acid coding sequence (SEQ ID NO: 14) vs murine coding sequence: 86% homology (SEQ ID NO: 15).
  • Human AC6 polypeptide (SEQ ID NO: 10) vs murine AC6 polypeptide (SEQ ID NO: 11) at amino acid levels: 94% homology.
  • AC6mut D A substitution is in the exact same relative structural position in the catalytic core of the human AC6mut as the murine AC6mut, as illustrated below (showing the wild type still having the aspartic acid, or "D" residue, as underlined below:
  • Murine 549 YLKEQCIETFLILGASQKRKEEKAMLAKLQRTPANSMEGLMPRWVPDPAFSRTKDSKAFR 608
  • Murine 669 YSRKVDPRFGAYVACALLVFCFICFIQLLVFPYSTLILGIYAAIFLLLLVTVLICAVCSC 728 Human 721 GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIAN FTCNHTPIRSCAARMLNLT 780
  • Murine 909 ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF 968
  • Murine 1149 YQLECRGWKVKGKGEMTTYFLNGGPSS 1176 (SEQ ID Ol l l)
  • both the human ACmut nucleic acid coding sequence (SEQ ID NO: 13) and the murine ACmut nucleic acid coding sequence (SEQ ID NO: 12) were made by changing an adenosine (or "A") to a cytosine (or "C"), as indicated below, where the "A" residue before its change to "C” is underlined, below; i.e., illustrated below is the wild type human AC6 (SEQ ID NO: 10) and wild type murine AC6 (SEQ ID NO: l l):
  • Murine 90 CCTCCCAGCAGC ⁇
  • Murine 150 ACAGCTTGGGGGGAACGCAATGGGCAGAAGCG—C-CCACGCCACGCGAATCGAGCCAGT 206
  • Murine 1404 CCCGAGGCCCGGGCAGATCACGCCCACTGCTGTGTGGAGATGGGGGTAGACATGATCGAA 1463
  • Murine 3140 CGAGATCATCAGTGAGGAGAGATTCCGGCAGTTGGAGAAGATCAAGACCATCGGTAGCAC 3199
  • Murine 3380 CATTGGGGCCCGAAAGCCACAGTATGACATCTGGGGAAATACCGTGAATGTTTCCAGTCG 3439
  • Murine 3440 TATGGACAGCACTGGAGTTCCTGACCGAATACAGGTGACTACGGACCTATACCAGGTTCT 3499
  • nucleic acids of the invention are made, isolated and/or manipulated by, e.g., cloning and expression of cDNA libraries, amplification of message or genomic DNA by PCR, and the like.
  • the nucleic acids and genes used to practice this invention including DNA, RNA, iRNA, antisense nucleic acid, cDNA, genomic DNA, vectors, viruses or hybrids thereof, can be isolated from a variety of
  • Recombinant polypeptides e.g., cAMP-incompetent AC chimeric proteins used to practice this invention
  • Recombinant polypeptides generated from these nucleic acids can be individually isolated or cloned and tested for a desired activity.
  • Any recombinant expression system can be used, including e.g. bacterial, fungal, mammalian, yeast, insect or plant cell expression systems
  • nucleic acids used to practice this invention can be synthesized in vitro by well-known chemical synthesis techniques, as described in, e.g., Adams (1983) J. Am. Chem. Soc. 105:661; Belousov (1997) Nucleic Acids Res. 25:3440-3444; Frenkel (1995) Free Radic. Biol. Med. 19:373-380; Blommers (1994) Biochemistry 33 :7886-
  • nucleic acids used to practice this invention, such as, e.g., subcloning, labeling probes (e.g., random-primer labeling using Klenow polymerase, nick translation, amplification), sequencing, hybridization and the like are known in the art.
  • labeling probes e.g., random-primer labeling using Klenow polymerase, nick translation, amplification
  • sequencing hybridization and the like are known in the like.
  • MOLECULAR CLONING A LABORATORY MANUAL (2ND ED.), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); CURRENT PROTOCOLS ⁇ MOLECULAR BIOLOGY, Ausubel, ed. John Wiley & Sons, Inc., New York (1997); LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY:
  • Another useful means of obtaining and manipulating nucleic acids used to practice the methods of the invention is to clone from genomic samples, and, if desired, screen and re-clone inserts isolated or amplified from, e.g., genomic clones or cDNA clones.
  • Sources of nucleic acid used in the methods of the invention include genomic or cDNA libraries contained in, e.g., mammalian artificial chromosomes (MACs), see, e.g., U.S. Patent Nos. 5,721, 118; 6,025,155; human artificial chromosomes, see, e.g., Rosenfeld (1997) Nat. Genet.
  • MACs mammalian artificial chromosomes
  • yeast artificial chromosomes YAC
  • bacterial artificial chromosomes BAC
  • P I artificial chromosomes see, e.g., Woon (1998) Genomics 50:306-316
  • P l-derived vectors PACs
  • cosmids recombinant viruses, phages or plasmids.
  • AC6mut fusion proteins and nucleic acids encoding them are used. Any AC6mut polypeptide can be used to practice this invention.
  • the AC6mut protein can be fused to a heterologous peptide or polypeptide, such as a peptide for targeting the polypeptide to a desired cell type, such a cardiac myocyte.
  • a heterologous peptide or polypeptide joined or fused to a protein used to practice this invention can be an N-terminal identification peptide which imparts a desired characteristic, such as fluorescent detection, increased stability and/or simplified purification.
  • Peptides and polypeptides used to practice this invention can also be synthesized and expressed as fusion proteins with one or more additional domains linked thereto for, e.g., producing a more immunogenic peptide, to more readily isolate a recombinantly synthesized peptide, to identify and isolate antibodies and antibody-expressing B cells, and the like.
  • Detection and purification facilitating domains include, e.g., metal chelating peptides such as polyhistidine tracts and histidine- tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Immunex Corp, Seattle WA).
  • metal chelating peptides such as polyhistidine tracts and histidine- tryptophan modules that allow purification on immobilized metals
  • protein A domains that allow purification on immobilized immunoglobulin
  • the domain utilized in the FLAGS extension/affinity purification system Immunex Corp, Seattle WA.
  • the inclusion of a cleavable linker sequences such as Factor Xa or enterokinase (Invitrogen, San Diego CA) between a purification domain and the motif-comprising peptide or polypeptide to facilitate purification.
  • an expression vector can include an epitope-encoding nucleic acid sequence linked to six histidine residues followed by a thioredoxin and an enterokinase cleavage site (see e.g., Williams (1995) Biochemistry 34: 1787-1797; Dobeli (1998) Protein Expr. Purif. 12:404-414).
  • the histidine residues facilitate detection and purification while the enterokinase cleavage site provides a means for purifying the epitope from the remainder of the fusion protein.
  • Technology pertaining to vectors encoding fusion proteins and application of fusion proteins are well described in the scientific and patent literature, see e.g., Kroll (1993) DNA Cell. Biol, 12:441-53.
  • nucleic acids or nucleic acid sequences used to practice this invention e.g.,
  • AC6mut-encoding nucleic acids can be an oligonucleotide, nucleotide, polynucleotide, or to a fragment of any of these, to DNA or RNA of genomic or synthetic origin which may be single-stranded or double-stranded and may represent a sense or antisense strand, to peptide nucleic acid (PNA), or to any DNA-like or RNA-like material, natural or synthetic in origin.
  • PNA peptide nucleic acid
  • nucleic acids or “nucleic acid sequences” including oligonucleotide, nucleotide, polynucleotide, or any fragment of any of these; and include DNA or RNA (e.g., mRNA, rRNA, tRNA, iRNA) of genomic or synthetic origin which may be single-stranded or double-stranded; and can be a sense or antisense strand, or a peptide nucleic acid (PNA), or any DNA-like or RNA- like material, natural or synthetic in origin, including, e.g., iRNA, ribonucleoproteins (e.g., e.g., double stranded iRNAs, e.g., iRNPs).
  • DNA or RNA e.g., mRNA, rRNA, tRNA, iRNA
  • PNA peptide nucleic acid
  • nucleic acids i.e., oligonucleotides, containing known analogues of natural nucleotides.
  • Compounds use to practice this invention include nucleic-acid-like structures with synthetic backbones, see e.g., Mata (1997) Toxicol. Appl. Pharmacol. 144: 189-197; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Strauss-Soukup (1997) Biochemistry 36:
  • Antisense Nucleic Acid Drug Dev 6 153-156.
  • Compounds use to practice this invention include "oligonucleotides” including a single stranded polydeoxynucleotide or two complementary polydeoxynucleotide strands that may be chemically synthesized.
  • compounds used to practice this invention include synthetic oligonucleotides having no 5' phosphate, and thus will not ligate to another oligonucleotide without adding a phosphate with an ATP in the presence of a kinase.
  • a synthetic oligonucleotide can ligate to a fragment that has not been dephosphorylated.
  • compounds used to practice this invention include genes or any segment of DNA involved in producing an AC6mut polypeptide; it can include regions preceding and following the coding region (leader and trailer) as well as, where applicable, intervening sequences (introns) between individual coding segments (exons).
  • operably linked can refer to a functional relationship between two or more nucleic acid (e.g., DNA) segments. In alternative aspects, it can refer to the functional relationship of transcriptional regulatory sequence to a transcribed sequence.
  • a promoter can be operably linked to a coding sequence, such as a nucleic acid used to practice this invention, if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.
  • promoter transcriptional regulatory sequences can be operably linked to a transcribed sequence where they can be physically contiguous to the transcribed sequence, i.e., they can be exacting.
  • transcriptional regulatory sequences, such as enhancers need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
  • the invention comprises use of "expression cassettes" comprising a nucleotide sequences used to practice this invention, which can be capable of affecting expression of the nucleic acid, e.g., a structural gene or a transcript (e.g., encoding AC6mut protein) in a host compatible with such sequences.
  • Expression cassettes can include at least a promoter operably linked with the polypeptide coding sequence or inhibitory sequence; and, in one aspect, with other sequences, e.g., transcription termination signals. Additional factors necessary or helpful in effecting expression may also be used, e.g., enhancers.
  • expression cassettes used to practice this invention also include plasmids, expression vectors, recombinant viruses, any form of recombinant "naked DNA" vector, and the like.
  • a "vector" used to practice this invention can comprise a nucleic acid that can infect, transfect, transiently or permanently transduce a cell.
  • a vector used to practice this invention can be a naked nucleic acid, or a nucleic acid complexed with protein or lipid.
  • vectors used to practice this invention can comprise viral or bacterial nucleic acids and/or proteins, and/or membranes (e.g., a cell membrane, a viral lipid envelope, etc.).
  • vectors used to practice this invention can include, but are not limited to replicons (e.g., RNA replicons, bacteriophages) to which fragments of DNA may be attached and become replicated.
  • Vectors thus include, but are not limited to RNA, autonomous self-replicating circular or linear DNA or RNA (e.g., plasmids, viruses, and the like, see, e.g., U.S. Patent No. 5,217,879), and can include both the expression and non-expression plasmids.
  • the vector used to practice this invention can be stably replicated by the cells during mitosis as an autonomous structure, or can be incorporated within the host's genome.
  • promoters used to practice this invention include all sequences capable of driving transcription of a coding sequence in a cell, e.g., a mammalian cell such as a heart, lung, muscle, nerve or brain cell.
  • promoters used in the constructs of the invention include cz ' s-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene.
  • a promoter used to practice this invention can be a cz ' s-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5' and 3 ' untranslated regions, or an intronic sequence, which are involved in transcriptional regulation.
  • These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) transcription.
  • “constitutive” promoters used to practice this invention can be those that drive expression continuously under most environmental conditions and states of development or cell differentiation.
  • “Inducible” or “regulatable” promoters used to practice this invention can direct expression of the nucleic acid of the invention under the influence of environmental conditions, administered chemical agents, or developmental conditions.
  • Adenovirus Vector and Adeno-associated virus (AAV) delivery are examples of Adenovirus Vector and Adeno-associated virus (AAV) delivery.
  • delivery vehicles, vectors, expression vectors, recombinant viruses, or equivalent are or comprise: an adeno-associated virus (AAV); a recombinant AAV virus, vector or virion; or, an adenovirus vector.
  • AAV adeno-associated virus
  • the AAV, recombinant AAV virus or vector, or adenovirus vector is or comprises: an AAV serotype AAV5, AAV6, AAV7, AAV8 or AAV9; a rhesus macaque AAV (AAVrh), or an AAVrhlO; or any pseudotype, hybrid or derivative thereof.
  • any of these vectors is tropic for, or is designed for specific delivery to, a particular cell, tissue or organ.
  • an AAV used to practice the invention or any vector or delivery vehicle used to practice the invention
  • is tropic or has tropism
  • an AAV used to practice the invention is tropic for, or is designed for specific delivery another tissue or organ, for example, the liver.
  • this "peripheral" mode of delivery e.g., delivery vehicles, vectors, recombinant viruses and the like, are injected IM or IV, can circumvent problems encountered when genes or nucleic acids are expressed directly in an organ (e.g., the heart, lung or kidney) itself.
  • an organ e.g., the heart, lung or kidney
  • AAV5, AAV6, and AAV9 have been found to be tropic for the heart, see e.g., Fang et al., Hum Gene Ther Methods 2012 Oct 17; Zincarelli, et al, Clin Transl Sci. 2010 Jun;3(3):81-9.
  • Adeno-associated virus (AAV) used to practice the invention can be any nonpathogenic member of the Parvoviridae family of small, non-enveloped, single-stranded DNA animal viruses.
  • AAV require helper virus (e.g., adenovirus) for replication and, thus, AAVs used to practice the invention do not replicate upon administration to a subject.
  • helper virus e.g., adenovirus
  • AAV can infect a relatively wide range of cell types and stimulate only a mild immune response, particularly as compared to a number of other viruses, such as adenovirus.
  • AAV serotypes used to practice this invention include, e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV1 1, and AAV12.
  • AAV used to practice the invention can be from other animals, including: e.g., birds (e.g., avian AAV, or AAAV), bovines (e.g., bovine AAV, or BAAV), canines, equines, ovines, and porcines.
  • AAV vectors used to practice the invention are recombinant nucleic acid molecules in which at least a portion of the AAV genome is replaced by a heterologous nucleic acid molecule; one can replace about 4.7 kilobases (kb) of AAV genome DNA, e.g., by removing the viral replication and capsid genes.
  • the heterologous nucleic acid molecule is simply flanked by AAV inverted terminal repeats (ITRs) on each terminus.
  • ITRs serve as origins of replication and contain cis acting elements required for rescue, integration, excision from cloning vectors, and packaging.
  • AAVs used to practice the invention comprise a promoter operatively linked to the heterologous nucleic acid molecule to control expression.
  • An AAV vector can be packaged into an AAV capsid in vitro with the assistance of a helper virus or helper functions expressed in cells to yield an AAV virion.
  • the serotype and cell tropism of an AAV virion are conferred by the nature of the viral capsid proteins.
  • AAV vectors and AAV virions can transduce cells efficiently, including both dividing and non-dividing cells.
  • AAV vectors and virions have been shown to be safe and to lead to long term in vivo persistence and expression in a variety of cell types.
  • an ITR joined to 5' terminus of the AC6mut-encoding nucleic acid molecule and an ITR joined to the 3' terminus of the AC6mut-encoding nucleic acid molecule.
  • ITRs include, but are not limited, to AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAAV, BAAV, and other AAV ITRs known to those skilled in the art.
  • an AAV ITR is selected from an AAV2 ITR, an AAV5 ITR, an AAV6 ITR, and a BAAV ITR.
  • an AAV ITR is an AAV2 ITR.
  • an AAV ITR is an AAV5 ITR. In one embodiment, an AAV ITR is an AAV6 ITR. In one embodiment, an AAV ITR is a BAAV ITR.
  • AAV vectors used to practice the invention comprise other sequences, such as expression control sequences, e.g., a promoter, an enhancer, a repressor, a ribosome binding site, an RNA splice site, a polyadenylation site, a transcriptional terminator sequence, and a microRNA binding site.
  • expression control sequences e.g., a promoter, an enhancer, a repressor, a ribosome binding site, an RNA splice site, a polyadenylation site, a transcriptional terminator sequence, and a microRNA binding site.
  • promoters include, but are not limited to, an AAV promoter, such as a p5, pl9 or p40 promoter, an adenovirus promoter, such as an adenoviral major later promoter, a cytomegalovirus (CMV) promoter, a papilloma virus promoter, a polyoma virus promoter, a respiratory syncytial virus (RSV) promoter, a sarcoma virus promoter, an SV40 promoter, other viral promoters, an actin promoter, an amylase promoter, an immunoglobulin promoter, a kallikrein promoter, a metallothionein promoter, a heat shock promoter, an endogenous promoter, a promoter regulated by rapamycin or other small molecules, other cellular promoters, and other promoters known to those skilled in the art.
  • the promoter is an AAV promoter.
  • the promoter is a CMV promoter.
  • AAV vectors of different serotypes are used, e.g.,: an AAV1 vector, an AAV2 vector, an AAV3 vector, an AAV4 vector, an AAV5 vector, an AAV6 vector, an AAV7 vector, an AAV8 vector, an AAV9 vector, an AAV 10 vector, an AAV11 vector, an AAV 12 vector, an AAAV vector, and a BAAV vector.
  • the AAV vector is an AAV2 vector, an AAV5 vector, an AAV6 vector or a BAAV vector.
  • chimeric, shuffled or capsid-modified AAV derivatives are used to provide one or more desired functionalities for the viral vector.
  • these derivatives may display increased efficiency of gene delivery, decreased immunogenicity (humoral or cellular), an altered tropism range and/or improved targeting of a particular cell type compared to an AAV viral vector comprising a naturally occurring AAV genome.
  • increased efficiency of gene delivery is achieved by improved receptor or co-receptor binding at the cell surface, improved internalization, improved trafficking within the cell and into the nucleus, improved uncoating of the viral particle and/or improved conversion of a single-stranded genome to double-stranded form.
  • an altered tropism range or targeting of a specific cell population results in increased efficiency, such that the vector dose is not diluted by administration to tissues where it is not needed.
  • capsid-free AAV vectors are used as described e.g., in U.S. patent app. No. 20140107186.
  • AAV9 vectors that are heart- or liver-tropic are used as described e.g., in U.S. patent app. No. 20140056854.
  • AAV vectors are described in e.g., in U.S. patent app. Nos. 20130310443; 20130136729, are used to practice the invention.
  • AAV vectors are pseudotyped for e.g., improved or altered performance, e.g., to improve or alter the tropism or other features of the virus, as described e.g., in U.S. patent app. No 20120220492.
  • specific or improved targeting allows the delivery vehicle (e.g., the AAV viral particle) to infect and deliver the therapeutic nucleic acid (e.g., an AC6mut) only to those cells intended to be infected, thus decreasing the risk of unwanted side effects from gene therapy and increasing the efficacy of the gene therapy.
  • dosages of the viral vector are determined by factors such as the condition being treated, the age, weight and health of the patient, and may thus vary among patients.
  • a therapeutically effective human dosage of a viral vector is generally in the range of from about 0.1 ml to about 100 ml of solution containing concentrations of from about 1 xlO 9 to 1 xlO 16 genomes virus vector.
  • An exemplary human dosage for delivery to large organs may be about 5 x 10 , to 5 x 10 AAV genomes per 1 kg, at a volume of about 1 to 100 niL.
  • the dosages are adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
  • the levels of expression of the trans gene can be monitored to determine the frequency of dosage resulting in viral vectors, e.g., AAV vectors.
  • the invention provides compositions and methods for delivering and expressing AC6mut in vivo in a cardiac myocyte cell.
  • these compositions comprise AC6mut -encoding nucleic acids formulated for these purposes, e.g., expression vehicles or AC6mut -encoding nucleic acids formulated in a buffer, in a saline solution, in a powder, an emulsion, in a vesicle, in a liposome, in a nanoparticle, in a nanolipoparticle and the like.
  • compositions can be formulated in any way and can be applied in a variety of concentrations and forms depending on the desired in vivo or ex vivo conditions, including a desired in vivo or ex vivo method of administration and the like. Details on techniques for in vivo or ex vivo formulations and administrations are well described in the scientific and patent literature.
  • Formulations and/or carriers of the AC6mut -encoding nucleic acids used to practice this invention are well known in the art.
  • Formulations and/or carriers used to practice this invention can be in forms such as tablets, pills, powders, capsules, liquids, gels, syrups, slurries, suspensions, etc., suitable for in vivo or ex vivo applications.
  • AC6mut -encoding nucleic acids used to practice this invention can be in admixture with an aqueous and/or buffer solution or as an aqueous and/or buffered suspension, e.g., including a suspending agent, such as sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia, and dispersing or wetting agents such as a naturally occurring phosphatide (e.g., lecithin), a condensation product of an alkylene oxide with a fatty acid (e.g., polyoxyethylene stearate), a condensation product of ethylene oxide with a long chain aliphatic alcohol (e.g., heptadecaethylene oxycetanol), a condensation product of ethylene oxide with a partial ester derived from a fatty acid and a hexitol (e.g., polyoxyethylene sorbito)
  • the aqueous suspension can also contain one or more preservatives such as ethyl or n-propyl p-hydroxybenzoate.
  • preservatives such as ethyl or n-propyl p-hydroxybenzoate.
  • Formulations can be adjusted for osmolarity, e.g., by use of an appropriate buffer.
  • the compounds (e.g., formulations) of the invention can comprise a solution of AC6mut -encoding nucleic acids or genes dissolved in a pharmaceutically acceptable carrier, e.g., acceptable vehicles and solvents that can be employed include water and Ringer's solution, an isotonic sodium chloride.
  • a pharmaceutically acceptable carrier e.g., acceptable vehicles and solvents that can be employed include water and Ringer's solution, an isotonic sodium chloride.
  • sterile fixed oils can be employed as a solvent or suspending medium.
  • any fixed oil can be employed including synthetic mono- or diglycerides, or fatty acids such as oleic acid.
  • solutions and formulations used to practice the invention are sterile and can be manufactured to be generally free of undesirable matter. In one embodiment, these solutions and formulations are sterilized by conventional, well known sterilization techniques.
  • solutions and formulations used to practice the invention can comprise auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents, e.g., sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
  • concentration of active agent e.g., AC6mut -encoding nucleic acids or genes
  • concentration of active agent can vary widely, and can be selected primarily based on fluid volumes, viscosities and the like, in accordance with the particular mode of in vivo or ex vivo administration selected and the desired results, e.g., increasing in vivo AC6mut expression.
  • solutions and formulations used to practice the invention can be lyophilized; for example, the invention provides a stable lyophilized formulation comprising AC6mut -encoding nucleic acids or genes.
  • this formulation is made by lyophilizing a solution comprising AC6mut -encoding nucleic acid or gene and a bulking agent, e.g., mannitol, trehalose, raffinose, and sucrose or mixtures thereof.
  • a process for preparing a stable lyophilized formulation can include lyophilizing a solution about 2.5 mg/mL protein, about 15 mg/mL sucrose, about 19 mg/mL NaCl, and a sodium citrate buffer having a pH greater than 5.5 but less than 6.5. See, e.g., U.S. patent app. no.
  • compositions and formulations of the invention can be delivered by the use of liposomes (see also discussion, below).
  • liposomes particularly where the liposome surface carries ligands specific for target cells, e.g., cardiac myocytes, or are otherwise preferentially directed to a specific tissue or organ type, e.g., a heart, one can focus the delivery of the active agent into a target cell, e.g., a cardiac myocyte, in an in vivo or ex vivo application.
  • target cells e.g., a cardiac myocytes
  • the invention also provides nanoparticles, nanolipoparticles, vesicles and liposomal membranes comprising compounds (e.g., AC6mut or AC6mut -encoding nucleic acids or genes) used to practice the methods of this invention, e.g., to deliver AC6mut or AC6mut -encoding nucleic acids or genes to cardiac myocyte cells in vivo or ex vivo.
  • these compositions are designed to target specific molecules, including biologic molecules, such as polypeptides, including cell surface polypeptides, e.g., for targeting a desired cell type, e.g., a mammalian cardiac cell, a cardiac myocyte and the like.
  • the invention provides multilayered liposomes comprising compounds used to practice this invention, e.g., as described in Park, et al., U.S. Pat. Pub. No. 20070082042.
  • the multilayered liposomes can be prepared using a mixture of oil-phase components comprising squalane, sterols, ceramides, neutral lipids or oils, fatty acids and lecithins, to about 200 to 5000 nm in particle size, e.g., to entrap a cAMP-incompetent AC-encoding nucleic acid or gene.
  • Liposomes can be made using any method, e.g., as described in Park, et al, U.S.
  • Pat. Pub. No. 20070042031 including method of producing a liposome by encapsulating an active agent (e.g., AC6mut -encoding nucleic acids or genes), the method comprising providing an aqueous solution in a first reservoir; providing an organic lipid solution in a second reservoir, and then mixing the aqueous solution with the organic lipid solution in a first mixing region to produce a liposome solution, where the organic lipid solution mixes with the aqueous solution to substantially instantaneously produce a liposome encapsulating the active agent; and immediately then mixing the liposome solution with a buffer solution to produce a diluted liposome solution.
  • an active agent e.g., AC6mut -encoding nucleic acids or genes
  • liposome compositions used to practice this invention comprise a substituted ammonium and/or polyanions, e.g., for targeting delivery of a compound (e.g., AC6mut -encoding nucleic acids or genes) used to practice this invention to a desired cell type, as described e.g., in U.S. Pat. Pub. No. 20070110798.
  • the invention also provides nanoparticles comprising compounds (e.g., AC6mut - encoding nucleic acids or genes) used to practice this invention in the form of active agent-containing nanoparticles (e.g., a secondary nanoparticle), as described, e.g., in U.S. Pat. Pub. No. 20070077286.
  • the invention provides nanoparticles comprising a fat-soluble active agent of this invention or a fat-solubilized water-soluble active agent to act with a bivalent or trivalent metal salt.
  • solid lipid suspensions can be used to formulate and to deliver AC6mut -encoding nucleic acids or genes used to practice the invention to a mammalian cell in vivo or ex vivo, as described, e.g., in U.S. Pat. Pub. No. 20050136121. Delivery vehicles
  • any delivery vehicle can be used to practice the methods or compositions of this invention, e.g., to deliver AC6mut or AC6mut -encoding nucleic acids or genes to practice the methods of the invention in vivo or ex vivo.
  • delivery vehicles comprising polycations, cationic polymers and/or cationic peptides, such as polyethyleneimine derivatives, can be used e.g. as described, e.g., in U.S. Pat. Pub. No. 20060083737.
  • a dried polypeptide-surfactant complex is used to formulate a composition of the invention, wherein a surfactant is associated with a nucleic acid via a non-covalent bond e.g. as described, e.g., in U.S. Pat. Pub. No. 20040151766.
  • a nucleic acid used to practice this invention can be applied to cells as polymeric hydrogels or water-soluble copolymers, e.g., as described in U.S. Patent No. 7,413,739; for example, a nucleic acid can be polymerized through a reaction between a strong nucleophile and a conjugated unsaturated bond or a conjugated unsaturated group, by nucleophilic addition, wherein each precursor component comprises at least two strong nucleophiles or at least two conjugated unsaturated bonds or conjugated unsaturated groups.
  • a nucleic acid is applied to cells using vehicles with cell membrane-permeant peptide conjugates, e.g., as described in U.S. Patent Nos. 7,306,783; 6,589,503.
  • the nucleic acid itself is conjugated to a cell membrane- permeant peptide.
  • a nucleic acid and/or the delivery vehicle are conjugated to a transport-mediating peptide, e.g., as described in U.S. Patent No. 5,846,743, describing transport-mediating peptides that are highly basic and bind to polyphosphoinositides.
  • electro-permeabilization is used as a primary or adjunctive means to deliver AC6mut -encoding nucleic acids or genes to a cell, e.g., using any electroporation system as described e.g. in U.S. Patent Nos. 7, 109,034; 6,261,815;
  • the methods of the invention also comprise implanting or engrafting cells, e.g., cardiac or cardiac myocyte cells, comprising or expressing AC6mut -encoding nucleic acids or genes used to practice the invention; and in one aspect, methods of the invention comprise implanting or engrafting the AC6mut - encoding nucleic acids or genes (or cells expressing them) in a vessel, tissue or organ ex vivo or in vivo, e.g., a heart or a cardiac myocyte, or implanting or engrafting the re- programmed differentiated cell in an individual in need thereof.
  • implanting or engrafting cells e.g., cardiac or cardiac myocyte cells, comprising or expressing AC6mut -encoding nucleic acids or genes used to practice the invention
  • methods of the invention comprise implanting or engrafting the AC6mut - encoding nucleic acids or genes (or cells expressing them) in a vessel, tissue or organ ex vivo or in vivo, e.g
  • Cells can be removed from an individual, treated using the compositions and/or methods of this invention, and reinserted (e.g., injected or engrafted) into a tissue, organ or into the individual, using any known technique or protocol.
  • dedifferentiated re-programmed cells, stem cells, or re-programmed differentiated cells can be re-implanted (e.g., injected or engrafted) using e.g., microspheres e.g., as described in U.S. Pat. No.
  • the cell carrier comprises a bulking agent comprising round and smooth polymethylmethacrylate microparticles preloaded within a mixing and delivery system and an autologous carrier comprising these cells.
  • the cells are re-administered to a tissue, an organ, e.g., a heart, and/or to an individual in need thereof in a biocompatible crosslinked matrix, as described e.g., in U.S. Pat. App. Pub. No. 20050027070.
  • the cells of the invention are re-administered (e.g., injected or engrafted) to a tissue, an organ and/or an individual in need thereof within, or protected by, a biocompatible, nonimmunogenic coating, e.g., as on the surface of a synthetic implant, e.g., as described in U.S. Pat. No. 6,969,400, describing e.g., a protocol where AC6mut can be conjugated to a polyethylene glycol that has been modified to contain multiple nucleophilic groups, such as primary amino or thiol group.
  • the cells of the invention are re-administered (e.g., injected or engrafted) to a tissue, an organ and/or an individual in need thereof using grafting methods as described e.g. by U.S. Pat. Nos. 7,442,390; 5,733,542.
  • any method for delivering polypeptides, nucleic acids and/or cells to a tissue or organ can be used, and these protocols are well known in the art, e.g., as described in U.S. Patent No. (USPN) 7,514,401, describing e.g., using intracoronary (IC), intravenous (IV), and/or local delivery (direct myocardial injection) of polypeptides, nucleic acids and/or cells to a heart in situ.
  • IC intracoronary
  • IV intravenous
  • local delivery direct myocardial injection
  • aerosol drug particles into the lungs and into the bloodstream can be used for delivering polypeptides, nucleic acids and/or cells to a tissue or organ (e.g., a lung, kidney, heart).
  • nucleic acids and/or cells can be given through a catheter into the coronary arteries or by direct injection into the left atrium or ventricular myocardium via a limited thoracotomy; or delivered into the myocardium via a catheter passed during cardiac catheterization; or delivered into the pericardial space.
  • nucleic acids used to practice this invention or a vector comprising a nucleic acid used to practice the invention (e.g., an adeno virus- associated virus or vector (AAV), or an adenoviral gene therapy vector), or a vesicle, liposome, nanoparticle or nanolipid particle (NLP) of the invention, and the like, to a tissue or organ (e.g., a lung, kidney, heart); e.g. as described in USPN 7,501,486.
  • AAV adeno virus- associated virus or vector
  • NLP nanoparticle or nanolipid particle
  • compositions used to practice this invention can be used in combination with other therapeutic agents, e.g. angiogenic agents, anti-thrombotic agents, antiinflammatory agents, immunosuppressive agents, anti-arrhythmic agents, tumor necrosis factor inhibitors, endothelin inhibitors, angiotensin-converting enzyme inhibitors, calcium antagonists, antibiotic agents, antiviral agents and viral vectors.
  • therapeutic agents e.g. angiogenic agents, anti-thrombotic agents, antiinflammatory agents, immunosuppressive agents, anti-arrhythmic agents, tumor necrosis factor inhibitors, endothelin inhibitors, angiotensin-converting enzyme inhibitors, calcium antagonists, antibiotic agents, antiviral agents and viral vectors.
  • Compositions used to practice this invention can be used for ameliorating or treating any of a variety of cardiopathies and cardiovascular diseases, e.g., cardiopathies and cardiovascular diseases, e.g., coronary artery disease (CAD); atherosclerosis;
  • CAD coronary artery disease
  • atherosclerosis CAD
  • vasculitis including autoimmune and viral vasculitis such as polyarteritis nodosa, Churg-Strass syndrome, Takayasu's arteritis, Kawasaki Disease and Rickettsial vasculitis; atherosclerotic aneurisms; myocardial hypertrophy; congenital heart diseases (CHD); ischemic heart disease and anginas; acquired valvular/endocardial diseases; primary myocardial diseases including myocarditis; arrhythmias; and transplant rejections; metabolic myocardial diseases and myocardiomyopathies such as congestive, hypertrophic and restrictive cardiomyopathies, and/or heart transplants.
  • CHD congenital heart diseases
  • ischemic heart disease and anginas acquired valvular/endocardial diseases
  • primary myocardial diseases including myocarditis; arrhythmias; and transplant rejections
  • metabolic myocardial diseases and myocardiomyopathies such as congestive
  • kits comprising compositions and methods of the invention, including instructions for use thereof.
  • cells, delivery vehicles, vectors, expression vectors, recombinant viruses and the like, of the invention can also be provided.
  • kits comprising compositions comprising (a) AC6mut -encoding nucleic acid, (b) delivery vehicles, vectors, expression vectors, recombinant viruses and the like, of the invention, (c) a liquid or aqueous formulation of the invention, or (d) the vesicle, liposome, nanoparticle or nanolipid particle of the invention.
  • the kit further comprising instructions for practicing any methods of the invention, e.g., in vitro or ex vivo methods for delivering a desired AC6mut or AC6mut-expressing nucleic acid, vector, and the like, to a cardiac myocyte cell.
  • AC6 mutant adenylyl cyclase type 6 (AC6) polypeptide, the so-called "AC6 mutant", or "AC6mut”.
  • Cardiac myocytes of these AC6mut transgenic mice showed impaired cAMP production in response to isoproterenol (74% reduction; p ⁇ 0.001), but LV size and function were normal. Isolated hearts showed preserved LV function in response to isoproterenol stimulation.
  • AC6mut expression was associated with increased sarcoplasmic reticulum Ca 2+ uptake and the EC50 for SERCA2a activation was reduced.
  • AC6mut catalytically inactive murine AC6 mutant
  • AC6mut Transgenic Mice (Fig. 1A). The use of animals was in accordance with Association for Assessment and Accreditation of Laboratory Animal Care guidelines and was approved by the Institutional Animal Care and Use Committee of VA San Diego Healthcare System.
  • To generate mice with cardiac-directed expression of AC6mut the murine AC6mut cDNA [4] with an AU1 tag at the C-terminus, was subcloned between the a-myosin heavy chain promoter and SV40 polyA.
  • a 9.2-kb fragment containing the expression cassette was used for pronuclear injection, carried out in the transgenic mouse facility at University of California, San Diego (inbred C57BL/6). Founder mice were identified by polymerase chain reaction (PCR) of genomic DNA prepared from tail tips.
  • PCR polymerase chain reaction
  • the AC6mut gene was detected using a primer homologous to the a-MHC promoter (forward: 5' CACATAGAAGCCTAGCCCACACC) (SEQ ID NO: l); the reverse primer was for the AC6 region (5' CAGGAGGCCACTAAACCATGAC) (SEQ ID NO:2).
  • AC6mut mRNA was detected using the following primers: (forward: 5'
  • TGGGCCTCTCTACTCTGCAT (SEQ ID NO:3); reverse: 5'
  • Endogenous AC6 mRNA was detected using primers homologous to its 3'- untranslated region (forward: 5' GGCATTGAGTGGGACTTTGT (SEQ ID NO:5); reverse: 5' TCTGCATCCAAACAAACGAA) (SEQ ID NO:6). This 3 ' untranslated region was not present in the AC6mut cDNA, enabling quantification of endogenous AC6.
  • Founder animals were crossbred with wild-type mice of the same strain, and selected animals were used for analysis of cardiac transgene expression. We documented variable transgene expression in independent lines and selected a line with a 17-fold increase in AC6mut protein expression (vs endogenous AC6) for our studies. LV expression levels of AC types 2 - 9 were determined using quantitative RT-PCR as previously described [5].
  • Echocardiography Anesthesia was induced with 5% isoflurane (at a flow rate of 1 L/min oxygen) and maintained with 1% isoflurane in oxygen. Images were obtained using a 16L MHz linear probe and Sonos 5500 ® Echocardiograph system (Philips Medical Systems, Bothell, WA), as previously reported [7]. Data were acquired and analyzed without knowledge of group identity.
  • Isolated Perfused Hearts LV Contractile Function. Cardiac function was assessed in isolated perfused hearts to assess LV contractile function in a manner unaffected by reflex activation or anesthesia, as previously reported [7]. An intraventricular balloon catheter was deployed to measure isovolumic LV pressure (LV end-diastolic pressure 10 mmHg; 1.7 mM ionized Ca 2+ ). Isoproterenol was delivered in bolus doses (from 0.1 nM to 300 nM) at five-minute intervals as LV pressure was recorded. Subsequently, the first derivative of the LV pressure (LV dP/dt) was derived and used as a surrogate of LV contractile function. Data were acquired and analyzed without knowledge of group identity.
  • Cytosolic calcium transients were measured using Indo-1, as described previously [19]. Cardiac myocytes were plated onto laminin-coated glass cover slips and loaded with indo-l/AM (3 ⁇ , Calbiochem, La Jolla CA) and dispersing agent, pluronic F-127 (0.02 mg/ml, Calbiochem, La Jolla CA) for 30 min. Following dye loading, cover slips were mounted in a superfusion chamber, rinsed to remove excess indo-l/AM, and mounted on a Nikon DIAPHOTTM epifluorescence microscope equipped with a 40x objective interfaced to a Photon Technologies photometry system
  • the ratio F405/F485 represents a measure for [Ca 2+ ]i.
  • cardiac myocytes were superfused with 25 mM HEPES (pH 7.3) containing 2 mM CaC3 ⁇ 4. Myocytes were field- stimulated at 0.3 Hz.
  • Isoproterenol-stimulated Ca 2+ transient was determined by adding isoproterenol (10 ⁇ ) to the buffer. Calcium transients were recorded from at least 20 cells per heart and for at least 3 hearts per group. Diastolic and systolic intracellular Ca 2+ levels were obtained from the basal and maximal F405/F485 ratio per cycle, respectively.
  • Cardiac Myocyte Isolation Cardiac Myocyte Isolation. Cardiac myocyte isolation was performed as previously described [4].
  • Cyclic AMP Measurement. Isolated cardiac myocytes were stimulated with isoproterenol (10 ⁇ , 10 min) or the water-soluble forskolin analog NKH477 (10 ⁇ , 10 min), and then lysed (2.5% dodecyltrimethylammonium bromide, 0.05 M sodium acetate, pH 5.8, and 0.02% bovine serum albumin). Cyclic AMP was measured using the cAMP BIOTRAKTM enzyme immunoassay system (GE Healthcare, Pittsburgh,
  • isoproterenol (10 ⁇ , 10 min) or KH477 (10 ⁇ , 10 min).
  • Cardiac myocytes were homogenized in buffer A: 20 mM Tris-HCl (pH 7.4), 0.5 mM EGTA, 0.5 mM EDTA, and protease inhibitor cocktail from Invitrogen) and centrifuged (14,000 x , 5 min, 4°C). The supernatant was incubated with PKA biotinylated peptide substrate (SignaTECT ® (SIGNATECT ® ) cAMP -Dependent Protein Kinase Assay System (Promega, Madison WI)) in the presence of [ ⁇ - 32 ⁇ ] ⁇ . The 32 P-labeled, biotinylated substrate was recovered with a streptavidin matrix, and the specific activity of PKA determined.
  • Isoproterenol-Stimulated Phosphorylation of Ryanodine Receptor-2, PLB, and Troponin I in Cardiac Myocytes To determine dynamic phosphorylation of key Ca 2+ regulating proteins, we conducted studies of basal and isoproterenol-stimulated phosphorylation of RyR2, PLB and Tnl in cultured cardiac myocytes isolated from each group (Fig. 2C). Cultured cardiac myocytes (100,000 cells per well) were used in these studies and immunoblotting performed before and after incubation with isoproterenol (10 ⁇ , 10 min).
  • Cells were lysed in lysis buffer: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM Na2EDTA, 1 mM EGTA, 1% Triton, 2.5 mM sodium pyrophosphate, 1 mM ⁇ - glycerophosphate, 1 mM Na3V04, 1 ⁇ g/ml leupeptin). Protein concentration was measured using the Bradford method. Immunoblots were normalized to GAPDH and compared (Fig. 2D).
  • PDE Activity Assay Phosphodiesterase activity was assayed using the Cyclic Nucleotide Phosphodiesterase Assay Kit (Enzo). LV tissues were homogenized in buffer containing 10 mM Tris-HCl (pH 7.4), 1 mM PMSF, 10 mM activated orthovanadate, lx protease inhibitor cocktail (Life Sciences) and centrifuged at 10,000 rpm (10 min) in a microfuge. Tissue homogenates were desalted by gel filtration using Desalting Column Resin (Enzo). Twenty ⁇ g of protein (Bradford) was added to each well and PDE activity measured.
  • Enzo Cyclic Nucleotide Phosphodiesterase Assay Kit
  • 2-well chamber slides for 1 hr washed, fixed (10% formalin, 15 min, 23 °C), blocked with normal goat serum (1 hr) and incubated (4°C, overnight) with: anti-AUl antibody (Fitzgerald, 1 :300; for detecting AC6mut transgene protein); anti-Cav3 antibody (BD Pharmagen, 1 : 100; for detecting caveolae); anti-PDI antibody (Invitrogen, 1 : 1000; for detecting SR); anti-lamin A (Abeam, 1 :200; for detecting nuclear envelope); anti-CREM- 1 antibody (Santa Cruz, 1 :50); or anti-phospho-CREB antibody (Upstate, 1 : 100).
  • anti-AUl antibody Fitzgerald, 1 :300; for detecting AC6mut transgene protein
  • anti-Cav3 antibody BD Pharmagen, 1 : 100; for detecting caveolae
  • anti-PDI antibody Invitrogen, 1 : 1000; for detecting
  • Cardiac myocytes were washed with PBS and then incubated with secondary antibodies (Alexia Fluo 488 or 594 conjugated, 1 : 1000 dilution) for 1 hr. To identify the nucleus, cells were incubated with Hoechst dye (1 : 1000 dilution, 20 min). Cardiac myocytes then were imaged as previously described [2].
  • secondary antibodies Alexia Fluo 488 or 594 conjugated, 1 : 1000 dilution
  • RT-qPCR Quantitative reverse transcription polymerase chain reaction
  • the anti-AC5/6 antibody to identify endogenous AC6 and AC6mut (Santa Cruz, 1 :200 dilution).
  • the epitope for the AC5/6 antibody is at the C-terminus of AC6 and AC6mut (sequence: KGYQLECRGVVKVKGKGEMTT YFLNGGP S S (SEQ ID NO:9); protein accession #043306 and #Q01234).
  • calreticulin ABR Affinity, 1 : 1,000
  • calsequestrin Novus Biologicals, 1 : 1,000
  • GAPDH Fitzgerald, 1 :20,000
  • PDE3A Advanced
  • PKA catalytic subunit BD Transduction, 1 : 1,000
  • p-PKA catalytic subunit Cell Signaling, 1 : 1,000
  • PKA-RIIa and PKA-RII BD Transduction, 1 : 1,000
  • phospho-PKA-RIIa S96
  • phospho-PKA-RII SI 14
  • PKCa catalytic subunit Santa Cruz, 1 :200
  • PLB Affinity
  • Bioreagents 1 :5,000); phospho S16-PLB (Badrilla, 1 :3,000 dilution); phospho-RyR2 (S2808) (Abeam, 1 : 1,000); S 100A1 (Epiyomics, 1 : 1,000); SERCA2a (Enzo, 1 : 1,000); troponin I and phospho-Tnl (S22/23) (Cell Signaling, 1 : 1,000 each)
  • AC6mut Transgenic Mice AC6mut mice were physically indistinguishable from their transgene negative siblings. Necropsy of adult mice showed that body weight, tibial length, LV weight, and lung weight showed no group differences. (Table 1).
  • AC6mut mRNA was increased 62-fold and protein was increased 17-fold over the levels of endogenous AC6, which were detected using primers and antibody to the common regions on both endogenous AC6 and transgene AC6mut in RT-PCR and immunoblotting (Figs. IB and 1C).
  • the transgenic line was suited to test the overall effect of reduced AR-stimulated cAMP production in the presence of increased AC6mut expression on LV function.
  • Echocardiography showed that basal cardiac structure and function were unchanged by cardiac-directed expression of AC6mut. LV dimensions were not different between groups, and basal LV ejection fraction and the velocity of circumferential fiber shortening were similar (Table 2). Thus, despite marked diminution 5 of LV cAMP generating capacity in AC6mut mice, LV structure and basal function were unaltered.
  • LV Contractile Function in Response to Isoproterenol To assess cardiac contractility in a manner independent of autonomic nervous influence, endogenous catecholamines, and anesthesia, LV pressure development was measured in
  • LV expression of proteins that regulate SR Ca 2+ uptake was altered LV expression of proteins that regulate SR Ca 2+ uptake.
  • the contents of LV SERCA2a, calreticulin, and calsequestrin were unchanged, and PLB phosphorylation at Serl 6 was unchanged (Fig. 4D).
  • AC6mut expression is associated with increased SR Ca 2+ uptake in LV homogenates and increased Ca 2+ transients with reduced time of relaxation in intact cardiac myocytes. Associated with these physiologically favorable effects of AC6mut expression was reduced PLB expression, a Ca 2+ regulator that inhibits SERCA2a activity. Reduced PLB content or increased PLB phosphorylation at Serl6 is associated with reduction of its inhibitory effects, which increases SERCA2a activity [20], [21], [22].
  • PLB expression is reduced in cultured cardiac myocytes expressing AC6 or AC6mut [4], but the current study is the first to demonstrate that this effect is also seen in vivo (Fig. 4B).
  • AC6mut expression was associated with increased expression and nuclear translocation of CREM-1 (Figs. 3B and 3E), a transcriptional suppressor in the
  • AC6mut expression was associated with an unanticipated increase in LV expression of the Ca 2+ sensitizing protein, SlOOAl, which increases contractile function through modulation of RyR2 and SERCA2a [24]. How might AC6mut expression be linked with increased LV S lOOAl expression? AC6mut expression was associated with increased phosphorylation and nuclear translocation of CREB (Figs. 4C and 4E), processes that are required for CREB activation.
  • CREB is a transcriptional activator that regulates many genes through CRE site(s) in their promoters [25].
  • the SlOOAl promoter possesses a CRE site [26], indicating that SlOOAl expression could plausibly have been activated by AC6mut expression.
  • compartmentalization of PKA and cAMP may also be factors [27], [28].
  • A The diagram depicts the site of substitution of alanine (ala) for aspartic acid (asp) at position 426 (position number based on SEQ ID NO: 16) in the CI domain
  • AC6mut mR A expression was assessed by qRT-PCR using primers common to endogenous AC6 and transgene AC6mut. Primers for detecting GAPDH mRNA were used for internal control of the qRT-PCR reaction. AC6mut mRNA was increased 62- fold vs endogenous AC6. Animal number in bars +SE; Student's t-test, unpaired, 2 tails
  • AC6mut protein was detected in immunoblotting using anti-AC5/6 antibody and confirmed using anti-AUl tag antibody. AC6mut protein was increased 17-fold vs endogenous AC6.
  • Adenylyl cyclase increases survival in cardiomyopathy. Circulation 105: 1989-1994.
  • adenylyl cyclase expression improves heart function in murine cardiomyopathy.
  • AKAP79 interacts with multiple adenylyl cyclase (AC) isoforms and scaffolds AC5 and AC6 to a-amino-3-hydroxyl-5-methyl-4-isoxazole-propionate (AMP A) receptors. J Biol Chem 285: 14450-14458.
  • LV left ventricle
  • TL tibial length. Values represent mean ⁇ SE; Student's / test (unpaired, 2- tailed). Table 2. Echocardiography (Basal)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cardiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Hospice & Palliative Care (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Virology (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/US2014/040948 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function Ceased WO2014197624A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
US14/893,905 US11040091B2 (en) 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
RU2015155831A RU2015155831A (ru) 2013-06-07 2014-06-04 Аденилатциклаза, некомпетентная по циклическому аденозин монофосфату, композиция и способы для лечения сердечной недостаточности и улучшения сердечной функции
BR112015030355A BR112015030355A8 (pt) 2013-06-07 2014-06-04 uso de uma proteína ou um polipeptídeo de adenilil ciclase tipo 6 (ac6) incompetente com a adenosina monofosfato cíclico (incompetente com camp) ou um gene ou ácido nucléico que codifica ac6mut, e, formulação
CN201480044190.5A CN105452458A (zh) 2013-06-07 2014-06-04 用于治疗心力衰竭和增加心脏功能的不能产生环腺苷酸的腺苷酸环化酶和组合物和方法
JP2016517971A JP6571069B2 (ja) 2013-06-07 2014-06-04 環状アデノシン一リン酸−インコンピテントアデニリルシクラーゼならびに心不全を処置するおよび心機能を増大させるための組成物および方法
EP14808138.3A EP3004343B1 (en) 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
DK14808138.3T DK3004343T3 (en) 2013-06-07 2014-06-04 CYCLIC ADENOSIN MONONPHOSPHATE INSUFFICIENT ADENYLYL CYCLE AND COMPOSITIONS AND METHODS FOR TREATING HEART WEIGHT AND INCREASING HEART FUNCTION
CA2914029A CA2914029A1 (en) 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
KR1020167000315A KR20160032090A (ko) 2013-06-07 2014-06-04 사이클 아데노신 모노포스페이트-결핍 아데닐일 사이클라아제 및 심부전 치료와 심기능 향상을 위한 조성물 및 방법
HK16111093.5A HK1222884A1 (zh) 2013-06-07 2014-06-04 用於治疗心力衰竭和增加心脏功能的不能产生环腺苷酸的腺苷酸环化酶和组合物和方法
AU2014274902A AU2014274902B2 (en) 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
IL242885A IL242885B (en) 2013-06-07 2015-12-02 Deficient adenosine monophosphate cyclic-adenylyl cyclase and preparations and methods for treating heart failure and increasing heart function
ZA2015/08942A ZA201508942B (en) 2013-06-07 2015-12-08 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361832759P 2013-06-07 2013-06-07
US61/832,759 2013-06-07

Publications (1)

Publication Number Publication Date
WO2014197624A1 true WO2014197624A1 (en) 2014-12-11

Family

ID=52008569

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/040948 Ceased WO2014197624A1 (en) 2013-06-07 2014-06-04 Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function

Country Status (14)

Country Link
US (1) US11040091B2 (https=)
EP (1) EP3004343B1 (https=)
JP (1) JP6571069B2 (https=)
KR (1) KR20160032090A (https=)
CN (1) CN105452458A (https=)
AU (1) AU2014274902B2 (https=)
BR (1) BR112015030355A8 (https=)
CA (1) CA2914029A1 (https=)
DK (1) DK3004343T3 (https=)
HK (1) HK1222884A1 (https=)
IL (1) IL242885B (https=)
RU (1) RU2015155831A (https=)
WO (1) WO2014197624A1 (https=)
ZA (1) ZA201508942B (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2018512854A (ja) * 2015-04-09 2018-05-24 コーネル ユニヴァーシティー アレルゲンに対する反応を予防するための遺伝子治療
EP3778629A4 (en) * 2018-07-09 2021-06-30 Pharchoice Therapeutics Inc USE OF RECOMBINANT RYR2 PROTEIN OR RECOMBINANT RYR2 PROTEIN IN THE MANUFACTURE OF A MEDICINAL PRODUCT AGAINST HEART FAILURE
US11634742B2 (en) 2020-07-27 2023-04-25 Anjarium Biosciences Ag Compositions of DNA molecules, methods of making therefor, and methods of use thereof
US11760987B2 (en) 2017-09-07 2023-09-19 The Regents Of The University Of California Compositions and methods for the treatment or prevention of heart failure

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109890400B (zh) * 2016-10-24 2022-12-20 贝特基因公司 包含蛋白磷酸酶1抑制肽的血管疾病治疗用组合物
WO2018090036A1 (en) * 2016-11-14 2018-05-17 Renova Therapeutics, Inc. Method of protection for cardiac tissue
EP3689363A4 (en) * 2017-09-29 2021-05-19 BethphaGen Inc. PHARMACEUTICAL COMPOSITION FOR THE PREVENTION OR TREATMENT OF CARDIAC ARRHYTHMIA
CA3100280A1 (en) * 2018-06-08 2019-12-12 University Of Florida Research Foundation, Incorporated Aav cardiac gene therapy for cardiomyopathy
CN109191052B (zh) * 2018-10-22 2020-09-25 山东大学 一种多车型车辆路径优化方法、服务器及系统

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020103147A1 (en) * 1997-09-05 2002-08-01 Hammond H. Kirk Gene therapy for congestive heart failure

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020103147A1 (en) * 1997-09-05 2002-08-01 Hammond H. Kirk Gene therapy for congestive heart failure

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
GAO ET AL.: "Beneficial effects of adenylyl cyclase type 6 (AC6) expression persist using a catalytically inactive AC6 mutant", MOL PHARMACOL., vol. 79, no. 3, 2 December 2010 (2010-12-02), pages 381 - 388, XP055300478 *
LAI ET AL.: "Activation of cardiac adenylyl cyclase expression increases function of the failing ischemic heart in mice", J AM COLL CARDIOL., vol. 51, no. 15, 15 April 2008 (2008-04-15), pages 1490 - 1497, XP029646078, DOI: doi:10.1016/j.jacc.2008.01.015 *
See also references of EP3004343A4 *
SUGANO ET AL.: "Activated expression of cardiac adenylyl cyclase 6 reduces dilation and dysfunction of the pressure-overloaded heart", BIOCHEM BIOPHYS RES COMMUN., vol. 405, no. 3, 30 December 2010 (2010-12-30), pages 349 - 355, XP 028145472, DOI: doi:10.1016/j.bbrc.2010.12.113 *
TAKAHASHI ET AL.: "Increased cardiac adenylyl cyclase expression is associated with increased survival after myocardial infarction", CIRCULATION, vol. 114, no. 5, 24 July 2006 (2006-07-24), pages 388 - 396, XP055300494 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2018512854A (ja) * 2015-04-09 2018-05-24 コーネル ユニヴァーシティー アレルゲンに対する反応を予防するための遺伝子治療
JP2021097677A (ja) * 2015-04-09 2021-07-01 コーネル ユニヴァーシティー アレルゲンに対する反応を予防するための遺伝子治療
US11760987B2 (en) 2017-09-07 2023-09-19 The Regents Of The University Of California Compositions and methods for the treatment or prevention of heart failure
EP3778629A4 (en) * 2018-07-09 2021-06-30 Pharchoice Therapeutics Inc USE OF RECOMBINANT RYR2 PROTEIN OR RECOMBINANT RYR2 PROTEIN IN THE MANUFACTURE OF A MEDICINAL PRODUCT AGAINST HEART FAILURE
US11634742B2 (en) 2020-07-27 2023-04-25 Anjarium Biosciences Ag Compositions of DNA molecules, methods of making therefor, and methods of use thereof

Also Published As

Publication number Publication date
AU2014274902B2 (en) 2020-06-04
BR112015030355A2 (pt) 2017-07-25
RU2015155831A3 (https=) 2018-03-28
JP6571069B2 (ja) 2019-09-04
US11040091B2 (en) 2021-06-22
EP3004343A1 (en) 2016-04-13
IL242885B (en) 2019-12-31
JP2016521708A (ja) 2016-07-25
US20160101164A1 (en) 2016-04-14
RU2015155831A (ru) 2017-07-14
HK1222884A1 (zh) 2017-07-14
DK3004343T3 (en) 2019-02-04
CN105452458A (zh) 2016-03-30
AU2014274902A1 (en) 2015-12-24
KR20160032090A (ko) 2016-03-23
EP3004343B1 (en) 2018-10-10
EP3004343A4 (en) 2017-01-04
CA2914029A1 (en) 2014-12-11
BR112015030355A8 (pt) 2019-12-24
ZA201508942B (en) 2019-05-29

Similar Documents

Publication Publication Date Title
AU2014274902B2 (en) Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
KR102107482B1 (ko) 심혈관 질환 및 다른 증상에 대한 파라크린 유전자의 전신 전달 및 조절 발현
US20170182129A1 (en) Systemic delivery of virus vectors encoding urocortin-2 and related genes to treat diabetes-related cardiac dysfunctions and congestive heart failure
AU2021305213A1 (en) MYBPC3 polypeptides and uses thereof
US11760987B2 (en) Compositions and methods for the treatment or prevention of heart failure
HK1257863A1 (en) Systemic delivery and regulated expression of paracrine genes for cardiovascular diseases and other conditions
HK1203845B (en) Systemic delivery and regulated expression of paracrine genes for cardiovascular diseases and other conditions

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201480044190.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14808138

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2914029

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 242885

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2016517971

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015030355

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2014808138

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014274902

Country of ref document: AU

Date of ref document: 20140604

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20167000315

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015155831

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015030355

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151203