WO2014093595A1 - Crispr-cas component systems, methods and compositions for sequence manipulation - Google Patents

Crispr-cas component systems, methods and compositions for sequence manipulation Download PDF

Info

Publication number
WO2014093595A1
WO2014093595A1 PCT/US2013/074611 US2013074611W WO2014093595A1 WO 2014093595 A1 WO2014093595 A1 WO 2014093595A1 US 2013074611 W US2013074611 W US 2013074611W WO 2014093595 A1 WO2014093595 A1 WO 2014093595A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
crispr
tracr
target
enzyme
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/074611
Other languages
French (fr)
Other versions
WO2014093595A9 (en
Inventor
Feng Zhang
David Olivier BIKARD
Le Cong
David Benjamin Turitz COX
Patrick Hsu
Wenyan Jiang
Shauiliang LIN
Luciano MARRAFFINI
Randall Jeffrey PLATT
Fei RAN
Neville Espi SANJANA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rockefeller University
Massachusetts Institute of Technology
Broad Institute Inc
Harvard University
Original Assignee
Rockefeller University
Massachusetts Institute of Technology
Broad Institute Inc
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=49881125&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014093595(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to EP17162030.5A priority Critical patent/EP3252160B1/en
Priority to KR1020267010790A priority patent/KR20260055511A/en
Priority to EP23192260.0A priority patent/EP4286402A3/en
Priority to CA2894668A priority patent/CA2894668A1/en
Priority to EP25158803.4A priority patent/EP4570817A3/en
Priority to JP2015547530A priority patent/JP2016505256A/en
Priority to BR112015013786-5A priority patent/BR112015013786B1/en
Priority to EP23161559.2A priority patent/EP4234696A3/en
Priority to EP20198492.9A priority patent/EP3825401A1/en
Priority to EP23192949.8A priority patent/EP4286403A3/en
Priority to CN201380072868.6A priority patent/CN105658796B/en
Priority to BR122021008308-8A priority patent/BR122021008308B1/en
Priority to AU2013359262A priority patent/AU2013359262C1/en
Priority to RU2015128102A priority patent/RU2701662C9/en
Priority to EP13812430.0A priority patent/EP2825654B1/en
Priority to DK13812430.0T priority patent/DK2825654T3/en
Priority to EP23192951.4A priority patent/EP4286404A3/en
Priority to ES13812430.0T priority patent/ES2635244T3/en
Priority to EP14188820.6A priority patent/EP2840140B2/en
Application filed by Rockefeller University, Massachusetts Institute of Technology, Broad Institute Inc, Harvard University filed Critical Rockefeller University
Priority to HK15106920.5A priority patent/HK1206388B/en
Priority to KR1020157018662A priority patent/KR102955556B1/en
Priority to EP14190376.5A priority patent/EP2848690B1/en
Priority to CN201910829026.XA priority patent/CN110982844B/en
Priority to CN202111233527.5A priority patent/CN114634950A/en
Publication of WO2014093595A1 publication Critical patent/WO2014093595A1/en
Priority to US14/497,627 priority patent/US20150031134A1/en
Priority to US14/523,799 priority patent/US9840713B2/en
Anticipated expiration legal-status Critical
Publication of WO2014093595A9 publication Critical patent/WO2014093595A9/en
Priority to US14/990,444 priority patent/US9822372B2/en
Priority to US14/991,083 priority patent/US20160115489A1/en
Priority to US15/838,064 priority patent/US20180305704A1/en
Priority to US15/887,377 priority patent/US20180179547A1/en
Priority to US16/178,551 priority patent/US20190292550A1/en
Priority to AU2019280394A priority patent/AU2019280394B2/en
Priority to US16/906,580 priority patent/US20200318123A1/en
Priority to US17/503,928 priority patent/US20220135985A1/en
Priority to AU2022203763A priority patent/AU2022203763B2/en
Priority to AU2025203777A priority patent/AU2025203777A1/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/746—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for lactic acid bacteria (Streptococcus; Lactococcus; Lactobacillus; Pediococcus; Enterococcus; Leuconostoc; Propionibacterium; Bifidobacterium; Sporolactobacillus)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90—Stable introduction of foreign DNA into chromosome
    • C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/20—Allele or variant detection, e.g. single nucleotide polymorphism [SNP] detection
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/30—Detection of binding sites or motifs
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/50—Mutagenesis
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00—ICT specially adapted for sequence analysis involving nucleotides or amino acids
    • G16B30/10—Sequence alignment; Homology search
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102—Mutagenizing nucleic acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034—Isolating an individual clone by screening libraries
    • C12N15/1082—Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/30—Chemical structure
    • C12N2310/35—Nature of the modification
    • C12N2310/351—Conjugate
    • C12N2310/3519—Fusion with another nucleic acid
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/50—Physical structure
    • C12N2310/53—Physical structure partially self-complementary or closed
    • C12N2310/531—Stem-loop; Hairpin
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00—Applications; Uses
    • C12N2320/10—Applications; Uses in screening processes
    • C12N2320/11—Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00—Applications; Uses
    • C12N2320/30—Special therapeutic applications
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00—Nucleic acids vectors
    • C12N2800/10—Plasmid DNA
    • C12N2800/101—Plasmid DNA for bacteria
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00—ICT specially adapted for sequence analysis involving nucleotides or amino acids

Definitions

  • the present invention generally relates to systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that may use vector systems related to Clustered Regularly Interspaced Short Palindromic Repeats (CRJSPR) and components thereof,
  • sequence targeting such as genome perturbation or gene-editing
  • CRJSPR Clustered Regularly Interspaced Short Palindromic Repeats
  • the CRISPR/Cas or the CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short RNA molecule to recognize a specific DNA target, in other words the Cas enzyme can be recruited to a specific DNA target using said short RNA molecule.
  • Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques a d analysis methods may significantly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases.
  • the invention provides a vector system comprising one or more vectors.
  • the system comprises: (a) a first regulatory element operabl linked to a tracr mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR.
  • component (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element.
  • component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell.
  • the system comprises the tracr sequence under the control of a third regulatory element, such as a polymerase III promoter.
  • the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. Determining optimal alignment is within the purview of one of skill in the art.
  • the CRISPR complex comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR complex in a detectable amount in the nucleus of a eukaryotic cell.
  • a nuclear localization sequence is not necessary for CRISPR complex activity in eukaryotes, but that including such sequences enhances activity of the system, especially as to targeting nucleic acid .molecules in the nucleus.
  • the CRISPR enzyme is a type II CRISPR system enzyme. In some embodiments, the CRISPR enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is S. pneumoniae, S, pyogenes, or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms. The enzyme may be a Cas9 homoiog or ortholog. In some embodiments, the CRISPR enzyme is codon- optimized for expression in a eukaryotic cell. In some embodiments, the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence. In some embodiments, the CRISPR enzyme lacks DNA strand cleavage activity.
  • the first regulatory element is a polymerase III promoter.
  • the second regulatory element is a polymerase ⁇ promoter.
  • the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15- 20 nucleotides in length.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partial ly double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g.
  • vectors refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
  • viral vector wherein vira!iy-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication detective adenoviruses, and adeno-associated viruses).
  • Viral vectors also include polynucleotides carried by a vims for traiisfection into a host cell.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • Other vectors e.g., non-episomal mammalian vectors
  • certain vectors are capable of directing the expression of genes to which they are operatively-linked.
  • Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
  • operably linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory elemeiit(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro trail scription/translation system or in a host cell when the vector is introduced into the host ceil).
  • regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (RES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
  • RES internal ribosomal entry sites
  • other expression control elements e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences.
  • transcription termination signals such as polyadenylation signals and poly-U sequences.
  • regulatory elements are described, for example, in Goeddei, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
  • Regulator ⁇ .' elements include those that direct constitutive expression of a nucleotide sequence in many types of host ceil and those that direct expression of the nucleotide sequence only in certain host ceils (e.g., tissue-specific regulator ⁇ ' sequences).
  • a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
  • a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g.
  • pol III promoters include, but are not limited to, U6 and HI promoters.
  • pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with, the CMV enhancer) [see, e.g., Boshari et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydro folate reductase promoter, the ⁇ -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFla promoter.
  • RSV Rous sarcoma virus
  • CMV cytomegalovirus
  • PGK phosphoglycerol kinase
  • promoter ⁇ ' element also encompassed by the term "regulator ⁇ ' element” are enhancer elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Mol. Cell. Biol, Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc.
  • a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly Interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
  • CRISPR clustered regularly Interspersed short palindromic repeats
  • Advantageous vectors include lentivirases and adeno-assoeiated viruses, and types of such vectors can al so be selected for targeting particul ar types of cells.
  • the invention provides a vector comprising a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising one or more nuclear localization sequences.
  • said regulatory element drives transcription of the CRISPR enzyme in a eukaryotic cell such that said CRISPR enzyme accumulates in a detectable amount in the nucleus of the eukaryotic cell.
  • the regulatory element is a polymerase II promoter.
  • the CRISPR enzyme is a type II CRISPR system enzyme.
  • the CRISPR enzyme is a Cas9 enzyme.
  • the Cas9 enzyme is 5. pneumoniae, S. pyogenes or S.
  • thermophilus Cas9 and may include mutated Cas9 derived from these organisms.
  • the CRISPR enzyme is codon-optimized for expression in a eukaryotic cell.
  • the CRISPR enzyme directs cleavage of one or two strands at the locationo of the target sequence.
  • the CRISPR enzyme lacks DNA strand cleavage activity.
  • the invention provides a CRISPR enzyme comprising one or more uclear localization sequences of sufficient stre gth to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
  • the CRISPR enzyme is a type II CRISPR system enzyme.
  • the CRISPR enzyme is a Cas9 enzyme.
  • the Cas9 enzyme is S. pneumoniae, S. pyogenes or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms.
  • the enzyme may be a Cas9 homolog or ortholog.
  • the CRISPR e zyme lacks the ability to cleave one or more strands of a target sequence to which it binds.
  • the invention provides a eukaryotic host cell comprising (a) a first regulatory element operably linked to a tract mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR comple to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CR ISPR enzyme compiexed with (1) the guide sequence that is hybridized to the target sequence, a d (2) the tracr mate sequence that is hybridized to the tracr sequence; and/or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence.
  • the host cell comprises components (a) and (b).
  • component (a), component (b), or components (a) and (b) are stably integrated into a genome of the host eukaryotic cell.
  • component (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element.
  • component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell.
  • the eukaryotic host cell further comprises a third regulatory element, such as a polymerase III promoter, operably linked to said tracr sequence.
  • the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
  • the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic ceil.
  • the CRISPR enzyme is a type ⁇ CRISPR system enzyme.
  • the CRISPR enzyme is a Cas9 enzyme.
  • the Cas9 enzyme is 5. pneumoniae, S. pyogenes or S, thermophilus Cas9, and may include mutated Cas9 derived from these organisms.
  • the enzyme may be a Cas9 homolog or ortholog.
  • the CRISPR enzyme is codon -optimized for expression in a eukaryotic cell.
  • the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence.
  • the CRISPR enzyme lacks DNA strand cleavage activity.
  • the first regulatory element is a polymerase ( II promoter.
  • the second regulatory element is a polymerase II promoter.
  • the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15- 20 nucleotides in length.
  • the invention provides a non-human eukaryotic organism; preferably a multicellular eukaryotic organism, comprising a eukaryotic host cell according to any of the described embodiments.
  • the invention provides a eukaryotic organism; preferably a multicellular eukaryotic organism, comprising a eukaryotic host cell according to any of the described embodiments.
  • the organism in some embodiments of these aspects may be an animal; for example a mammal. Also, the organism may be an arthropod such as an insect. The organism also may be a plant. Further, the organism may be a fungus.
  • the invention provides a kit comprising one or more of the components described herein.
  • the kit comprises a vector system and instructions for using the kit.
  • the vector system comprises (a) a first regulatory elemen operably linked to a tracr mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR comple to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence; and'Or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR.
  • the kit comprises components (a) and (b) located on the same or different vectors of the system.
  • componen (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element.
  • component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell.
  • the system further comprises a third regulatory element, such as a polymerase III promoter, operably linked to said tracr sequence.
  • the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
  • the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
  • the CRISPR enzyme is a type II CRISPR system enzyme
  • the CRISP R enzyme is a Cas9 enzyme.
  • the Cas9 enzyme is S. pneumoniae, S. pyogenes or S.
  • thermophilus Cas9 and may include mutated Cas9 derived from these organisms.
  • the enzyme may be a Cas9 homolog or ortholog.
  • the CRISPR enzyme is codo -optimized, for expression in a eukaryotic cell.
  • the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence.
  • the CRISPR enzyme lacks DNA strand cleavage activity.
  • the first regulator)? element is a polymerase III promoter.
  • the second regulatory element is a polymerase II promoter.
  • the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15-20 nucleotides in length.
  • the invention provides a method of modifying a target polynucleotide in a eukaryotic cell.
  • the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
  • the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
  • said vectors are delivered to the eukaryotic cell in a subject.
  • said modifying takes place in said eukaryotic cell in a cell culture.
  • the method further comprises isolating said eukaryotic cell from a subject prior to said modifying.
  • the method further comprises returning said eukaryotic cell and/or cells derived therefrom to said subject.
  • the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
  • the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • the method further comprises delivering one or more vectors to said eukaryotic cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
  • the invention provides a method of generating a model eukaryotic cell comprising a mutated disease gene
  • a disease gene is any gene associated an increase in the risk of having or developing a disease.
  • the method comprises (a) introducing one or more vectors into a eukaryotic cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said disease gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotic
  • said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence.
  • the invention provides a method for developing a biologically active agent that modulates a cell signaling event associated with a disease gene.
  • a disease gene is any gene associated an increase in the risk of having or developing a disease.
  • the method comprises (a) contacting a test compound wit a model cell of any one of the described embodiments; and (b) detecting a change in a readout that is indicative of a reduction or a augmentatio of a cell signaling event associated with said mutation in said disease gene, thereby developing said biologically active agent that modulates said cell signaling event associated with said disease gene.
  • the invention provides a recombinant polynucleotide comprising a guide sequence upstream of a tracr mate sequence, wherein the guide sequence when expressed directs sequence-specific binding of a CRJSPR complex to a corresponding target sequence present in a eukaryotic cell.
  • the target sequence is a viral sequence present in a eukaryotic cell.
  • the target sequence is a proto -oncogene or an oncogene.
  • the invention provides for a method of selecting one or more prokaryotic cell(s) by introducing one or more mutations in a gene in the one or more prokaryotic cell (s), the method comprising: introducing one or more vectors into the prokaryotic cell (s), wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and a editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; al lowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRJSPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRJSPR complex comprises the CRJSPR enzyme complexed with (1) the guide sequence that is hybridized to the
  • the CRJSPR enzyme is Cas9.
  • the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific cells without requiring a selection marker or a two-step process that may include a counter-selection system. [0022] Accordingly, it is an object of the invention not to encompass within the invention any previously known product, process of making the product, or method of using the product- such that Applicants reserve the right and hereby disclose a disclaimer of any previously known product, process, or method.
  • the invention does not intend to encompass within the scope of the invention any product, process, or making of the product or method of using the product, which does not meet the written description and enablement requirements of the USPTO (35 U.S.C. ⁇ 1 12, first paragraph) or the EPO (Article 83 of the EPC), such that Applicants reserve the right and hereby disclose a disclaimer of any previously described product, process of making the product, or method of using the product,
  • FIG. 1 shows a schematic model of the CRISPR system.
  • the Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide sequence (blue) and a scaffold (red).
  • the guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5 '-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB) ⁇ 3 bp upstream of the PAM (red triangle).
  • Figure 2A-F shows an exemplary CRISPR system, a possible mechanism of action, an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity.
  • Figure 3 shows an exemplary expression cassette for expression of CRISPR. system elements in eukaryotic cells, predicted structures of example guide sequences, and CRISPR system activity as measured in eukaryotic and prokaryotic cells.
  • Figure 4A-0 shows results of an evaluation of SpCas9 specificity for an example target.
  • Figure 5A-G show an exemplary vector system and results for its use in directing homologous recombination in eukaryotic ceils.
  • Figure 6 provides a table of protospacer sequences and summarizes modification efficiency results for protospacer targets designed based on exemplary S. pyogenes and S. thermophilus CRISPR systems with corresponding PAMs against loci in human and mouse genomes.
  • Figure 7A-C shows a comparison of different tracr NA transcripts for Cas9- mcdiated gene targeting.
  • Figure 8 shows a schematic of a surveyor nuclease assay for detection of double strand break-induced micro-insertions and --deletions.
  • Figure 9A-B shows exemplary bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cells.
  • Figure 10 shows a bacterial plasmid transformation interference assay, expression cassettes and plasmids used therein, and transformation efficiencies of cells used therein .
  • Figure 11A-C shows histograms of distances between adjacent S. pyogenes SF370 locus I PAM (NGG) ( Figure 10A) and S. thermophilus LMD9 locus 2 PA..VI (NNAGAAW) ( Figure 10B) in the human genome; and distances for each PAM by chromosome (Chr) ( Figure IOC).
  • Figure 12A-C shows an exemplary CRISPR system, an example adaptation for expression in eukaryotic cells, and results of tests assessing CRISPR activity.
  • Figure 13A-C shows exemplary manipulations of a CRISPR system for targeting of genomic loci in mammalian cells.
  • Figure 14A-B shows the results of a Northern blot analysis of erRNA processing in mammalian cel ls.
  • Figure 15 shows an exemplary selection of protospacers in the human PVALB and mouse Th loci.
  • Figure J 6 shows example protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR system in the human EMX1 locus.
  • Figure 17 provides a table of sequences for primers and probes used for Surveyor, RFLP, genomic sequencing, and Northern blot assays.
  • Figure 18A-C shows exemplary manipulation of a CRISPR system with chimeric RNAs and results of SURVEYOR assays for system activity in eukaryotic cells.
  • Figure 19A-B shows a graphical representation of the results of SURVEYOR assays for CRJSPR system activity in eukaryotic cells.
  • Figure 20 shows an exemplary visualization of some S. pyogenes Cas9 target sites in the human genome using the i CSC genome browser.
  • Figure 21 shows predicted secondary structures for exemplary chimeric RNAs comprising a guide sequence, tracr mate sequence, and tracr sequence.
  • Figure 22 shows exemplaiy bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cells.
  • FIG. 23 shows that Cas9 nuclease activity against endogenous targets may be exploited for genome editing
  • the CRISPR targeting construct directed cleavage of a chromosomal locus and was co -transformed with an editing template that recombined with the target to prevent cleavage.
  • Kanamycin- resistant transformants that survived CRISPR attack contained modifications introduced by the editing template, tracr, ir ws-activating CRISPR RNA; aphA-3, kanamycin resistance gene,
  • Figure 24 shows analysis of PAM and seed sequences that eliminate Cas9 cleavage,
  • PGR. products with, randomized PAM sequences or randomized seed sequences were transformed in crR6 cells. These cells expressed Cas9 loaded with a crRNA that, targeted a chromosomal region of R6' "" " "J ceils (highlighted in pink) that is absent from the R6 genome. More than 2* 105 chloramphenicoi-resistant transform arsts, carrying inactive PAM or seed sequences, were combined for amplification and deep sequencing of the target region, (b) Relative proportion of number of reads after transformation of the random PAM constructs in crR6 cells (compared to number of reads in R6 transformants).
  • the relative abundance for each 3 -nucleotide PAM sequence is shown. Severely underrepresented sequences (NGG) are shown in red; partially underrepresented one in orange ( NAG) (c) Relative proportion of number of reads after transformation of the random seed sequence constructs in crR6 cells (compared to number of reads in R6 trail sformants). The relative abundance of each nucleotide for each position of the first 20 nucleotides of the protospacer sequence is shown. High abundance indicates lack of cleavage by Cas9, i.e. a CR ISPR inactivating mutation. The grey line shows the level of the WT sequence. The dotted line represents the level above which a mutation significantly disrupts cleavage (See section "Analysis of deep sequencing data" in Example 5)
  • Figure 25 shows introduction of single and multiple mutations using the CRISPR system in S. pneumoniae, (a) Nucleotide and amino acid sequences of the wild-type and edited (green nucleotides; underlined amino acid residues) bgaA. The protospacer, PAM and restriction sites are shown, (b) Transformation efficiency of ceils transformed with targeting constructs in the presence of an editing template or control, (c) PGR analysis for 8 transformants of each editing experiment followed by digestion with BtgZI (R ⁇ A) and Tsel (NE ⁇ AA).
  • bgaA Deletion of bgaA was revealed as a smaller PGR product, (d) Miller assay to measure the ⁇ -galactosidase activity of WT and edited strains, (e) For a single-step, double deletion the targeting construct contained two spacers (in this case matching srtA and bgaA) and was co-transformed with two different editing templates (f) PGR analysis for 8 transformants to detect deletions in srtA and bgaA loci. 6/8 transformants contained deletions of both genes.
  • Figure 26 provides mechanisms underlying editing using the CRISPR system
  • a stop codon was introduced in the erythromycin resistance gene ermAM to generate strain JENS 3.
  • the wild-type sequence can be restored by targeting the stop codon with the CRISPR: :ermA (stop) construct, and using the ermAM wild-type sequence as an editing template
  • (b) Mutant and wild-type ermAM sequences (c) Fraction of erythromicyn-resistant (erm R ) cfu calculated from total or kanamycin-resistant (kan R ) cfu.
  • FIG. 27 illustrates genome editing with the CRISPR system in E. coli.
  • a kanamycin-resistant plasmid carrying the CRISPR array (pCRISPR) targeting the gene to edit may be transformed in the HME63 reeombmeering strain containing a chloramphenicol-resistant plasmid harboring cas9 and tracr (pCas9), together with an oligonucleotide specifying the mutation,
  • pCas9 chloramphenicol-resistant plasmid harboring cas9 and tracr
  • a &42T mutation conferring streptomycin resistance was introduced in the rpsL gene
  • FIG. 28 illustrates the transformation of crR.6 genomic DNA leads to editing of the targeted locus
  • the IS 1167 element of S. pneumoniae R6 was replaced by the CRISPROl locus of S. pyogenes SF370 to generate crR6 strain.
  • This locus encodes for the Cas9 nuclease, a CRISPR array with six spacers, the tracrRNA that is required for crRNA biogenesis and Casl , Cas2 and Csii2, proteins not necessary for targeting.
  • Strain crR6M contains a minimal functional CRISPR system without casl, casl and csn2.
  • the aphA-3 gene encodes kanamycin resistance.
  • Protospacers from the streptococcal bacteriophages ⁇ 8232.5 and ⁇ 370.1 were fused to a chloramphenicol resistance gene (cat) and integrated, in the srtA gene of strain R6 to generate strains R68232.5 and R6370.1.
  • Right panel PC analysis of 8 R6 823 transformants with crR6 genomic DNA. Primers that amplify the srtA locus were used for PCR.
  • Figure 29 provides chromatograms of DNA sequences of edited cells obtained in this study. In all cases the wild-type and mutant protospacer and PAM sequences (or their reverse complement) are indicated. When relevant, the amino acid sequence encoded by the protospacer is provided. For each editing experiment, all strains for which PCR and restriction analysis corroborated the introduction of the desired modification were sequenced. A representative chromatogram is show , (a) Chromatogram for the introduction of a PAM mutation into the R6 S ",2,J target ( Figure 23d).
  • Figure 30 illustrates CRISPR immunity against random S. pneumoniae targets containing different PAMs.
  • FIG 31 provides a general scheme for targeted genome editing.
  • crR6M was further engineered to contain tracrR A, Cas9 and only one repeat of the CRISPR array followed by kanamycin resistance marker (aphA-3), generating strain crR6Rk.
  • DNA from this strain is used as a template for PCR with primers designed to introduce a new spacer (green box designated with N).
  • the left and right PCRs are assembled using the Gibson method to create the targeting construct.
  • Both the targeting and editing constructs are then transformed into strain crR6Rc, which is a strain equivalent to crR6Rk but has the kanamycin resistance marker replaced by a chloramphenicol resistance marker (cat).
  • Figure 32 illustrates the distribution of distances between PAMs. NGG and CCN that are considered to be valid PAMs. Data is shown for the S. pneumoniae R6 genome as well as for a random sequence of the same length and with the same GC-content (39.7 %). The dotted line represents the average distance (12) between PAMs in the R6 genome.
  • Figure 33 il lustrates CRISPR-mediated editing of the ermAM locus using genomic DNA as targeting construct.
  • genomic DNA To use genomic DNA as targeting construct it is ecessary to avoid CRISPR autoimmunity, and therefore a spacer against a sequence not present in the chromosome must be used (in this case the ermAM erythromycin resistance gene), (a) Nucleotide and ami o acid sequences of the wild-type and mutated (red letters) ermAM gene. The protospacer and PAM sequences are shown, (b) A schematic for CRISPR-mediated editing of the ermAM locus using genomic DNA.
  • a construct carrying an ermAM-targetmg spacer (blue box) is made by PCR and Gibson assembly, and transformed into strain crR6Rc, generating strain JEN37.
  • the genomic DNA of JEN37 was then used as a targeting constmct, and was co -transformed with the editing template into JEN38, a strain in which the srtA gene was replaced by a wild-type copy of ermAM, anamycin-resistant transformants contai the edited genotype (JEN43).
  • Figiire 34 illustrates sequential introduction of mutations by CRISPR-mediated genome editing
  • R6 is engineered to generate crR6Rk.
  • crR6Rk is co-transformed with a srtA -targeting construct fused to cat for chloramphenicol selection of edited cells, along with an editing construct for a AsrtA in-frame deletion.
  • Strain crR6 AsrtA is generated by selection on chlramphenicol.
  • the AsrtA strain is co-transformed with a bgaA -targeting construct fused to aphA-3 for kanamycin selection of edited cells, and an editing constmct containing a AbgaA in-frame deletion.
  • the engineered CRISPR locus can be erased from the chromosome by first co-transforming R.6 DNA containing the wild-type IS 1167 locus and a plasmid carrying a bgaA protospacer (pDB97), and selection on spectinomycin.
  • Figure 35 illustrates the background mutation frequency of CRISPR in S. pneumoniae, (a) Transformation of the CRISPR: :0 or CRISPR: :erm(stop) targeting constructs in JEN53, with or without the ermAM editing template. The difference in kan R CFU between CRISPR: :0 and CRJSPR: :erm(stop) indicates that Cas9 cleavage kills non-edited cells. Mutants that escape CRISPR interference in the absence of editing template are observed at a frequency of 3 ⁇ 10 ⁇ ' ⁇ (b) PCR analysis of the CRISPR locus of escapers shows that 7/8 have a spacer deletio , (c) Escaper #2 carries a point mutation in cas9.
  • Figure 36 il lustrates that the essential elements of the S. pyogenes CRISPR locus 1 are reconstituted in E. coli using pCas9.
  • the plasmid contained tracrRNA, Cas9, as well as a leader sequence driving the crRNA array.
  • the pCRISPR plasmids contained the leader and the array only. Spacers may be inserted into the crRNA array between Bsal sites using annealed oligonucleotides. Oligonucleotide design is shown at bottom.
  • pCas9 carried chloramphenicol resistance (CmR) and is based on the low-copy pACYC184 plasmid backbone.
  • CmR chloramphenicol resistance
  • pCRISPR is based on the high-copy number pZE21 plasmid. Two plasmids were required because a pCRISPR plasmid containing a spacer targeting the E. coli chromosome may not be constructed using this organism as a cloning host if Cas9 is also present (it will kill the host).
  • FIG 37 illustrates CRISP -directed editing in E.coli MG1655.
  • An oligonucleotide (W542) carrying a point mutation that both confers streptomycin resistance and abolishes CRISPR immunity, together with a plasmid targeting rpsL (pCRISPR: :rpsL) or a control plasmid (pCRISPR: :0) were co-transformed into wild-type E.coli strain MG1655 containing pCas9. Transformants were selected on media containing either streptomycin or kanamycin. Dashed line indicates limi t of detection of the transformation assay.
  • Figure 38 illustrates the background mutation frequency of CRISPR in E.
  • Figure 39A-D shows a circular depiction of the phylo genetic analysis revealing five families of Cas9s, including three groups of large Cas9s (- 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids),
  • Figure 40A-F shows the linear depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s ( ⁇ 1400 amino acids) and two of small Cas9s ( ⁇ 1 100 amino acids).
  • Figure 41A-M shows sequences where the mutation points are located within the SpCas9 gene.
  • Figure 42 shows a schematic construct in which the transcriptional activation domain (VP64) is fused to Cas9 with two mutations in the catalytic domains (D10 and H840).
  • Figure 43A-D shows genome editing via homologous recombination
  • (a) Schematic of SpCas9 nickase, with D10A mutation in the RuvC I catalytic domain (b) Schematic representing homologous recombination (HR) at the human EMXl locus using either sense or antisense single stranded oligonucleotides as repair templates.
  • Red arrow above indicates sgRNA cleavage site; PCR primers for genotyping (Tables J and ) are indicated as arrows in right panel
  • Figure 44A-B shows single vector designs for SpCas9.
  • Figure 45 shows quantification of cleavage of NLS-Csnl constructs NLS-Csnl , Csnl, Csnl-NLS, NLS-Csnl-NLS, NLS-Csnl -GFP-NLS and UnTFN.
  • Figure 46 shows index frequency of NLS-Cas9, Cas9, Cas9-NLS and NLS-Cas9- NLS.
  • Figure 47 shows a gel demonstrating that SpCas9 with nickase mutations (individually) do not induce double strand breaks.
  • Figure 48 shows a design of the oligo DNA used as Homologous Recombination (HR) template in this experiment and a comparison of HR efficiency induced by different combinations of Cas9 protein and HR template.
  • HR Homologous Recombination
  • Figure 49A shows the Conditional Cas9, Rosa.26 targeting vector map.
  • Figure 49B shows the Constitutive Cas9, Rosa26 targeting vector map.
  • Figure 50A-H show the sequences of each element present in the vector maps of
  • Figure 51 shows a schematic of the important elements in the Constitutive and Conditional Cas9 constructs.
  • Figure 52 shows the functional validation of the expression of Constitutive and Conditional Cas9 constructs.
  • Figure 53 shows the validation of Cas9 nuclease activity by Surveyor.
  • Figure 54 shows the quantification of Cas9 nuclease activity.
  • Figure 55 shows construct design and homologous recombination (HR) strategy.
  • Figure 56 shows the genomic PCR genotyping results for the constitutive (Right) and conditional (Lett) constructs at two different gel exposure times (top row for 3 min and bottom row for 1 min).
  • Figure 57 shows Cas9 activation in mESCs.
  • Figure 58 shows a schematic of the strategy used to mediate gene knockout via NHEJ using a nickase version of Cas9 along with two guide RNAs.
  • Figure 59 shows how DNA double-strand break (DSB) repair promotes gene editing.
  • DSB DNA double-strand break
  • NHEJ error-prone non-homologous end joining
  • Indel random insertion'tieietion
  • a repair template in the form of a plasmid or single-stranded oligodeoxynucleotides can be supplied to leverage the homology-directed repair (HDR) pathway, which allows high fidelity and precise editing.
  • Figure 60 shows the timeline and overview of experiments. Steps for reagent design, construction, validation, and cell line expansion. Custom sgRNAs (Sight blue bars) for each target, as well as genotyping primers, are designed in siiico via our online design tool (available at the website genome-engineering.org/tools). sgRNA expression vectors are then cloned into a plasmid containing Cas9 (PX330) and verified via DNA sequencing. Completed plasmids (pCRISPRs), and optional repair templates for facilitating homology directed repair, are then transfected into cells and assayed for ability to .mediate targeted cleavage. Finally, transfected cel ls can be clonally expanded to derive isogenic cel l lines with defined mutations.
  • Custom sgRNAs Light blue bars
  • genotyping primers are designed in siiico via our online design tool (available at the website genome-engineering.org/tools).
  • sgRNA expression vectors are then clon
  • Figiire 61A-C shows Target selection and reagent preparation
  • 20-bp targets (highlighted in blue) must be followed by 5' ⁇ NGG, which can occur in either strand on genomic DNA. We recommend using the online tool described in this protocol in aiding target selection (www.genome-mgineering.org tools).
  • U6 Fwd U6 reverse primer
  • U6 Rev U6 reverse primer
  • extended DNA oligo Ultramer oiigos from IDT
  • guide sequence (blue N's) in U6 Rev- is the reverse complement of the 5'-NGG flanking target sequence
  • the guide oligos (blue N's) contain overhangs for ligation into the pair of Bbsl sites on PS330, with the top and bottom strand orientations matching those of the genomic target (i.e. top oligo is the 20-bp sequence preceding 5'-NGG in genomic DNA). Digestion of PX330 with Bbsl allows the replacement of the Type lis restriction sites (blue outline) with direct insertion of annealed oiigos. It is worth noting that an extra G was placed before the first base of the guide sequence. Applicants have found that an extra G in front of the guide sequence does not adversely affect targeting efficiency.
  • Figure 62A-D shows the anticipated results for multiple NHEJ.
  • Cas9-mediated cleavage efficiency (% indel) is calculated based on the fraction of cleaved DNA, as determined by integrated intensity of gel ba ds, (b) Two sgRNAs (orange a d blue bars) are designed to target the human GRIN2B and DYRKIA loci. SURVEYOR gel shows modification at both loci in transfecied cells. Colored arrows indicated expected fragment sizes for each locus, (c) A pair of sgRNAs (light blue and green bars) are designed to excise an exon (dark blue) in the human EMX1 locus. Target sequences and PAMs (red) are shown in respective colors, and sites of cleavage indicated by red triangle.
  • Predicted junction is shown below, individual clones isolated from cell populations transfecied with sgRNA 3, 4, or both are assayed by PCR (OUT Fwd, OUT Rev), reflecting a deletion of ⁇ 270-bp. Representative clones with no modification (12/23), mono- allelic (10/23), and bi-allelic (1/23) modifications are shown. IN Fwd and IN Rev primers are used to screen for inversion events (Fig. 6d). (d) Quantification of clonal lines with EMX1 exon deletions.
  • Two pairs of sgRNAs (3.1, 3.2 left-flanking sgRNAs; 4.1, 4.2, right flanking sgRNAs) are used to mediate deletions of variable sizes around one EMX1 exon.
  • Transfecied cells are clonaily isolated and expanded for genotyping analysis for deletions and inversion events. Of the 105 clones are screened, 51 (49%) and 11 (10%) carrying heterozygous and homozygous deletions, respectively. Approximate deletion sizes are given since junctions may be variable.
  • Figure 63A-C shows the application of ssODNs and targeting vector to mediate HR with both wifdtype and nickase mutant of Cas9 in HEK293FT and HUES9 cells with efficiencies ranging from 1.0-27%.
  • Figure 64 shows a schematic of a PCR-based .method for rapid and efficient CRISPR targeting in mammalian ceils.
  • a plasmid containing the human RNA polymerase III promoter U6 is PCR-amplified using a U6-specific forward primer and a reverse primer carrying the reverse complement of part of the U6 promoter, the sgRNA(+85) scaffold with guide sequence, and 7 T nucleotides for transcriptional termination.
  • the resulting PCR product is purified and co- delivered with a plasmid carrying Cas9 driven by the CBh promoter.
  • Figure 65 shows SURVEYOR Mutation Detection Kit from Transgenomlcs results for each gRNA and respective controls.
  • a positive SURVEY R result is one large band corresponding to the genomic PCR and two smaller bands that are the product of the SURVEYOR nuclease making a double-strand break at the site of a mutation.
  • Each gRNA was validated in the mouse cell line, Neuro-N2a, by liposomal transient co-transfection with hSpCas9. 72 hours post-transfection genomic DNA was purified using QuickExtract DNA from Epicentre. PCR was performed to amplify the locus of interest.
  • Figure 66 shows Surveyor results for 38 live pups (lanes 1-38) 1 dead pup (lane 39) and 1 wild-type pup for comparison (lane 40). Pups 1-19 were injected with gRNA Chd.8.2 and pups 20-38 were injected with gRNA Chd8.3. Of the 38 live pups, 13 were positive for a mutation. The one dead pup also had a mutation. There was no mutation detected in the wild- type sample. Genomic PCR sequencing was consistent with the SURVEYOR assay findings.
  • FIG. 67 shows a design of different Cas9 NLS constructs. All Cas9 were the human-codon-optimized version of the Sp Cas9. LS sequences are linked to the cas9 gene at either N-terminus or C-teraiinus. All Cas9 variants with different NLS designs were cloned into a backbone vector containing so it is driven by EFla promoter. On the same vector there is a chimeric RNA targeting human EMX1 locus driven by U6 promoter, together forming a two- eomponent system.
  • Figure 69A shows a design of the CRISPR-TF (Transcription Factor) with transcriptional activation activity.
  • the chimeric RNA is expressed by U6 promoter, while a human-codon-optimized, double-mutant version of the Cas9 protein (hSpCas9m), operabiy linked to triple NLS and a VP64 functional domain is expressed by a EF l a promoter.
  • the double mutations, DIOA and H840A renders the cas9 protein unable to introduce any cleavage but maintained its capacity to bind to target DNA when guided by the chimeric R NA.
  • Figure 69B shows transcriptional activation of the human SOX2 ge e with CRISPR- TF system (Chimeric RNA and the Cas9-NLS-VP64 fusion protein).
  • 293FT cells were transfected with piasmids bearing two components: (I) U6-driven different chimeric RNAs targeting 20-bp sequences within or around the human SOX2 genomic locus, and (2) EF la- driven hSpCas9m (double mutant)-NLS-VP64 fusion protein.
  • 96 hours post transfection 293FT cells were harvested and the level of activation is measured by the induction of mRNA expression using a qRT-PCR assay.
  • Figure 70 depicts NLS architecture optimization for SpCas9.
  • Figure 71 shows a QQ plot for NGGNN sequences.
  • Figure 72 shows a histogram of the data density with fitted normal distribution (black line) and ,99 quantile (dotted line).
  • FIG. 73A-C shows RNA-guided repression of bgaA expression by dgRNA::cas9**.
  • the Cas9 protein binds to the tracrR A, and to the precursor CRISPR RNA which is processed by RNAselll to form the crRNA.
  • the crRNA directs binding of Cas9 to the bgaA promoter and represses transcription, b.
  • the targets used to direct Cas9** to the bgaA promoter are represented. Putative -35, -10 as well as the bgaA start codon are in bold.
  • Betagaiactosidase activity as measure by Miller assay in the absence of targeting and for the four different targets.
  • Figure 74A-E shows characterization of Cas9** mediated repression, a.
  • the gfpmui2 gene and its promoter, including the -35 and -10 signals are represented together with the position of the different target sites used the study, b.
  • Relative fluorescence upon targeting of the coding strand c.
  • Relative fluorescence upon targeting of the non-coding strand d.
  • polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonueleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown.
  • polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (niRNA), transfer RNA, ribosomai RNA, short interfering RNA (siRNA), short-hairpin RNA (shR A), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers,
  • a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
  • the sequence of nucleotides may be interrupted by non-nuc!eotide components.
  • a polynucleotide may be further modified after polymerizatio , such as by conjugation with a labeling component.
  • chimeric RNA In aspects of the i ve tion the terms “chimeric RNA”, “chimeric guide RNA”, “guide RNA”, “single guide RNA” and “synthetic guide RNA” are used interchangeably and refer to the polynucleotide sequence comprising the guide sequence, the tracr sequence and the tracr mate sequence.
  • guide sequence refers to the about 20bp sequence within the guide RNA that specifies the target site and may be used interchangeably with the terms “guide” or "spacer”.
  • tracr mate sequence may also be used interchangeably with the term “direct repeat(s)”.
  • wild type is a term of the art understood by skilled perso s and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
  • variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
  • nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
  • Complementarity refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types.
  • a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100%) complementary).
  • Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
  • Substantially complementary refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under strirs gen t condi tion s .
  • stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes wit the target sequence, and substantially does not hybridize to non-target sequences.
  • Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence.
  • Non -limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y.
  • Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
  • the hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner.
  • the complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self hybridizing strand, or any combination of these.
  • a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PGR, or the cleavage of a polynucleotide by an enzyme.
  • a sequence capable of hybridizing with a given sequence is referred to as the "compl ement" of the given sequence.
  • expression refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins.
  • Transcripts and encoded polypeptides may be collectively referred to as "gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic ceil.
  • polypeptide refers to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or I, optical isomers, and amino acid analogs and peptidomimetics.
  • subject preferably a mammal, more preferably a human.
  • Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.
  • therapeutic agent refers to a molecule or compound that confers some beneficial effect upon administration to a subject.
  • the beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition; reducing or preventing the onset of a disease, symptom, disorder or condition; and generally counteracting a disease, symptom, disorder or pathological condition.
  • treatment or “treating,” or “palliating” or “ameliorating” are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment.
  • the compositions may be administered to a subject at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, even though the disease, condition, or symptom may not have yet bee manifested .
  • the term "effective amount” or “therapeutically effective amount” refers to the amount of an agent that is sufficient to effect beneficial or desired results.
  • the therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be detennined by one of ordinary skill in the art.
  • the term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein.
  • the specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.
  • Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells.
  • CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
  • CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in GoeddeL GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
  • the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
  • Vectors may be introduced and propagated in a prokaryote.
  • a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system).
  • a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
  • Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
  • Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
  • a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protem to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
  • Such enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
  • Example fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988.
  • GST glutathione S-transferase
  • E. coli expression vectors examples include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET l id (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
  • a vector is a yeast expression vector.
  • yeast Saccharomyces cerivisae examples include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa ( uijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif).
  • a vector drives protein expression in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
  • a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector.
  • mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195).
  • the expression vector's control functions are typically provided by one or more regulatory elements.
  • commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
  • tissue-specific regulatory- elements are known in the art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T ceil receptors (Winoto and Baltimore, 1989. EMBO J.
  • promoters are also encompassed, e.g., the murine hox promoters ( essel. and Grass, 1990. Science 249: 374-379) and the a-fetoprotein promoter ⁇ Cam pes and Tiighman, 1989. Genes Dev. 3: 537-546).
  • a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expressio of the one or more elements of the CRISPR system
  • C ISPRs Clustered Regularly Interspaced Short Palindromic Repeats
  • SPIDRs Sacer Interspersed Direct Repeats
  • the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacterid., 169:5429-5433 [1987]; and Nakata et al, J.
  • the CRISPR loci typically differ from other SSRs by the stmcture of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OM1CS J. Meg. Biol, 6:23-33 [2002]; and Mojica et al, Mol. Microbiol, 36:244-246 [2000]).
  • SRSRs short regularly spaced repeats
  • the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
  • CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol.
  • CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas") genes, including sequences encoding a Cas gene, a tracr (trans -activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrR A), a tracr-mate sequence (encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer” in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus.
  • a tracr trans -activating CRISPR
  • tracr-mate sequence encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
  • guide sequence also referred to as a "spacer” in the context of an endogenous CRIS
  • one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
  • target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence a d a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex.
  • a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
  • a target sequence is located in the nucleus or cytoplasm of a ceil.
  • the target sequence may be within an organelle of a eukaryotic cell, for example, mitochondrion or chlorop!ast.
  • a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an "editing template” or “editing polynucleotide” or “editing sequence”.
  • an exogenous template poly ucleotide may be referred to as a editing template.
  • the recombination is homologous recombination.
  • a CRISPR complex comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins
  • formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
  • the tracr sequence which may comprise or consist of al l or a portion of a wild- type tracr sequence (e.g.
  • a wild-type tracr sequence may also form part of a CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operabiy linked to the guide sequence.
  • the tracr sequence has sufficient complementarity to a tracr mate sequence to hybridize and participate in formation of a CRISPR complex. As with the target sequence, it is believed that complete complementarity is not needed, provided there is sufficient to be functional.
  • the tracr sequence has at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
  • one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites.
  • a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operabiy linked to separate regulatory elements on separate vectors.
  • two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
  • CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5" with respect to ("upstream” of) or 3' with, respect to ("downstream” of) a second element.
  • the coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction.
  • a single promoter drives expression of a transcript encoding a C ISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron).
  • the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
  • a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a "cloning site").
  • one or more insertion sites e.g. about or more than about I, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites are located upstream and/or downstream of one or more sequence elements of one or more vectors.
  • a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulator ⁇ ' element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic ceil.
  • a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to al low insertion of a guide sequence at each site.
  • the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these.
  • a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell.
  • a single vector may comprise about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about .1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequenee-containing vectors may be provided, and optionally delivered to a cell.
  • a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein.
  • Cas proteins include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl , Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Cmrl , Cmr3, Cmr4, Cmr5, Cnrr6, Csbl , Csb2, Csb3, Csxl7, CsxM, Csx lO, Cs l6, CsaX, Csx3, Cs l, Csxl5, Csfl , Csf2, CsO
  • the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9.
  • the CRISPR enzyme is Cas9, and may be Cas9 from S. pyogenes or S. pneumoniae.
  • the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence.
  • the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
  • a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wifd-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
  • D10A aspartate -to-a!anine substitution
  • pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
  • Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A.
  • a Cas9 nickase may be used in combination with guide sequenc(es), e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ.
  • Applicants have demonstrated (data not shown) the efficacy of two nickase targets (i.e., sgRNAs targeted at the same location but to different strands of DNA) in inducing mutagenic NHEJ.
  • a single nickase (Cas9-D10A with a single sgRNA) is unable to induce NBEJ and create indels but Applicants have shown that double nickase (Cas9 ⁇ D10A and two sgRNAs targeted to different strands at the same location) can do so in human embryonic stem cells (hESCs).
  • the efficiency is about 50% of nuclease (i.e., regular Cas9 without D10 mutation) in hESCs.
  • two or more catalytic domains of Cas9 may be mutated to produce a mutated Cas9 substantial ly lacking all DNA cleavage activity.
  • a DI0A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity.
  • a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01 %, or lower with respect to its non-mutated form.
  • Other mutations may be useful; where the Cas9 or other CRISPR enzyme is from a species other than S. pyogenes, mutations in corresponding amino acids may be made to achieve similar effects.
  • an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular ceils, such as eukaryotic cells.
  • the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate.
  • codon optimization refers to a process of modifying a nucleic acid sequence for enhan ced expression in the host cells of interest by replacing at least one codon (e.g.
  • Codon bias differences in codon usage between organisms
  • mRNA messenger RNA
  • tRNA transfer RNA
  • genes can be tailored for optimal gene expression in a given organism based on codon optimization.
  • Codon usage tables are readily available, for example, at the "Codon Usage Database", and these tables can be adapted in a number of ways. See Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000" Nuci. Acids Res, 28:292 (2000), Computer algorithms for codon optimizing a particular sequence for expression in a particular host ceil are also available, such as Gene Forge (Aptagen: Jacobus, PA), are also available.
  • one or more codons e.g. 1 , 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
  • one or more codons in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
  • a vector encodes a CR ISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs.
  • the CRISPR enzyme comprises about or more than about 1. 2, 3, 4, 5, 6, 7, 8, 9, 10. or more NLSs at or near the ami no -terminus, about or more tha about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more N LSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the ammo-terminus and one or more NLS at the earboxy terminus).
  • the CRISPR enzyme comprises at most 6 NLSs, In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus.
  • an NLS consists of one or more short sequences of positively charged lysines or arginines exposed on the protein surface, but other types of NLS are known.
  • Non- limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV ; the NLS from nucleopSasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK); the c-myc NLS having the amino acid sequence PAAKRV LD or RQRRNELKRSP; the hRNPAl M9 NLS having the sequence NQSSNFGPM GGNFGGRSSGPYGGGGQYFAKPRNQGGY; the sequence R RIZFKNKGKDTA:ELRRRRVE 7 S 7 ELRKAKKDEQILKRRNV of the IBB domain from importin-alpha; the sequences VSR RPRP and PPKKARED of the myoma T protein; the sequence POP KKPL of human p53; the sequence SAIJKKKKK AP of mouse c- abl IV; the sequences
  • the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
  • strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors.
  • Detection of accumulation in the nucleus may be performed by any suitable technique.
  • a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI).
  • detectable markers include fluorescent proteins (such as Green fluorescent proteins, or GFP; RFP; CFP), and epitope tags (HA tag, flag tag, SNAP lag).
  • Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or e zyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g.
  • a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence.
  • the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%. 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
  • Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith -Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Ciustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, Sa Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
  • Burrows-Wheeler Transform e.g. the Burrows Wheeler Aligner
  • ClustalW ClustalW
  • Ciustal X Ciustal X
  • BLAT BLAT
  • Novoalign Novoalign
  • ELAND Illumina, Sa Diego, CA
  • SOAP available at soap.genomics.org.cn
  • Maq available at maq.sourceforge.net
  • a guide sequence Is about or more tha about 5, 10, I I, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence- specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay.
  • the components of a CRISPR system sufficient to form a CRISPR complex may be provided to a host ceil having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein.
  • cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.
  • Other assays are possible, and will occur to those skilled in the art.
  • a guide sequence may be selected to target any target sequence.
  • the target sequence is a sequence within a genome of a cel l.
  • Exemplar ⁇ ' target sequences include those that are u ique in the target genome.
  • a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNNNXGG where NNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
  • a unique target sequence in a genome may include an S.
  • a unique target sequence in a genome may include a Cas9 target site of the form MMMMM MMMNNNNNNNNNNXXAGAAW where NNNNNNNNNNXXAGAAW (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
  • a unique target sequence in a genome may include an S. thermophilus CRISPRl Cas9 target site of the form MM MMMMMMMN N N NNNNNXXAGAAW where
  • a unique target sequence in a genome may include a Cas9 target site of the form MMMMMM MMNNNNNNNNNNNNNNNNXGGXG where NNNNNNNNNNNNXG GX G (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome,
  • a unique target sequence in a genome may include an S.
  • N is A, G, T, or C; and can be anything
  • M may be A, G, T, or C, and need not be considered in identifying a sequence as unique.
  • a guide sequence is selected to reduce the degree of secondary structure within the guide sequence.
  • Secondary structure may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFo!d, as described by Zuker and Stiegier (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfokl, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et ., 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62). Further algorithms may be found in U.S. application Serial No. TBA (attorney docket 44790.11.2022; Broad Reference BI-2013/004A); incorporated herein by reference.
  • a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence.
  • degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences.
  • Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence.
  • the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.
  • Example illustrations of optimal alignment between a tracr sequence and a tracr mate sequence are provided in Figures 12B and I3B.
  • the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
  • the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.
  • Preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
  • the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G).
  • loop forming sequences include CAAA and AAAG.
  • the transcript or transcribed polynucleotide sequence has at least two or more hairpins.
  • the transcript has two, three, four or five hairpins.
  • the transcript has at most five hairpins.
  • the single transcript further includes a transcription termination sequence; preferably this is a polyT sequence, for example six T nucleotides. An example illustration of such a hairpin structure is provided in the lower portion of Figure 13B, where the portion of the sequence 5' of the final "N" and upstream of the loop corresponds to the tracr mate sequence, and the portion of the sequence 3' of the loop corresponds to the tracr sequence.
  • Non-limiting examples of single polynucleotides comprisi g a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5' to 3'), where "N" represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1 ) catgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT; (2) isnsnsnsnsnsnsnsnsnsns ⁇
  • sequences (1) to (3) are used in combinatio with Cas9 from S. thermophilus CRJSPR1.
  • sequences (4) to (6) are used in combination with Cas9 from S. pyogenes.
  • the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence (suc as illustrated in the top portion of Figure 13B).
  • a recombination template is also provided.
  • a recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide.
  • a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex.
  • a template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length.
  • the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence.
  • a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1 , 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more ucleotides).
  • the nearest nucleotide of the template polynucleotide is within about 1 , 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
  • the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme).
  • a CR ISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
  • epitope tags include histidme (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
  • reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
  • GST glutathione-S-transferase
  • HRP horseradish peroxidase
  • CAT chloramphenicol acetyltransferase
  • beta-galactosidase beta-galactosidase
  • beta-glucuronidase beta-galactosidase
  • luciferase green fluorescent protein
  • GFP green fluorescent protein
  • HcRed HcRed
  • DsRed cyan fluorescent protein
  • a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP! 6 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US201 10059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
  • MBP maltose binding protein
  • DBD Lex A DNA binding domain
  • HSV herpes simplex virus
  • the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host. cell.
  • the invention further provides cells produced by such methods, and organisms (such as animals, plants, or fungi) comprising or produced from such cel ls.
  • a CRISPR enzyme in combi ation with (and optionally compiexed with) a guide sequence is delivered to a cell.
  • Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues.
  • Non-viral vector delivery systems include DNA plasniids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid compiexed with a delivery vehicle, such as a liposome.
  • Viral vector delivery systems include DN A and RNA viruses, which have either episomal or integrated genomes after delivery to the ceil.
  • Methods of non-viral delivery of ucleic acids mciude lipoiection, nucleofeetion, microinjection, biolistics, virosomes, liposomes, immunoliposomes, poiycation or lipid :nucleic acid co jugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
  • Lipoiection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectinTM).
  • Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administratio ) or target tissues (e.g. in vivo administration).
  • RNA or DNA viral based systems for the deliveiy of nucleic acids takes advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
  • Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo).
  • Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associaied and herpes simplex virus vectors for gene transfer.
  • Retroviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral tilers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LT s are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cel l to provide permanent transgene expression.
  • Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia vims (GaLV), Simian Immuiio deficiency vims (SIV), human immuno deficiency vims (HIV), and combinations thereof (see, e.g., Buchscher et al, J. Virol. 66:2731 -2739 (1992); Johann et al, J. Virol. 66: 1635-1640 (1992); Sommnerfelt ei al., Virol 176:58-59 (1990); Wilson et al, J. Virol 63:2374-2378 (1989); Miller et al, J. Virol.
  • MiLV murine leukemia virus
  • GaLV gibbon ape leukemia vims
  • SIV Simian Immuiio deficiency vims
  • HV human immuno deficiency vims
  • adenoviral based systems may be used.
  • Adenoviral based vectors are capable of very high transduction efficiency in man)? cell types and do not require ceil division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
  • Adeno-associated vims may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al,, Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641 ; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94: 1351 (1994), Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No.
  • Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ⁇ 2 cells or PA317 cells, which package retrovirus.
  • Viral vectors used in gene therapy are usually generated by producing a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide ⁇ ) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess 1TR sequences from the AAV genome which are required for packaging and integration into the host genome.
  • Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
  • the cell line may also be infected with adenovirus as a helper.
  • the helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
  • the helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination wit adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. Additional methods for the delivery of nucleic acids to cells are known to those skilled in the art. See, for example, US200300878 1 7, incorporated herein by reference.
  • a host cell is transiently or non-transiently transfecte with one or more vectors described herein.
  • a cell is transfected as it naturally occurs in a subject.
  • a cell that Is transfected is taken from a subject.
  • the cell is derived from cells taken from a subject, such as a cell line.
  • ceil lines for tissue culture are known in the art. Examples of cell lines include, but are not limited to, C8161 , CCRF-CEM, MOLT, mlMCD-3, NHDF, HeLa-S3, Huhl , Huh4, Huh7, Nl . ' V LC .
  • HASMC HASMC, HEKn, HEKa, MiaPaCell, Panel , PC-3, TF1 , CTLL-2, C 1 R, Rat6, CV 1, RPTE, A10, T24, J82, A375, ARH-77, Calul, SW480, SW620, S OV3, SK-UT, CaCo2, P388D1 , SEM-K2, WEHI-231 , HB56, TIB55, Jurkat, J45.01 , LRMB, Bcl-1 , BC-3, IC21 , DLD2, R.aw264.7, NRK, NRK-52E, MR.C5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A, BS-C-1 monkey kidney epithelial, BALB/ 3T3 mouse embryo fibroblast, 3T3 Swiss, 3T3-L1 , 132-d5 human fetal fibroblasts;
  • a cell transfeeted with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences.
  • a cel l transiently transfeeted with the components of a CRISPR system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CR1SPR complex, is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence.
  • cells transiently or non-transiently transfeeted with one or more vectors described herein, or cell lines derived from such ceils are used in assessing one or more test compounds.
  • one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant.
  • the transgenic animal is a mammal, such as a mouse, rat, or rabbit.
  • the organism or subject is a plant.
  • the organism or subject or plant is algae. Methods for producing transgenic plants and animals are known in the art, and generally begin with a method of cell transfeciion, such as described herein.
  • the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell.
  • the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • the invention provides a method of modifying expression of a polynucleotide in a eukaryotic ceil.
  • the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro.
  • the method comprises sampling a cell or population of cells from a human or non- human animal or plant (including micro-algae), and modifying the cell or cells. C alluring may occur at any stage ex vivo. The cell or cells may even be re-introduced into the non-human animal or plant (including micro-algae).
  • pathogens are often host-specific.
  • Fusarium oxysporum f. sp. lycopersici causes tomato wilt but attacks only tomato
  • Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability that gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants.
  • there can be non-host resistance e.g., the host and pathogen are incompatible.
  • Horizontal Resistance e.g., partial resistance against all races of a pathogen, typically controlled by many genes
  • Vertical Resistance e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes.
  • Plant and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural Variability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance.
  • the sources of resistance genes include native or foreign Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents.
  • plant breeders are provided with a new tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
  • the invention provides kits containing any one or more of the elements disclosed in the above methods and compositions.
  • the kit comprises a vector system and instructions for using the kit.
  • the vector system comprises (a) a first regulatory element operabiy linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme eompiexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence; and/or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence.
  • Elements may be provide individual ly or in combinations, and may be provided in any suitable container,
  • a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
  • Reagents may be provided in any suitable container.
  • a kit may provide one or more reaction or storage buffers.
  • Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyopiiiiized form).
  • a buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof.
  • the buffer is alkaline.
  • the buffer has a pH from about 7 to about 10.
  • the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element, in some embodiments, the kit comprises a homologous recombination template polynucleotide.
  • the invention provides methods for using one or more elements of a CRISPR system.
  • the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
  • the CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types.
  • modifying e.g., deleting, inserting, translocating, inactivating, activating
  • the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis.
  • An exemplary CRISPR complex comprises a CRISPR enzyme eompiexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
  • the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
  • the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
  • the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
  • the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
  • a gene product e.g., a protein
  • a non-coding sequence e.g., a regulatory polynucleotide or a junk DNA.
  • PAM protospacer adjacent motif
  • PAMs are typically 2-5 base pair sequences adjacent the protospacer (thai is, the target sequence) Examples of PAM sequences are given in the examples section beiow r , and the skilled person will be able to identify further PAM sequences for use with a given CRISPR enzyme.
  • the target polynucleotide of a CRISPR complex may include a number of disease- associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in US provisional patent applications 61 /736,527 and 61/748,427 having Broad reference BI-2011/008/WSGR Docket No. 44063-701.1 Gland BI- 201 1/008/WSGR Docket No. 44063-701 .102 respectively, both entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on December 12, 2012 and January 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
  • target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
  • target polynucleotides include a disease associated gene or polynucleotide.
  • a "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cel ls of a non disease control.
  • a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
  • the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
  • Parkinson's Disease x-Synuclein DJ-1; 1.RR 2: Parkin; PINK!
  • Hernophagocytic lynrphohistiocyiosis disorders PRF1, HPLH2,
  • BCL7A BCL7
  • Leukemia TALI, and oncology TCL5, SCL, TAL2, FLT3, NBS i, NBS, ZNFN1A1 , IKi, LYFi, diseases and disorders HOXD4, HQX4B, BCR, CML, PHL, ALL, ARNT, KRAS2.
  • RASK2 B-cell non-Hodgkin lymphoma
  • GMPS GMPS, AF10, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CHIC2, BTL, FLT3, KIT, PBT, LPP, NPM1, NUP214, D9S46E, CAN, CAIN, RIJNXl , CBFA2, AM I i .
  • CMKBR5, CCCKR5 CCR.5
  • Immunodeficiencies CD3E, CD3G, A CDA, AID, HIGM2, TNFRSF5, CD40, IJNG, DGU, HIGM4, TNFSF5.
  • CF CF, MRP7; Glycogen storage diseases (SLC2A2, GLUT2, G6PC, G6PT, G6PTI, GAA, LAMP2, LAMPB, AGL, GDE, GBE1, GYS2, PYGL, PFKM); Hepatic adenoma, 142330 (TCFl, HNF1 A, MODY3), Hepatic failure, early onset, and neurologic disorder (SCOD1, SCOl), Hepatic lipase deficiency (LIPC), Hepatoblastoma, cancer and carcinomas (CTNNBl , PDGFRL, PDGRL, PRLTS, AX I I , AXIN, CTNNB1, TP53, P53, LFS1, IGF2R, MPRI, MET, CASP8, MCH5; Medullary cystic kidney disease (UMOD, HNFJ, FJHN, MC D2, ADMCKD2); Phenylkeionuria (PAH, PKU1 ,
  • Muscular / Skeletal Becker muscular dystrophy (DMD, BMD, MYF6), Duchenne Muscular d seases and disorders Dystrophy (DMD, BMD); Eniery-Dreifuss muscular dystrophy (LMNA, LMN1, EMD2, FPU).
  • EMD2, FPLD, CMD1A Facioscapulohumeral muscular dystrophy (FSHMD 1 A, FS HD 1 A); Muscular dystrophy (FKRP, MDC 1 C,
  • LGMD2I L.AMA.2, LAMM, LARGE, KIAA0609, MDC ID, FCMD, TTID, MYOT, CAPN3, CANP3, DYSF, LGMD2B, SGCG, LGMD2C, DMDA1, SCG3, SGCA, ADL, DAG2, LGMD2D, DMDA2, SGCB, LGMD2E, SGCD, SGD, LGMD2F, CMD1L, TCA.P, LGMD.2G, CMDIN, TRIM32, HT2A, LGMD2H, FKRP, MDC1C. LGMD2I, TTN.
  • Neurological and ALS SOD1, ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal, diseases and VEGF-c); Alzheimer disease i ' APP, AAA, CVAP, ADl, APOE, AD2, disorders PSEN2, AD4, STM2, APBB2, FE65L1, NOS3, PLAU, URK, ACE,
  • DCPl ACEL MPO, PACIP1, PAXIP1L, PTIP, A2M, BLMH, BMH, PSEN1, AD3); Autism (Mecp2, B.ZRAP1, MDGA2, SemaSA, Neurexin 1, GLOl, MECP2, RTT, PPMX, MR 16, MRX79, NLGN3, NLGN4, IAA1260, AUTSX2); Fragile X Syndrome (F R2, FXR1, FXR2, mGLUR5); Huntington's disease and disease like disorders (HD, IT15, PRNP, PR1P, J PI 13.
  • Autism Mecp2, B.ZRAP1, MDGA2, SemaSA, Neurexin 1, GLOl, MECP2, RTT, PPMX, MR 16, MRX79, NLGN3, NLGN4, IAA1260, AUTSX2
  • Fragile X Syndrome F R2, FXR1, FXR2, mGLUR5
  • Parkinson disease (NR4A2, NUR 1, NOT, TINUR, SNCAIP, TBP, SCA17, SNCA, NACP, PARK I, PARK4, DJ1, PARK7, LRRK2, PARKS, ⁇ 1, PARK6, UCHL1, PARKS, SNCA, NACP, PARK1, PARK4, PRKN, P.ARK2, PDJ, DBH, NDUFV.2); Rett, syndrome (MECP.2, RTT, PPMX, MRX16, MRX79, CDKL5, STK9, MECP2, RTT, PPMX, MRX16, MRX79, x-Synuclein, DJ-1); Schizophrenia (Neuregulinl (Nrgl), Erb4 (receptor for Neuregulin), Complexinl (Cplxl), Tphl Tnq3tophan hydroxylase, Tph2, Tryptophan hydroxylase 2, Neurexin 1,
  • VLDLR VLDLR
  • Occular diseases and Age-related macular degeneration Abcr, Ccl2, Cc2, cp (ceruloplasmin), disorders Ti.mp3, cathepsinD, Vidir, Ccr2); Cataract. (CRYAA, CRYA1, CRYBB2,
  • IGF-1 Signaling IGF1; PRKCZ; ELK1; MAPKl; PTPN11; NEDD4; AKT2;
  • PIK3CA PRKCI; PTK2; FOS; PIK3CB; PIK3C3; MAPK8;
  • IGF1R insulin receptor
  • IRS1 MAPK3
  • IGFBP7 IGFBP7
  • KRAS PIK3C2A
  • PDPK1 MAP2K1; IGFBP2; SI N; JUN; CYR61; AKT3;
  • NRF2 ⁇ mediated PRKCE EP300; SOD2; PRKCZ; MAPKl; SQSTMl;
  • PRKDl PRKDl
  • MAPK3 KRAS
  • PRKCD PRKCD
  • GSTP1 GSTP1; MAPK9; FTL;
  • IGFIR insulin receptor RI
  • IL6R RELA
  • TLR4 PDGFRB
  • TNF RELB
  • IL8 IL8
  • PDGFRA NFKBI
  • TGFBR1 TGFBR1
  • SMAD4 VEGFA
  • BAX BAX
  • NRJP1 KRAS
  • PPARG RELA
  • STATS A TRAF2;
  • MAP2K1 MAP2K1; NFKBI; JUN; IL1R1; HSP90AA1
  • PRKD1 MAPK3; MAPK10; KRAS; MAPKl 3; PRKCD;
  • MAPK9 PIK3C2A
  • BTK PIK3C2A
  • MAPK14 TNF; RATI; FYN;
  • MAP2K2 MAP2K2; AKT1; PIK3R1; PDPK1; MAP2K1; AKT3;
  • PIK3C3 MAPK3; KRAS; RELA; SRC; PIK3C2A; RAF1;
  • PDPK1 PDPK1; STAT3; MAP2KI; NFKBI; BRAF; ATF4; AKT3;
  • Inositol Phosphate PRKCE Inositol Phosphate PRKCE; IRAKI; PRKAA2; EIF2AK2; PTEN; GRK6;
  • MAP2K1 MAP2K1; PAK3; ATM; TTK; CSNK1A1; BRAF; SGK
  • Glutathione Metabolism 11)1 12 GSTP1; ANPEP; ! l i l
  • Methionine Metabolism DNMT1 ; DNMT3B; AHCY; DNMT3A
  • Trpal Pome; Cgrp; Crf; Pka; Era; Nr2b; TRPM5; Prkaca;
  • Prkacb Prkarl a
  • Prkar2a Prkacb
  • Wnt2b Wnt3a; Wnt4; Wnt5a; Wnt6; Wnt7b; Wnt8b;
  • Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairmg particular mutations associated with DNA repeat instability and neurological disorders (Robert D, Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct 13, 2011 - Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeal instability: role of RNA 3 ⁇ 4 DNA hybrids. Mclvor EI, Polak U, Napierala M. RNA Biol. 2010 Sep-Oct;7(5):551-8). The CRISPR- Cas system may be harnessed to correct these defects of genomic instability.
  • a further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
  • Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence, A few cases of the disease may be caused by mutations in genes yet to be identified. The disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression.
  • the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
  • the genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussier-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NINDS Colpocephaly. These diseases are further described on the website of the National Institutes of Health under the subsection Genetic Brain Disorders.
  • the condition may be neoplasia.
  • the genes to be targeted are any of those listed in Table A (in this case PTEN and so forth).
  • the condition may be Age-related Macular Degeneration,
  • the condition may be a Schizophrenic Disorder.
  • the condition may be a Trinucleotide Repeat Disorder.
  • the condition may be Fragile X Syndrome.
  • the condition may be a Secretase Related Disorder.
  • the condition may be a Prion - related disorder.
  • the condition may be ALS.
  • the condition may be a drug addiction. In some embodiments, the condition may be Autism. In some embodiments, the condition may be Alzheimer's Disease. In some embodiments, the condition may be inflammation. In some embodiments, the condition may be Parkinson 's Disease.
  • proteins associated with Parkinson 's disease include but are not limited to a-synuclein, DJ ⁇ 1 , LRRK2, PIN 1 , Parkin, UCHL1 , Synphilin-1 , and XL RR i .
  • Examples of addiction-related proteins may include ABAT for example.
  • inflammation-related proteins may include the monocyte ehemoattraetant protein- 1 (MCP1 ) encoded by the Ccr2 gene, the C-C chemokine receptor type 5
  • CCR5 encoded by the Ccr5 gene
  • FCGR2b also termed CD32
  • FCERl g Fc epsi lon Ri g
  • cardiovascular diseases associated proteins may include IL1B (mterieiikm 1 , beta), XDH (xanthine dehydrogenase), TPS 3 (tumor protein p53 ), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), TLA (interieukm 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTS (cathepsin K), for example.
  • Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme I (UBA1) encoded by the UBA1 gene, or the NEDD8 ⁇ activating enzyme El catalytic subunit protein (UBE1 C) encoded by the UBA3 gene, for example.
  • VLDLR very low density lipoprotein receptor protein
  • UBA1 ubiquitin-like modifier activating enzyme I
  • UBE1 C El catalytic subunit protein
  • proteins associated Autism Spectrum Disorder may include the benzodiazepine receptor (peripheral) associated protein 1 (BZRA P1 ) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog 1 protein (FXR 1 ) encoded by the FXR1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
  • BZRA P1 benzodiazepine receptor (peripheral) associated protein 1
  • AFF2 AF4/FMR2 family member 2 protein
  • FXR 1 fragile X mental retardation autosomal homolog 1 protein
  • FXR2 fragile X mental retardation autosomal homolog 2 protein
  • proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABCl) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, or the chemokine (C-C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
  • ABCl sub-family A
  • APOE apolipoprotein E protein
  • CCL2 chemokine Ligand 2 protein
  • proteins associated Schizophrenia may include NRG1 , ErbB4, CPLXl , TPHl , TPH2, NRXNl , GS 3A, BDNF, DISC I , GSK3B, and combinations thereof.
  • proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v-erb-b2 erythroblastic leukemia viral oncogene homoiog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homoiog 3), ERBB4 (v-erb ⁇ b2 erythroblastic leukemia viral oncogene homoiog 4), Notch 1, Notch2, Notch 3, or Notch 4, for example.
  • ATM ataxia telangiectasia mutated
  • ATR ataxia telangiectasia and Rad3 related
  • EGFR epidermatitise
  • ERBB2 v-erb-b2 erythroblastic leukemia viral oncogene homoiog 2
  • ERBB3 v-erb-b2 ery
  • proteins associated with a secretase disorder may include PSENEN (presenilis enhancer 2 homoiog (C. elegans)), CTSB (cathepsin B), PSEN1 (preseniSin 1 ), APP (amyloid beta (A4) precursor protein), APH1B (anterior pharynx defective 1 homoiog B (C, elegans)), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cleaving enzyme 1), for example.
  • proteins associated with Amyotrophic Lateral Sclerosis may include SODl (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascuiar endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
  • proteins associated with prion diseases may include SODl (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA. (vascular endothelial growth factor A), VAGFB (vascuiar endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
  • proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-Macroglobulin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Actin alpha 2 smooth muscle aorta), ADAM22 (ADAM metailopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRAID (Alpha- ID adrenergic receptor for Alpha- I D adrenoreceptor), for example.
  • A2M Alpha-2-Macroglobulin
  • AATF Apoptosis antagonizing transcription factor
  • ACPP Acid phosphatase prostate
  • ACTA2 Actin alpha 2 smooth muscle aorta
  • ADAM22 ADAM metailopeptidase domain
  • ADORA3 Addenosine A3 receptor
  • ADRAID Alpha- ID adrenergic receptor for Alpha- I D adrenoreceptor
  • proteins associated with Immunodeficiency may include A2M [aipha-2- macroglobulinj; AANAT [arylalkylamine N-acetyltransferase] ; ABCA1 [ATP -binding cassette, sub-family A (ABC1), member 1]; ABCA2 [ATP-binding cassette, sub-family A (ABO), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3]; for example.
  • A2M aipha-2- macroglobulinj
  • AANAT arylalkylamine N-acetyltransferase
  • ABCA1 ATP -binding cassette, sub-family A (ABC1), member 1]
  • ABCA2 ATP-binding cassette, sub-family A (ABO), member 2]
  • ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3] for example.
  • proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntingtm), or DMPK (dystrophia myotonic a-protem kinase), FXN (frataxin), ATXN2 (ataxin 2), for example.
  • proteins associated with Neurotransmission Disorders include SST (somatostatin), NOSI (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, a!pha-2A-, receptor), ADRA2C (adrenergic, alpha-2C-, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamme (serotonin) receptor 2C), for example.
  • neurodevelopmental-associated sequences include A2BP1 [ataxin 2- binding protein 1 ], AADAT [ammoadipate aminotransferase] , AANAT [arylalkyiamine N- acetyltransferase], ABAT [4-aminobutyrate aminotransferase], ABCA 1 [ATP-binding cassette, sub-family A (ABO), member 1], or ABC A i 3 [ATP-binding cassette, sub-family A (ABO), member 13], for example.
  • A2BP1 ataxin 2- binding protein 1
  • AADAT ammoadipate aminotransferase
  • AANAT arylalkyiamine N- acetyltransferase
  • ABAT 4-aminobutyrate aminotransferase
  • ABCA 1 ATP-binding cassette, sub-family A (ABO), member 1
  • ABC A i 3 ATP-binding cassette, sub-family A (ABO), member 13
  • FIG. 1 Aieardi-Goutieres Syndrome; Alexander Disease; Allan-Herndon-Dudiey Syndrome; POLG-Related Disorders; Alpha-Mannosidosis (Type II and III); Alstrom Syndrome; Angelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta- r rhalassemia; Bilateral Optic Atrophy and (Infantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFS1]; Cerebrotcndinous Xanthomatosis; Cornelia de Lange Syndrome; MAPT-Reiated Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dyst
  • the present system can be used to target any polynucleotide sequence of interest.
  • Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
  • Example I CRISP R Complex Activity in the Nucleus of a Eukaryotic Cell
  • An example type II CRISPR system is the type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Casl, Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each).
  • DSB targeted DNA double-strand break
  • Figure 2A First, two non-coding RNAs, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus.
  • tracrRNA hybridizes to the direct repeats of pre- crRNA, which is then processed into mature crRNAs containing individual spacer sequences.
  • the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heterodupiex formation between the spacer region of the crRNA and the protospacer DNA.
  • Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer ( Figure 2A).
  • This example describes an example process for adapting this RNA-programmable nuclease system to direct CRISPR complex activity in the nuclei of eukaryotic cel ls.
  • HEK cell line HEK 293FT Human embryonic kidney (HEK) cell line HEK 293FT (Life Technologies) was maintained in Duibeeeo's modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (HyClone), 2 m VI GlutaMAX ( Life Technologies), lOOU/mL penicillin, and 100p.g/mL streptomycin at 37°C with 5% C0 2 incubation.
  • DMEM Duibeeeo's modified Eagle's Medium
  • HyClone fetal bovine serum
  • 2 m VI GlutaMAX Life Technologies
  • streptomycin 100p.g/mL streptomycin at 37°C with 5% C0 2 incubation.
  • N2A cell line ATCC was maintained with DMEM supplemented with 5% fetal bovine semm (HyClone), 2mM GlutaMAX (Life Technologies), lOOU/mL penicillin, and l OQ g/mL streptomycin at 37°C with 5% CO;.
  • HEK 293 FT or N2A cells were seeded into 24-wel! plates (Corning) one day prior to transfection at a density of 200,000 ceils per well. Cells were transfected using Lipofectamine
  • HEK 293FT or N2A cells were transfected with plasmid DNA as described above.
  • the cells were incubated at 37°C for 72 hours before genomic DNA extraction.
  • the genomic region surrounding a CRISPR target site for each gene was PGR amplified, and products were purified using QiaQuick Spin Column (Qiagen) following manufacturer's protocol.
  • a total of 00ng of the purified PGR products were mixed with 2 ⁇ 1 10 Taq polymerase PGR buffer (Enzymaties) and ultrapure water to a final volume of 20 ⁇ 1, and subjected to a re-annealing process to enable heterodupiex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute.
  • HE 293FT and N2A cells were transfected with plasmid DNA, and incubated at 37°C for 72 hours before genomic DNA extraction as described above.
  • the target genomic region was PGR amplified using primers outside the homology arms of the homologous recombination (HR) template.
  • PGR products were separated on a 1% agarose gel and extracted with MinElute GelExtraetion Kit (Qiagen). Purified products were digested with Hmdlll (Fermentas) and analyzed on a 6% Novex TBE poly-acrylamide gel (Life Technologies).
  • RNA secondary structure prediction was performed using the online webserver RNAfold developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et at, 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62).
  • Elements of the S. pyogenes CRISPR locus 1 sufficient for CRISPR activity were reconstituted in E. coli using pCRISPR plasmid (schematically illustrated in Figure 10A), pCRISPR contained tracrRNA, SpCas9, and a leader sequence driving the crRNA array.
  • Spacers also referred to as "guide sequences” were inserted into the crRNA array between Bsal sites using annealed oligonucleotides, as illustrated.
  • Challenge plasmids used in the interference assay were constructed by inserting the protospacer (also referred to as a "target sequence") sequence along with an adjacent CRISPR motif sequence (PAM) into pUC19 (see Figure 10B).
  • FIG. 1 provides a schematic representation of the interference assay.
  • Chemical ly competent E. coli strains already carrying pCRISPR and the appropriate spacer were transformed with the challenge plasmid containing the corresponding protospacer-PAM sequence.
  • pUC19 was used to assess the transformation efficiency of each pCRIS PR-carrying competent strain.
  • CRISPR activity resulted in cleavage of the pPSP piasmid carrying the protospacer, precluding ampicillin resistance otherwise conferred by pUC19 lacking the protospacer.
  • Figure ! OD illustrates competence of each pCRISPR- carrying E. cofi strain used in assays illustrated in Figure 4C.
  • FJEK 293FT cells were maintained and transfected as stated above. Cells were harvested by trypsinization followed by washing in phosphate buffered saline (PBS). Total cell RNA was extracted with TRI reagent (Sigma) following manufacturer's protocol. Extracted total RNA was quantified using Naonodrop (Thermo Scientific) and normalized to same concentration.
  • RNAs were mixed with equal volumes of 2X loading buffer (Ambion), heated to 95°C for 5 min, chilled on ice for 1 min, and then loaded onto 8% denaturing polyacrylamide gels (SequaGel, National Diagnostics) after pre-running the gel for at least 30 minutes. The samples were electrophoresed for 1.5 hours at 40W limit. Afterwards, the RNA was transferred to Hybond N+ membrane (GE Healthcare) at 300 mA in a semi-dry transfer apparatus (Bio-rad) at room temperature for 1 .5 hours. The RNA was crosslinked to the membrane using autocrossiink button on Stratagene UV Crosslinker the Stratalinker (Stratagene).
  • the membrane was pre-hyhridized in ULTRAhyb-Oligo Hybridization Buffer (Ambion) for 30 min with rotation at 42°C, and probes were then added and hybridized overnight. Probes were ordered from IDT and labeled with [gamma- "" ?] ATP s erk in Elmer) with T4 polynucleotide kinase (New England Biolabs). The membrane was washed once with pre-warmed (42°C) 2xSSC, 0.5% SDS for 1 min followed by two 30 minute washes at 42°C. The membrane was exposed to a phosphor screen for one hour or overnight at room temperature and then scanned with a phosphorimager (Typhoon).
  • CRISPR locus elements including tracrRNA, Cas9, and leader were PGR amplified from Streptococcus pyogenes SF370 genomic DNA with flanking homology arms for Gibson. Assembly. Two Bsal type IIS sites were introduced in between two direct repeats to facilitate easy insertion of spacers ( Figure 9). PGR products were cloned into EcoRV-digested pACYC184 downstream of the tet promoter using Gibson Assembly Master Mix (NEB). Other endogenous CRISPR system elements were omitted, with the exception of the last 50bp of Csn2.
  • Oligos Integrated DNA Technology encoding spacers with complimentary overhangs were cloned into the i&al-digested vector pDCOOO (NEB) and then ligated with T7 ligase (Enzymatics) to generate pCRISPR plasmids.
  • Challenge pfasmids containing spacers with PAM sequences also referred to herein as "CRISPR motif sequences" were created by ligating hybridized oligos carrying compatible overhangs (Integrated DNA Technology) into BanMl- digested pUC19. Cloning for all constructs was performed in E. coli strai JM109 f'Zymo Research).
  • pCRJSPR-carrying cells were made competent using the Z-Competent E. coli Transformation Kit and Buffer Set (Zymo Research, T3001 ) according to manufacturer's instructions. In the transformation assay, 50uL aliquots of competent cells carrying pCRISPR were thawed on ice and tra sformed with lug of spacer plasmid or pUC19 on ice for 30 minutes, followed by 45 second heat shock at 42°C and 2 minutes on ice.
  • a version of SpCas9 with an NLS attached to both N- and C-termini (2xNLS-SpCas9) was also generated. Constructs containing NLS-fused SpCas9 and SpRNase III were transfected into 293FT human embryonic kidney (HEK) cells, and the relative positioning of the NLS to SpCas9 and SpRNase III was found to affect their nuclear localization efficiency. Whereas the C -terminal NLS was sufficient to target SpRNase II I to the nucleus, attachment of a single copy of these particular NLS's to either the N- or C -terminus of SpCas9 was unable to achieve adequate nuclear localization in this system. In this example, the C-terminal.
  • NLS was that of nucleoplasmin (KRPAAT KAGQAKKKK), and the C-terminal NLS was that of the SV40 large T-antigen (P KKRKV).
  • P KKRKV SV40 large T-antigen
  • the tracrRNA from the CRISPR locus of S. pyogenes SF370 has two transcriptional start sites, giving rise to two transcripts of 89 ⁇ nucleotid.es (nt) and 171nt that are subsequently processed into identical 75nt mature tracrR As.
  • the shorter 89nt tracrRNA was selected for expression in mammalian cells (expressio constructs illustrated in Figure 7 A, with functionality as determined by results of the Surveyor assay shown in Figure 7B). Transcription start, sites are marked as +1, and transcription terminator and the sequence probed by northern blot are also indicated. Expression of processed tracrRNA was also confirmed by Northern blot.
  • Figure 7C shows results of a Northern blot analysis of total RNA extracted from 293FT cells transfected with U6 expression constructs carrying long or short tracrRNA, as well as SpCas9 and DR- EMX1(1)-DR.
  • Left and right panels are from 293FT cells transfected without or with SpRNase III, respectively.
  • U6 indicate loading control blotted with a probe targeting human U6 snRNA.
  • Transfection of the short tracrRNA expression construct led to abundant levels of the processed form of tracrRNA ( ⁇ 75bp). Very low amounts of long tracrRNA are detected on the Northern blot.
  • RNA polymerase Ill-based U6 promoter was selected to drive the expression of tracrRNA ( Figure 2C).
  • a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "tracr-mate sequences"; Figure 2C).
  • the initial spacer was designed to target a 33-base-pair (bp) target site (30-bp proto spacer plus a 3 -bp CRISPR motif (PAM) sequence satisfying the NGG recognition motif of Cas9) in the human EMXl locus ( Figure 2C), a key gene in the development of the cerebral cortex.
  • bp 33-base-pair
  • PAM 3 -bp CRISPR motif
  • HEK 293FT cells were transfected with combinations of CRISPR components. Since DSBs in mammalian nuclei are partially repaired by the non-homologous end joining (NHEJ) pathway, which leads to the formation of indels, the Surveyor assay was used to detect potential cleavage activity at the target.
  • NHEJ non-homologous end joining pathway
  • Figure 14 provides an additional Northern blot analysis of crRNA processing in mammalian ceils.
  • Figure 14A illustrates a schematic showing the expression vector for a single spacer flanked by two direct repeats (DR-EMXl(i)-DR). The 30bp spacer targeting the human EMX1 locus protospacer 1 (see Figure 6) and the direct repeat sequences are shown in the sequence beneath Figure 14 A. The line indicates the region whose reverse-complement sequence was used to generate Northern blot probes for EMX1(1) crRNA detection.
  • Figure 14B shows a Northern blot analysis of total RNA extracted from 293 FT cells transtected with U6 expression constructs carrying DR-EMX 1(1 )-DR.
  • DR-EMX1 (1 )-DR was processed into mature crRNAs only in the presence of SpCas9 and short tracrRNA and was not dependent on the presence of SpRNase III.
  • the mature crRNA detected from traiisfected 293FT total RNA is ⁇ 33bp and is shorter than the 39-42bp mature crRNA from S, pyogenes.
  • Figure 2 illustrates the bacterial CRISPR system described in this example.
  • Figure 2 A illustrates a schematic showing the CRISPR locus 1 from Streptococcus pyogenes SF370 and a proposed mechanism of CRISPR -mediated DNA cleavage by this system.
  • Mature crRNA processed from the direct repeat-spacer array directs Cas9 to genomic targets consisting of complimentary protospacers and a protospacer-adjacent motif (PAM).
  • PAM protospacer-adjacent motif
  • Cas9 mediates a double-strand break in the target DNA.
  • Figure 2B illustrates engineering of S.
  • FIG. 2C illustrates mammalian expression of SpCas9 and SpRNase 111 driven by the constitutive EFla promoter and tracrRNA and pre-crRNA array (DR-Spacer-DR) driven by the RNA Pol3 promoter U6 to promote precise transcription initiation and termination.
  • DR-Spacer-DR pre-crRNA array
  • FIG. 2D illustrates surveyor nuclease assay for SpCas9-mediated minor insertions and deletions.
  • SpCas9 was expressed with and without SpRNase III, tracrRNA, and a pre-crRNA array carrying the EMX1- target spacer.
  • Figure 2E illustrates a schematic representation of base pairing between target locus and EMXl -targeting crRNA, as well as an example chromatogram showing a micro deletion adjacent to the SpCas9 cleavage site.
  • Figure 2F illustrates mutated alleles identified from sequencing analysis of 43 clonal amplicons showing a " variety of micro insertions and deletions. Dashes indicate deleted bases, and non-aligned or mismatched bases indicate insertions or mutations. Scale bar ::: lOjim.
  • a chimeric crRNA-tracrRNA hybrid desig was adapted, where a mature crRNA (comprising a guide sequence) is fused to a partial tracrRNA via a stem-loop to mimic the natural crRNA:tracrRNA duplex (Figure 3A).
  • a bicistronic expression vector was created to drive co- expression of a chimeric RNA and SpCas9 in transfected ceils ( Figures 3 A and 8).
  • Figure 9 provides schematic illustrations of bicistronic expression vectors for pre- crRNA array ( Figure 9 A) or chimeric crRNA (represented by the short line downstream of the guide sequence insertion site and upstream of the EF l a promoter in Figure 9B) with hSpCas9, showing locationo of various elements and the point of guide sequence insertion.
  • the expanded sequence around the location of the guide sequence insertion site in Figure 9B also shows a partial DR sequence (GTTTAGAGCTA) and a partial tracrRNA sequence (TAGCAAGTTAAAATAAGGCTAGTCCGTTTTT).
  • Guide sequences can be inserted between Bbsl sites using annealed oligonucleotides. Sequence design for the oligonucleotides are shown below the schematic illustrations in Figure 9, with appropriate ligation adapters indicated.
  • WPRE represents the Woodchuck hepatitis virus post-transcription al regulatory element. The efficiency of chimeric RNA-mediated cleavage was tested by targeting the same EMXl locus described above. Using both Surveyor assay and Sanger sequencing of amplicons, Applicants confirmed that the chimeric RNA design facilitates cleavage of human EMXl locus with approximately a 4.7% modification rate (Figure 4).
  • Protospacers on the sense and anti-sense strands are indicated above and below the DNA sequences, respectively.
  • a modification rate of 6.3% and 0.75% was achieved for the human P VALB and mouse Th loci respectively, demonstrating the broad applicabi lity of the CRISPR system in modifying different loci across multiple organisms ( Figures 3B and 6). While cleavage was only detected with one out of three spacers for each locus using the chimeric constructs, all target sequences were cleaved with efficiency of indel production reaching 27%> when using the co-expressed pre-crRNA arrangement (Figure 6).
  • Figure 13 provides a further illustration that SpCas9 can be reprogrammed to target multiple genomic loci in mammalian cells.
  • Figure 13A provides a schematic of the human EMXl Socus showing the location of five protospacers, indicated by the underlined sequences.
  • Figure 13B provides a schematic of the pre-crRNA/trcrRNA complex showing hybridization between the direct repeat region of the pre-crRNA and tracrRNA (top), and a schematic of a chimeric RNA design comprising a 20bp guide sequence, and tracr mate and tracr sequences consisting of partial direct repeat and tracrRNA sequences hybridized in a hairpin structure (bottom).
  • Figure 3 illustrates example expression vectors.
  • Figure 3 A provides a schematic of a bi-cistronic vector for driving the expression of a synthetic crRNA-tracrRNA chimera (chimeric RNA) as well as SpCas9.
  • the chimeric guide RNA contains a 20-bp guide sequence corresponding to the protospacer in the genomic target site.
  • the folding algorithm produced an output with each base colored according to its probability of assuming the predicted secondary structure, as indicated by a rainbow scale that is reproduced in Figure 3B in gray scale.
  • FIG 44 Further vector designs for SpCas9 are shown in Figure 44, which illustrates single expression vectors incorporating a U6 promoter linked to an insertion site for a guide oligo, and a Cbh promoter linked to SpCas9 coding sequence.
  • the vector shown in Figure 44b includes a tracrRNA coding sequence linked to an HI promoter.
  • Figure 4A illustrates results of a Surveyor nuclease assay comparing the cleavage efficiency of Cas9 when paired with different mutant chimeric RNAs, Single-base mismatch up to 12-bp 5' of the PAM substantially abrogated genomic cleavage by SpCas9, whereas spacers with mutations at farther upstream positions retained activity against the original protospacer target ( Figure 4B).
  • SpCas9 has single-base specificity within the last 12-bp of the spacer. Furthermore, CRISPR is able to mediate genomic cleavage as efficiently as a pair of TALE nucleases (TALEN) targeting the same EMXl protospacer.
  • RNA to program sequence-specific DNA cleavage defines a new class of genome engineering tools for a variety of research and industrial applications.
  • CRISPR system can be further improved to increase the efficiency and versatility
  • Optimal Cas9 activity may depend on the availability of free Mg " at levels higher than that present in the mammalian nucleus (see e.g. Jinek et al, 2012, Science, 337:816), and the preference for an NGG motif immediately downstream of the protospacer restricts the ability to target on average every 12-bp in the human genome ( Figure 1 1 , evaluating both plus and minus strands of human chromosomal sequences).
  • FIG. 12 illustrates adaptation of the Type II CRISPR system from CRISPR 1 of Streptococcus thennophilus LMD-9 for heterologous expression in mammalian cells to achieve CRISPR-mediated genome editing.
  • Figure 12A provides a Schematic il lustration of CRISPR 1 from S. thennophilus LMD-9.
  • Figure 12B illustrates the design of an expression system for the S. thermophilus CRISPR system. Human eodon-optimized hSiCas is expressed using a constitutive EFla promoter.
  • tracrRNA and crRNA are expressed using the U6 promoter to promote precise transcription initiation. Sequences from the mature crRNA and tracrRNA are illustrated. A single base indicated by the lower case "a" in the crRNA sequence is used to remove the polyU sequence, which serves as a RNA polIII transcriptional terminator.
  • Figure 12C provides a schematic showing guide sequences targeting the human EMX1 locus as well as their predicted secondary structures. The modification efficiency at each target site is indicated below the RNA secondary structures. The algorithm generating the structures colors each base according to its probability of assuming the predicted secondary structure, which is indicated by a rainbow scale reproduced in Figure 12C in gray scale.
  • Figure 12D shows the results of hStCas9-mediated cleavage in the target locus using the Surveyor assay.
  • RNA guide spacers 1 and 2 induced 14% and 6.4%, respectively.
  • Statistical analysis of cleavage activity across biological replica at these two protospacer sites is also provided in Figure 6.
  • Figure 16 provides a schematic of additional protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR system in the human EMX! locus. Two protospacer sequences are highlighted and their corresponding PAM sequences satisfying NNAGAAW motif are indicated by underlining 3' with respect to the corresponding highlighted sequence. Both protospacers target the anti-sense strand.
  • Example 3 Sample target sequence selection algorithm.
  • a software program is designed to identify candidate CRISPR target sequences on both strands of an input DNA sequence based on desired guide sequence length and a CRISPR motif sequence (PAM) for a specified CRISPR enzyme.
  • PAM CRISPR motif sequence
  • target sites for Cas9 from S. pyogenes, with PAM sequences NGG may be identified by searching for 5'-N x -NGG-3' both on the input sequence and on the reverse-complement of the input.
  • target sites for Cas9 of S. thermophilus CRISPR 1, with PAM sequence NNAGAAW may be identified by searching for 5 '-N x -N AGAAW-3 ' both on the input sequence and on the reverse-complement of the input.
  • target sites for Cas9 of S. thermophihis CRISPR3, with PAM sequence NGGNG may be identified by searching for 5'-N x - GGNG-3' both on the input sequence and on the reverse-complement of the input.
  • the value "x" in N x . may be fixed by the program or specified by the user, such as 20.
  • the program filters out sequences based on the number of times they appear in the relevant reference genome.
  • the filtering step may be based on the seed sequence.
  • results are filtered based on the number of occurrences of the seed:PA sequence in the relevant genome. The user may be allowed to choose the length of the seed sequence.
  • the user may also be allowed to specify the number of occurrences of the seed:PAM sequence in a genome for purposes of passing the filter.
  • the default is to screen for unique sequences. Filtration level is altered by changing both the length of the seed sequence and the number of occurrences of the sequence in the genome.
  • the program may in addition or alternatively provide the sequence of a guide sequence complementary to the reported target sequence(s) by providing the reverse complement of the identified target sequence(s).
  • chimeric RNAs comprising a guide sequence, a tracr mate sequence, and a tracr sequence in a single transcript
  • Figure 18a illustrates a schematic of a bicistronic expression vector for chimeric RNA.
  • Cas9 is driven by the CBh promoter and the chimeric RNA is driven by a U6 promoter.
  • the chimeric guide RNA consists of a 20bp guide sequence (Ns) joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript), which is truncated at various positions as indicated.
  • Protospacer IDs and their corresponding genomic target, protospacer sequence, PAM sequence, and strand location are provided in Table D. Guide sequences were designed to be com lementary to the entire protospacer sequence in the case of separate transcripts in the hybrid system, or only to the underlined portion in the case of chimeric RNAs.
  • HEK cell line 293FT Human embryonic kidney (HEK) cell line 293FT (Life Technologies) was maintained in Dulbecco's modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (HyClone), 2mM GlutaMAX (Life Technologies), lQQU/mL penicillin, and IQQjig/mL streptomycin at 37°C with 5% C0 2 incubation. 293FT cells were seeded onto 24-well plates (Coming) 24 hours prior to transfection at a density of 150,000 ceils per well. Cells were transfected using Lipofectamine 2000 (Life Technologies) following the manufacturer's recommended protocol. For each well of a 24- well plate, a total of 500ng plasmid was used.
  • DMEM Dulbecco's modified Eagle's Medium
  • HyClone fetal bovine serum
  • 2mM GlutaMAX Life Technologies
  • lQQU/mL penicillin lQQU/mL penicillin
  • SURV EY OR assay for genome modification [00229] 293 FT cells were transfected with plasmid DNA as described above. Cells were incubated at 37°C for 72 hours post-transfection prior to genomic DNA extraction. Genomic DNA was extracted using the QuickExtract DNA Extraction Solution (Epicentre) following the manufacturer's protocol. Briefly, pelleted cells were resuspended in QuickExtract solution and incubated at 65°C for 15 minutes and 98°C for 10 minutes. The genomic region flanking the CRISPR target site for each gene was PGR amplified (primers listed in Table E), and products were purified using QiaQuick Spin Column (Qiagen) following the manufacturer ' s protocol.
  • 400ng total of the purified PCR products were mixed with 2 ⁇ 1 10X Taq DNA Polymerase PGR buffer (Enzymatics) and ultrapure water to a final volume of 20 ⁇ 1, and subjected to a re- annealing process to enable heteroduplex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute.
  • products were treated with SURVEYOR nuclease and SURVEYOR enhancer S (Transgcnomies) following the manufacturer's recommended protocol, and analyzed on 4-20% Novex TBE poly-acrylamide gels (Life Technologies). Gels were stained with SYBR Gold DNA stain (Life Technologies) for 30 minutes and imaged with a Gel Doc gel imaging system (Bio-rad). Quantification was based on relative band intensities.
  • each SpCas9 target site was operationally defined as a 20bp sequence followed by an NGG protospacer adjacent motif (PAM) sequence, and we identified all sequences satisfying this 5'-N2o-NGG-3' definition on all chromosomes.
  • PAM NGG protospacer adjacent motif
  • a 'seed' sequence which can be, for example, approximately 1 1 -12bp sequence 5' from the PAM sequence
  • 5 '-NNNNNNN N -NGG-3 ' sequences were selected to be unique in the relevant genome. All genomic sequences were downloaded from the UCSC Genome Browser (Human genome hgl9, Mouse genome mm9, Rat genome rn5, Zebrafish genome danRer?, D. melanogaster genome dm4 and C. elegans genome cel O). The full search results are available to browse using UCSC Genome Browser information. An example vi sualization of some target si tes in the human genome is provided in Figure 21.
  • Chimeric RNAs containing longer fragments of wild-type tracrRN A (chiRNA(+67) and chiRNA(+85)) mediated DNA cleavage at all three EMX1 target sites, with chiRNA(+85) in particular demonstrating significantly higher levels of DNA cleavage than the corresponding crRNA/tracrRNA hybrids that expressed guide and tracr sequences in separate transcripts ( Figures 18b and 19a).
  • Two sites in the PVALB locus that yielded no detectable cleavage using the hybrid system (guide sequence and tracr sequence expressed as separate transcripts) were also targeted using chiRNAs.
  • chiRNA(+67) and chiRNA(+85) were able to mediate significant cleavage at the two PVALB protospacers ( Figures 1 8c and 19b).
  • chimeric RNA may be loaded onto Cas9 more efficiently than its native hybrid counterpart.
  • all predicted unique target sites for the S. pyogenes Cas9 were computationally identified in the human, mouse, rat, zebra fish, C. elegans, and D. melanogaster genomes.
  • Chimeric RNAs can be designed for Cas9 enzymes from other microbes to expand the target space of CR ISPR RNA -programmable nucleases.
  • Figure 22 illustrates an exemplary bicistro ic expression vector for expression of chimeric RNA including up to the +85 nucleotide of wild-type tracr RNA sequence, and SpCas9 with nuclear localization sequences.
  • SpCas9 is expressed from a CBh promoter and terminated with the bGH po yA signal (bGH pA).
  • the expanded sequence illustrated immediately below the schematic corresponds to the region surrounding the guide sequence insertion site, and includes, from 5' to 3', 3 '-portion of the U6 promoter (first shaded region), Bbsl cleavage sites (arrows), partial direct repeat (tracr mate sequence GTTTTAGAGCTA, underlined), loop sequence GAAA, and +85 tracr sequence (underlined sequence following loop sequence).
  • An exemplary guide sequence insert is illustrated below the guide sequence insertion site, with nucleotides of the guide sequence for a selected target represented by an "N".
  • NLS-SpCas9-EGFP NLS-SpCas9-EGFP
  • GMRKPAFLSGEQKKATvT LLFKTTSIRKV KQLKEDYFKK]ECFDSVEISGVEDRFNASL
  • GIRD QSG ILDFL SDGFANRNFMQLJHDDSL FKEDIQKAQ ⁇ SGQGDSLHEH:IANLA
  • GEGRPYEGTQTAKLKYT GGPLPFAWDILSPQFMYGS AYVKHPADIPDYL LSFPEGF
  • NLS-SpCas9ii-NLS (the D10A nickase mutation is lowercase):
  • N guide sequence; first underline :::: tracr mate sequence; second underline ::: tracr sequence; bold ::::: terminator)
  • Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PA M of
  • N guide sequence; first underline :::: tracr mate sequence; second underline ::: tracr sequence; bold :::: terminator)
  • Example chimeric RNA for S. thennophilus LMD-9 CRISPR1 Cas9 (with PAM of NNAGAAW)
  • N guide sequence
  • Example chimeric RNA for S. thermophilus LMD-9 CRISPR1 Cas9 (with PAM of
  • Example chimeric RNA for S. thermophilus LMD-9 CRISP 3 Cas9 (with PAM of NGGNG)
  • Example 5 RNA-guided editing of bacterial genomes using CRISPR-Cas systems
  • Applicants used the CRIS PR-associated endonuclease Cas9 to introduce precise mutations in the genomes of Streptococcus pneumoniae and Escherichia coli.
  • the approach relied on Cas9-directed cleavage at the targeted site to kill unmutated cells and circumvented the need for selectable markers or counter-selection systems.
  • Cas9 specificity was reprogrammed by changing the sequence of short CRISPR RNA (crRNA) to make si gle- and muiti-iiucieotide changes carried on editing templates. Simultaneous use of two erRNAs enabled multiplex mutagenesis. In S.
  • mutagenesis in eukaryotes is achieved by the use of sequence-specific nucleases that promote homologous recombination of a template DNA containing the mutation of interest.
  • Zinc finger nucleases ZFNs
  • transcription activator-like effector nucleases TALE s
  • mutagenesis methods either introduce a selection marker in the edited locus or require a two-step process that includes a counter- selection system.
  • phage recombination proteins have been used for recombineering, a tech ique that promotes homologuous recombination of linear DNA or oligonucleotides.
  • recombineering efficiency can be relatively low (0.1 -10% for point mutations down to 10 "5 -10 "6 for larger modifications), in many cases requiring the screening of a large number of colonies. Therefore new technologies that are affordable, easy to use and efficient are still in need for the genetic engineering of both eukaryottc and prokaryotic organisms.
  • CRISPR loci are composed of a series of repeats separated by 'spacer' sequences that match the genomes of bacteriophages and other mobile genetic elements.
  • the repeat-spacer array is transcribed as a long precursor and processed within repeat sequences to generate small crRNA that specify the target sequences (also known as protospacers) cleaved by CRISPR systems.
  • Cas9 is a dsDNA endonuclease that uses a crRNA guide to specify the site of cleavage. Loading of the crRNA guide onto Cas9 occurs during the processing of the crRNA precursor and requires a small R A amisense to the precursor, the tracrRNA, and RNAse III. In contrast to genome editing with ZFNs or TALENs, changing Cas9 target specificity does not require protein engineering but only the design of the short crRNA guide.
  • Applicants recently showed in S. pneumoniae that the introduction of a CRISPR system targeting a chromosomal locus leads to the killing of the transformed cells. It was observed that occasional survivors contained mutations in the target region, suggesting that Cas9 dsDNA endonuclease activity against endogenous targets could be used for genome editing. Applicants showed that marker-less mutations can be introduced through the transformation of a template DNA fragment that will recombine in the genome and eliminate Cas9 target recognition. Directing the specificity of Cas9 with several different crR As allows for the introduction of multiple mutations at the same time. Applicants also characterized in detail the sequence requirements for Cas9 targeting and show that the approach can be combined with recombmeering for genome editing in E. coli.
  • RESULTS Genome editing by Cas9 cleavage of a chromosomal target
  • S. pneumoniae strain crR6 contains a Cas9-based CRISPR system that cleaves a target sequence present in the bacteriophage ⁇ 8232.5. This target was integrated into the srtA chromosomal locus of a second strain R6 b2j2' ⁇ An altered target sequence containing a mutation in the PAM region was integrated into the srtA locus of a third strain R6 i /lJ i , rendering this strain 'immune' to CR1SPR cleavage ( Figure 28a).
  • Another way to disrupt Cas9 ⁇ mediated cleavage is to introduce mutations in the protospacer region of the editing template. It is known that point mutations within the 'seed sequence' (the 8 to 10 protospacer nucleotides immediately adjacent to the PAM) can abolish cleavage by CRISPR nucleases. However, the exact length of this region is not known, and it is unclear whether mutations to any nucleotide in the seed can disrupt Cas9 target recognition. Applicants followed the same deep sequencing approach described above to randomize the entire protospacer sequence involved in base pair contacts with the crRNA and to determine all sequences that disrupt targeting.
  • Cas9-mediated editing can also be used to generate multiple mutations for the study of biological pathways. Applicants decided to illustrate this for the sortase-dependent pathway that anchors surface proteins to the envelope of Gram-positive bacteria. Applicants introduced a .sona.se deletion by co-transformation of a chloramphenicol-resistant targeting construct and a AsrtA editing template ( Figure 33a,b), followed by a AbgaA deletion using a kanamycin-resistant targeting construct that replaced the previous one. In S, pneumoniae, ⁇ -galactosidase is covalentiy linked to the cell wall by sortase.
  • deletion of srtA results in the release of the surface protein into the supernatant, whereas the double deletion has no detectable ⁇ - galactosidase activity ( Figure 34c).
  • Such a sequential selection can be iterated as many times as required to generate multiple mutations.
  • Spectinomycin-resistant transformants that retain the plasmid eliminated the CRISPR sequences ( Figure 34a,d).
  • Mechanism and efficiency of editing To understand the mechanisms underlying genome editing with Cas9, Applicants designed an experiment in which the editing efficiency was measured independently of Cas9 cleavage. Applicants integrated the ermAM erythromycin resistance gene in the srtA locus, and introduced a premature stop codon using Cas9-mediated editing ( Figure 33). The resulting strain (JEN53) contains an ermAM(stop) allele and is sensitive to erythromycin. This strain may be used to assess the efficiency at which the ermAM gene is repaired by measuring the fraction of cells that restore antibiotic resistance with or without the use of Cas9 cleavage.
  • JENS 3 was transformed with an editing template that restores the wild- type allele, together with either a kanamycin-resistant CRISPR construct targeting the ermAM(stop) allele (CRISPR: : ermAM (stop)) or a control construct without a spacer (CRISPR: :0) ( Figure 26a,b).
  • CRISPR: : ermAM (stop) CRISPR: : ermAM (stop)
  • CRISPR: :0 spacer
  • Transformation of the CRISPR: : ermAM (stop) construct followed by kanamycin selection resulted in an increase of the fraction of erythromycin-resistant, edited cells to 99 % ( Figure 26c).
  • Figure 26c To determine if this increase is caused by the killing of non-edited cells, Applicants compared the kanamycin- resistant colony forming units (cfu) obtained after co-transformation of JEN53 cells with the CRISPR: :ermAM(stop) or CRISPR: :0 constructs.
  • This background frequency may be calculated as the ratio of CRISPR: :ermAM(stop)/CRISPR : :0 cfu, 2.6* 10 "3 (7.J xl0V2.7xl0 4 ) in this experiment, meaning that if the recombination frequency of the editing template is less than this value, CRISPR selection may not efficiently recover the desired mutants above the background.
  • Applicants sought to introduce an A to C transversion in the rpsL gene that confers streptomycin resistance.
  • the pCas9 plasmid was first introduced into E.
  • CRISPR-Cas systems may be used for targeted genome editing in bacteria by the co-introduction of a targeting constmct that killed wild-type cells and an editing template that both eliminated CRISPR cleavage and introduced the desired mutations.
  • Different types of mutations insertions, deletions or sear-less single-nucleoiide substitutions
  • Multiple mutations may be introduced at the same time.
  • the specificity and versatility of editing using the CRISPR system relied on several unique properties of the Cas9 endonuclease: (i) its target specificity may be programmed with a small RNA, without the need for enzyme engineering, (ii) target specificity was very high, determined by a 20 bp RNA-DNA interaction with low probability of no -target recognition, (iii) almost any sequence may be targeted, the only requirement being the presence of an adjacent NGG sequence, (iv) almost any mutation in the NGG sequence, as well as mutations in the seed sequence of the protospacer, eliminates targeting.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Analytical Chemistry (AREA)
  • Theoretical Computer Science (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Medical Informatics (AREA)
  • Evolutionary Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Mycology (AREA)
  • Veterinary Medicine (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Virology (AREA)

Abstract

The invention provides for systems, methods, and compositions for manipulation of sequences and/or activities of target sequences. Provided are vectors and vector systems, some of which encode one or more components of a CRISPR complex, as well as methods for the design and use of such vectors. Also provided are methods of directing CRISPR complex formation in eukaryotic cells and methods for selecting specific cells by introducing precise mutations utilizing the CRISPR/Cas system.

Description

CRISPR-CAS COMPONENT SYSTEMS, METHODS AND COMPOSITIONS FOR
SEQUENCE MANIPULATION
RE LAI' ED APPLICATIONS AND INCORPORATION BY REFERENCE
[0001 ] This application claims priority to US provisional patent applications 61/736,527, 61/748,427, 61/768,959, 61/791,409 and 61/835,931 having Broad reference BI- 203 1/008/WSGR Docket No. 44063-701.101, BI-2011/008/WSGR Docket No. 44063-701.102, Broad reference BL20 i I 008 VP Docket No. 44790.01.2003, BI-201 1/008/VP Docket No. 44790.02.2003 and BT2Q1 1/008/VP Docket No. 44790.03.2003 respectively, all entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on December 12, 2012, January 2, 2013, February 25, 2013, March 15, 2013 and June 17, 2013, respectively.
[0002] Reference is made to US provisional patent applications 61/758,468; 61/769.046; 61/802,174; 61/806,375; 61 /814,263; 61/819,803 and 61/828,130, each entitled ENGINEERING AND OPTIMIZATION OF SYSTEMS, METHODS AN D COMPOSITIONS FOR SEQUENCE MANIPULATION, filed on January 30, 2013; February 25, 2013; March 15, 2013; March. 28, 2013; April 20, 2013; May 6, 2013 and May 28, 2013 respectively. Reference is also made to US provisional patent applications 61/835,936, 61/836,127, 61/836,101 , 61/836,080, 61/836,123 and 61/835,973 eac filed June 17, 2013. Reference is also made to US provisional patent application 61/842,322 and US patent application 14/054,414, each having Broad reference BI-2011/008A, entitled CRISPR-CAS SYSTEMS AND METHODS FOR ALTERING EXPRESSION OF GENE PRODUCTS filed on July 2, 2013 and October 15, 2013 respectively.
[0003] The foregoing applications, and all documents cited therein or during their prosecution ("appln cited documents") and all documents cited or referenced in the appln cited documents, and all documents cited or referenced herein ("herein cited documents"), and all documents cited or referenced in herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. More specifically, all referenced documents are incorporated by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference. FIELD OF THE INVENTION
[0004] The present invention generally relates to systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that may use vector systems related to Clustered Regularly Interspaced Short Palindromic Repeats (CRJSPR) and components thereof,
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0005] This invention was made with government support under the NIH Pioneer Award DP IMH 100706, awarded by the National Institutes of Health. The government has certain rights in the in ention.
BACKGROUND OF THE IN VENTION
[0006] Recent advances in genome sequencing techniques and analysis methods have significantly accelerated the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases. Precise genome targeting technologies are needed to enable systematic reverse e gi eering of causal genetic variations by allowi g selective perturbation of individual genetic elements, as well as to advance synthetic biology, biotechnological, and medical applications. Although genome-editing techniques such as designer zinc fingers, transcription activator- like effectors (TALEs), or homing meganuc leases are available for producing targeted genome perturbations, there remains a need for new genome engineering technologies that are affordable, easy to set up, scalable, and amenable to targeting multiple positions within the eukaryotic genome.
SUMMARY OF THE INVENTION
[0007] There exists a pressing need for alternative and robust systems and tech iques for sequence targeting with a wide array of applications. This invention addresses this need and provides related adva tages. The CRISPR/Cas or the CRISPR-Cas system (both terms are used interchangeably throughout this application) does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short RNA molecule to recognize a specific DNA target, in other words the Cas enzyme can be recruited to a specific DNA target using said short RNA molecule. Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques a d analysis methods may significantly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases. To utilize the CRISPR-Cas system effectively for genome editing without deleterious effects, it is critical to un derstan d aspects of engineering and optimization of these genome engineerin g tools, which are aspects of the claimed in vention.
[0008] In one aspect, the invention provides a vector system comprising one or more vectors. In some embodiments, the system comprises: (a) a first regulatory element operabl linked to a tracr mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR. enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence; and (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence; wherein components (a) and (b) are located on the same or different vectors of the system. In some embodiments, component (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element. In some embodiments, component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell. In some embodiments, the system comprises the tracr sequence under the control of a third regulatory element, such as a polymerase III promoter. In some embodiments, the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. Determining optimal alignment is within the purview of one of skill in the art. For example, there are publically and commercially available alignment algorithms and programs such as, but not limited to, ClustalW, Smith- Waterman in matlab, Bowtie, Geneious, Biopython and SeqMan. In some embodiments, the CRISPR complex comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR complex in a detectable amount in the nucleus of a eukaryotic cell. Without wishing to be bound by theory, it is believed that a nuclear localization sequence is not necessary for CRISPR complex activity in eukaryotes, but that including such sequences enhances activity of the system, especially as to targeting nucleic acid .molecules in the nucleus. In some embodiments, the CRISPR enzyme is a type II CRISPR system enzyme. In some embodiments, the CRISPR enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is S. pneumoniae, S, pyogenes, or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms. The enzyme may be a Cas9 homoiog or ortholog. In some embodiments, the CRISPR enzyme is codon- optimized for expression in a eukaryotic cell. In some embodiments, the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence. In some embodiments, the CRISPR enzyme lacks DNA strand cleavage activity. In some embodiments, the first regulatory element is a polymerase III promoter. In some embodiments, the second regulatory element is a polymerase Π promoter. In some embodiments, the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15- 20 nucleotides in length. In general, and throughout this specification, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partial ly double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a "plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein vira!iy-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication detective adenoviruses, and adeno-associated viruses). Viral vectors also include polynucleotides carried by a vims for traiisfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host celt upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors." Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. [0009] Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory elemeiit(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro trail scription/translation system or in a host cell when the vector is introduced into the host ceil).
[0010] The term "regulatory element" is intended to include promoters, enhancers, internal ribosomal entry sites ( RES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddei, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulator}.' elements include those that direct constitutive expression of a nucleotide sequence in many types of host ceil and those that direct expression of the nucleotide sequence only in certain host ceils (e.g., tissue-specific regulator}' sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and HI promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with, the CMV enhancer) [see, e.g., Boshari et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydro folate reductase promoter, the β-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFla promoter. Also encompassed by the term "regulator}' element" are enhancer elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Mol. Cell. Biol, Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit β-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly Interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
[0011] Advantageous vectors include lentivirases and adeno-assoeiated viruses, and types of such vectors can al so be selected for targeting particul ar types of cells.
[0012] In one aspect, the invention provides a vector comprising a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising one or more nuclear localization sequences. In some embodiments, said regulatory element drives transcription of the CRISPR enzyme in a eukaryotic cell such that said CRISPR enzyme accumulates in a detectable amount in the nucleus of the eukaryotic cell. In some embodiments, the regulatory element is a polymerase II promoter. I some embodiments, the CRISPR enzyme is a type II CRISPR system enzyme. In some embodiments, the CRISPR enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is 5. pneumoniae, S. pyogenes or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms. In some embodiments, the CRISPR enzyme is codon-optimized for expression in a eukaryotic cell. In some embodiments, the CRISPR enzyme directs cleavage of one or two strands at the locatio of the target sequence. In some embodiments, the CRISPR enzyme lacks DNA strand cleavage activity.
[0013] in one aspect, the invention provides a CRISPR enzyme comprising one or more uclear localization sequences of sufficient stre gth to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In some embodiments, the CRISPR enzyme is a type II CRISPR system enzyme. In some embodiments, the CRISPR enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is S. pneumoniae, S. pyogenes or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms. The enzyme may be a Cas9 homolog or ortholog. In some embodiments, the CRISPR e zyme lacks the ability to cleave one or more strands of a target sequence to which it binds. [0014] In one aspect, the invention provides a eukaryotic host cell comprising (a) a first regulatory element operably linked to a tract mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR comple to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CR ISPR enzyme compiexed with (1) the guide sequence that is hybridized to the target sequence, a d (2) the tracr mate sequence that is hybridized to the tracr sequence; and/or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence. In some embodiments, the host cell comprises components (a) and (b). In some embodiments, component (a), component (b), or components (a) and (b) are stably integrated into a genome of the host eukaryotic cell. In some embodiments, component (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element. In some embodiments, component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell. In some embodiments, the eukaryotic host cell further comprises a third regulatory element, such as a polymerase III promoter, operably linked to said tracr sequence. In some embodiments, the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. In some embodiments, the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic ceil. In some embodiments, the CRISPR enzyme is a type Π CRISPR system enzyme. In some embodiments, the CRISPR enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is 5. pneumoniae, S. pyogenes or S, thermophilus Cas9, and may include mutated Cas9 derived from these organisms. The enzyme may be a Cas9 homolog or ortholog. In some embodiments, the CRISPR enzyme is codon -optimized for expression in a eukaryotic cell. In some embodiments, the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence. In some embodiments, the CRISPR enzyme lacks DNA strand cleavage activity. In some embodiments, the first regulatory element is a polymerase ( II promoter. In some embodiments, the second regulatory element is a polymerase II promoter. In some embodiments, the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15- 20 nucleotides in length. In an aspect, the invention provides a non-human eukaryotic organism; preferably a multicellular eukaryotic organism, comprising a eukaryotic host cell according to any of the described embodiments. In other aspects, the invention provides a eukaryotic organism; preferably a multicellular eukaryotic organism, comprising a eukaryotic host cell according to any of the described embodiments. The organism in some embodiments of these aspects may be an animal; for example a mammal. Also, the organism may be an arthropod such as an insect. The organism also may be a plant. Further, the organism may be a fungus.
[0015] In one aspect, the invention provides a kit comprising one or more of the components described herein. In some embodiments, the kit comprises a vector system and instructions for using the kit. In some embodiments, the vector system comprises (a) a first regulatory elemen operably linked to a tracr mate sequence and one or more insertion sites for inserting one or more guide sequences upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR comple to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence; and'Or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR. enzyme comprising a nuclear localization sequence. In some embodiments, the kit comprises components (a) and (b) located on the same or different vectors of the system. In some embodiments, componen (a) further comprises the tracr sequence downstream of the tracr mate sequence under the control of the first regulatory element. In some embodiments, component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell. In some embodimenis, the system further comprises a third regulatory element, such as a polymerase III promoter, operably linked to said tracr sequence. In some embodimenis, the tracr sequence exhibits at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. In some embodiments, the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In some embodiments, the CRISPR enzyme is a type II CRISPR system enzyme, in some embodiments, the CRISP R enzyme is a Cas9 enzyme. In some embodiments, the Cas9 enzyme is S. pneumoniae, S. pyogenes or S. thermophilus Cas9, and may include mutated Cas9 derived from these organisms. The enzyme may be a Cas9 homolog or ortholog. In some embodiments, the CRISPR enzyme is codo -optimized, for expression in a eukaryotic cell. In some embodiments, the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence. In some embodiments, the CRISPR enzyme lacks DNA strand cleavage activity. In some embodiments, the first regulator)? element is a polymerase III promoter. In some embodiments, the second regulatory element is a polymerase II promoter. In some embodiments, the guide sequence is at least 15, 16, 17, 18, 19, 20, 25 nucleotides, or between 10-30, or between 15-25, or between 15-20 nucleotides in length.
[0016] In one aspect, the invention provides a method of modifying a target polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. In some embodiments, said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence. In some embodiments, the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence. In some embodiments, said vectors are delivered to the eukaryotic cell in a subject. In some embodiments, said modifying takes place in said eukaryotic cell in a cell culture. In some embodiments, the method further comprises isolating said eukaryotic cell from a subject prior to said modifying. In some embodiments, the method further comprises returning said eukaryotic cell and/or cells derived therefrom to said subject.
[0017] In one aspect, the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. In some embodiments, the method further comprises delivering one or more vectors to said eukaryotic cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
[0018] In one aspect, the invention provides a method of generating a model eukaryotic cell comprising a mutated disease gene, In some embodiments, a disease gene is any gene associated an increase in the risk of having or developing a disease. In some embodiments, the method comprises (a) introducing one or more vectors into a eukaryotic cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said disease gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotic cell comprising a mutated disease gene. In some embodiments, said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence. [0019] In one aspect, the invention provides a method for developing a biologically active agent that modulates a cell signaling event associated with a disease gene. In some embodiments, a disease gene is any gene associated an increase in the risk of having or developing a disease. In some embodiments, the method comprises (a) contacting a test compound wit a model cell of any one of the described embodiments; and (b) detecting a change in a readout that is indicative of a reduction or a augmentatio of a cell signaling event associated with said mutation in said disease gene, thereby developing said biologically active agent that modulates said cell signaling event associated with said disease gene.
[0020} In one aspect, the invention provides a recombinant polynucleotide comprising a guide sequence upstream of a tracr mate sequence, wherein the guide sequence when expressed directs sequence-specific binding of a CRJSPR complex to a corresponding target sequence present in a eukaryotic cell. In some embodiments, the target sequence is a viral sequence present in a eukaryotic cell. In some embodiments, the target sequence is a proto -oncogene or an oncogene.
[0021] In one aspect the invention provides for a method of selecting one or more prokaryotic cell(s) by introducing one or more mutations in a gene in the one or more prokaryotic cell (s), the method comprising: introducing one or more vectors into the prokaryotic cell (s), wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and a editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; al lowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRJSPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRJSPR complex comprises the CRJSPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein binding of the CRISPR complex to the target polynucleotide induces cell death, thereby allowing one or more prokaryotic cell(s) in which one or more mutations have been introduced to be selected. In a preferred embodiment, the CRJSPR enzyme is Cas9. In another aspect of the invention the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific cells without requiring a selection marker or a two-step process that may include a counter-selection system. [0022] Accordingly, it is an object of the invention not to encompass within the invention any previously known product, process of making the product, or method of using the product- such that Applicants reserve the right and hereby disclose a disclaimer of any previously known product, process, or method. It is further noted that the invention does not intend to encompass within the scope of the invention any product, process, or making of the product or method of using the product, which does not meet the written description and enablement requirements of the USPTO (35 U.S.C. § 1 12, first paragraph) or the EPO (Article 83 of the EPC), such that Applicants reserve the right and hereby disclose a disclaimer of any previously described product, process of making the product, or method of using the product,
[0023] It is noted that in this disclosure and particularly in the claims and/or paragraphs, terms such as "comprises", "comprised", "comprising" and the like can have the meaning attributed to it in U.S. Patent law; e.g., they can mean "includes", "included", "including", and the like; and that terms such as "consisting essentially of and "consists essentially of have the meaning ascribed to them in U.S. Patent law, e.g., they allow for elements not explicitly recited, but exclude elements that are found in the prior art or that affect a basic or novel characteristic of the invention. These and other embodiments are disclosed or are obvious from and encompassed by, the following Detailed Description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0024] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0025] Figure 1 shows a schematic model of the CRISPR system. The Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide sequence (blue) and a scaffold (red). The guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5 '-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB) ~3 bp upstream of the PAM (red triangle). [0026] Figure 2A-F shows an exemplary CRISPR system, a possible mechanism of action, an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity.
[0027] Figure 3 shows an exemplary expression cassette for expression of CRISPR. system elements in eukaryotic cells, predicted structures of example guide sequences, and CRISPR system activity as measured in eukaryotic and prokaryotic cells.
[0028] Figure 4A-0 shows results of an evaluation of SpCas9 specificity for an example target.
[0029] Figure 5A-G show an exemplary vector system and results for its use in directing homologous recombination in eukaryotic ceils.
[0030] Figure 6 provides a table of protospacer sequences and summarizes modification efficiency results for protospacer targets designed based on exemplary S. pyogenes and S. thermophilus CRISPR systems with corresponding PAMs against loci in human and mouse genomes. Cells were transfected with Cas9 and either pre-erRNA/tracrRjN A or chimeric RNA, and analyzed 72 hours after transfection. Percent indels are calculated based on Surveyor assay- results from indicated cell lines (N:=3 for all protospacer targets, errors are S.E.M., N.D. indicates not detectable using the Surveyor assay, and N.T. indicates not tested in this study).
[0031] Figure 7A-C shows a comparison of different tracr NA transcripts for Cas9- mcdiated gene targeting.
[0032] Figure 8 shows a schematic of a surveyor nuclease assay for detection of double strand break-induced micro-insertions and --deletions.
[0033] Figure 9A-B shows exemplary bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cells.
[0034] Figure 10 shows a bacterial plasmid transformation interference assay, expression cassettes and plasmids used therein, and transformation efficiencies of cells used therein .
[0035] Figure 11A-C shows histograms of distances between adjacent S. pyogenes SF370 locus I PAM (NGG) (Figure 10A) and S. thermophilus LMD9 locus 2 PA..VI (NNAGAAW) (Figure 10B) in the human genome; and distances for each PAM by chromosome (Chr) (Figure IOC).
[0036] Figure 12A-C shows an exemplary CRISPR system, an example adaptation for expression in eukaryotic cells, and results of tests assessing CRISPR activity. [0037] Figure 13A-C shows exemplary manipulations of a CRISPR system for targeting of genomic loci in mammalian cells.
[0038] Figure 14A-B shows the results of a Northern blot analysis of erRNA processing in mammalian cel ls.
[0039] Figure 15 shows an exemplary selection of protospacers in the human PVALB and mouse Th loci.
[0040 j Figure J 6 shows example protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR system in the human EMX1 locus.
[0041] Figure 17 provides a table of sequences for primers and probes used for Surveyor, RFLP, genomic sequencing, and Northern blot assays.
[0042] Figure 18A-C shows exemplary manipulation of a CRISPR system with chimeric RNAs and results of SURVEYOR assays for system activity in eukaryotic cells.
[0043] Figure 19A-B shows a graphical representation of the results of SURVEYOR assays for CRJSPR system activity in eukaryotic cells.
[0044] Figure 20 shows an exemplary visualization of some S. pyogenes Cas9 target sites in the human genome using the i CSC genome browser.
[0045] Figure 21 shows predicted secondary structures for exemplary chimeric RNAs comprising a guide sequence, tracr mate sequence, and tracr sequence.
[0046] Figure 22 shows exemplaiy bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cells.
[0047] Figure 23 shows that Cas9 nuclease activity against endogenous targets may be exploited for genome editing, (a) Concept of genome editing using the CRISPR system. The CRISPR targeting construct directed cleavage of a chromosomal locus and was co -transformed with an editing template that recombined with the target to prevent cleavage. Kanamycin- resistant transformants that survived CRISPR attack contained modifications introduced by the editing template, tracr, ir ws-activating CRISPR RNA; aphA-3, kanamycin resistance gene, (b) Transformation of crR6M DNA in j 8"2'5 cells with no editing template, the R6 wild-type srtA or the R6370.1 editing templates. Recombination of either R6 srtA or R6"' ) 1 prevented cleavage by Cas9. Transformation efficiency was calculated as colony forming units (cm) per μg of crR6M DNA; the mean values with standard deviations from at least three independent experiments are shown. PCR analysis was performed on 8 clones in each transformation. "Un." indicates the unedited srtA locus of strain Κβ^'^; "Ed." shows the editing template. R6b "^'3 and R6J "J 1 targets are distinguished by restriction with. Eael.
[0048] Figure 24 shows analysis of PAM and seed sequences that eliminate Cas9 cleavage, (a) PGR. products with, randomized PAM sequences or randomized seed sequences were transformed in crR6 cells. These cells expressed Cas9 loaded with a crRNA that, targeted a chromosomal region of R6'""""J ceils (highlighted in pink) that is absent from the R6 genome. More than 2* 105 chloramphenicoi-resistant transform arsts, carrying inactive PAM or seed sequences, were combined for amplification and deep sequencing of the target region, (b) Relative proportion of number of reads after transformation of the random PAM constructs in crR6 cells (compared to number of reads in R6 transformants). The relative abundance for each 3 -nucleotide PAM sequence is shown. Severely underrepresented sequences (NGG) are shown in red; partially underrepresented one in orange ( NAG) (c) Relative proportion of number of reads after transformation of the random seed sequence constructs in crR6 cells (compared to number of reads in R6 trail sformants). The relative abundance of each nucleotide for each position of the first 20 nucleotides of the protospacer sequence is shown. High abundance indicates lack of cleavage by Cas9, i.e. a CR ISPR inactivating mutation. The grey line shows the level of the WT sequence. The dotted line represents the level above which a mutation significantly disrupts cleavage (See section "Analysis of deep sequencing data" in Example 5)
[0049] Figure 25 shows introduction of single and multiple mutations using the CRISPR system in S. pneumoniae, (a) Nucleotide and amino acid sequences of the wild-type and edited (green nucleotides; underlined amino acid residues) bgaA. The protospacer, PAM and restriction sites are shown, (b) Transformation efficiency of ceils transformed with targeting constructs in the presence of an editing template or control, (c) PGR analysis for 8 transformants of each editing experiment followed by digestion with BtgZI (R→A) and Tsel (NE→AA). Deletion of bgaA was revealed as a smaller PGR product, (d) Miller assay to measure the β-galactosidase activity of WT and edited strains, (e) For a single-step, double deletion the targeting construct contained two spacers (in this case matching srtA and bgaA) and was co-transformed with two different editing templates (f) PGR analysis for 8 transformants to detect deletions in srtA and bgaA loci. 6/8 transformants contained deletions of both genes.
[00S0] Figure 26 provides mechanisms underlying editing using the CRISPR system, (a) A stop codon was introduced in the erythromycin resistance gene ermAM to generate strain JENS 3. The wild-type sequence can be restored by targeting the stop codon with the CRISPR: :ermA (stop) construct, and using the ermAM wild-type sequence as an editing template, (b) Mutant and wild-type ermAM sequences, (c) Fraction of erythromicyn-resistant (ermR) cfu calculated from total or kanamycin-resistant (kanR) cfu. (d) Fraction of total cel ls that acquire both the CRISPR construct and the editing template. Co-transformation of the CRISPR targeting construct produced more transformants (t-test, p=0.011). In all cases the values show the meani-s.d. for three independent experiments.
[0051] Figure 27 illustrates genome editing with the CRISPR system in E. coli. (a) A kanamycin-resistant plasmid carrying the CRISPR array (pCRISPR) targeting the gene to edit may be transformed in the HME63 reeombmeering strain containing a chloramphenicol-resistant plasmid harboring cas9 and tracr (pCas9), together with an oligonucleotide specifying the mutation, (b) A &42T mutation conferring streptomycin resistance was introduced in the rpsL gene (c) Fraction of streptomicyn-resistant (strepR) cfu calculated from total or kanamycin- resistant (kanR) cfu. (d) Fraction of total cells that acquire both the pCRISPR plasmid and the editing oligonucleotide. Co-transformation of the pCRISPR targeting plasmid produced more transformants (t-test, p:=0.004). In al l cases the "values showed the meani-s.d. for three independent experiments.
[0052] Figure 28 illustrates the transformation of crR.6 genomic DNA leads to editing of the targeted locus (a) The IS 1167 element of S. pneumoniae R6 was replaced by the CRISPROl locus of S. pyogenes SF370 to generate crR6 strain. This locus encodes for the Cas9 nuclease, a CRISPR array with six spacers, the tracrRNA that is required for crRNA biogenesis and Casl , Cas2 and Csii2, proteins not necessary for targeting. Strain crR6M contains a minimal functional CRISPR system without casl, casl and csn2. The aphA-3 gene encodes kanamycin resistance. Protospacers from the streptococcal bacteriophages φ8232.5 and φ370.1 were fused to a chloramphenicol resistance gene (cat) and integrated, in the srtA gene of strain R6 to generate strains R68232.5 and R6370.1. (b) Left panel: Transfomiation of crR6 and crR6M genomic DNA in R6C and R '·*. As a control of cell competence a streptomycin resistant gene was also transformed. Right panel: PC analysis of 8 R6823 transformants with crR6 genomic DNA. Primers that amplify the srtA locus were used for PCR. 7/8 genotyped colonies replaced the R68232.5 srtA locus by the WT locus from the crR6 genomic DNA. [0053] Figure 29 provides chromatograms of DNA sequences of edited cells obtained in this study. In all cases the wild-type and mutant protospacer and PAM sequences (or their reverse complement) are indicated. When relevant, the amino acid sequence encoded by the protospacer is provided. For each editing experiment, all strains for which PCR and restriction analysis corroborated the introduction of the desired modification were sequenced. A representative chromatogram is show , (a) Chromatogram for the introduction of a PAM mutation into the R6S ",2,J target (Figure 23d). (b) Chromatograms for the introduction of the >A and NE>AA mutations into β-gaiactosidase (bgaA) (Figure 25c). (c) Chromatogram for the introduction of a 6664 bp deletion within bgaA ORF (Figures 25c and 25f). The dotted line indicates the limits of the deletion, (d) Chromatogram for the introduction of a 729 bp deletion within srtA ORF (Figure 25f). The dotted line indicates the limits of the deletion, (e) Chromatograms for the generation of a premature stop codon within erniAM (Figure 33). (f) rpsL editing in E. coli (Figure 27).
[0054] Figure 30 illustrates CRISPR immunity against random S. pneumoniae targets containing different PAMs. (a) Position of the 10 random targets on the S. pneumoniae R6 genome. The chosen targets have different PAMs and are on both strands, (b) Spacers corresponding to the targets were cloned in a minimal CRISPR array on plasmid pLZ12 and transformed into strain crR6Rc, which supplies the processing and targeting machinery in trans, (c) Transformation efficiency of the different plasmids in strain R6 and crR6Rc. No colonies were recovered for the transformation of pDB99~108 (T1-T10) in crR.6Rc. The dashed line represents limit of detection of the assay.
[0055] Figure 31 provides a general scheme for targeted genome editing. To facilitate targeted genome editing, crR6M was further engineered to contain tracrR A, Cas9 and only one repeat of the CRISPR array followed by kanamycin resistance marker (aphA-3), generating strain crR6Rk. DNA from this strain is used as a template for PCR with primers designed to introduce a new spacer (green box designated with N). The left and right PCRs are assembled using the Gibson method to create the targeting construct. Both the targeting and editing constructs are then transformed into strain crR6Rc, which is a strain equivalent to crR6Rk but has the kanamycin resistance marker replaced by a chloramphenicol resistance marker (cat). About 90 % of the kanamycin-resistant transformants contain the desired mutation. [0056] Figure 32 illustrates the distribution of distances between PAMs. NGG and CCN that are considered to be valid PAMs. Data is shown for the S. pneumoniae R6 genome as well as for a random sequence of the same length and with the same GC-content (39.7 %). The dotted line represents the average distance (12) between PAMs in the R6 genome.
[0057] Figure 33 il lustrates CRISPR-mediated editing of the ermAM locus using genomic DNA as targeting construct. To use genomic DNA as targeting construct it is ecessary to avoid CRISPR autoimmunity, and therefore a spacer against a sequence not present in the chromosome must be used (in this case the ermAM erythromycin resistance gene), (a) Nucleotide and ami o acid sequences of the wild-type and mutated (red letters) ermAM gene. The protospacer and PAM sequences are shown, (b) A schematic for CRISPR-mediated editing of the ermAM locus using genomic DNA. A construct carrying an ermAM-targetmg spacer (blue box) is made by PCR and Gibson assembly, and transformed into strain crR6Rc, generating strain JEN37. The genomic DNA of JEN37 was then used as a targeting constmct, and was co -transformed with the editing template into JEN38, a strain in which the srtA gene was replaced by a wild-type copy of ermAM, anamycin-resistant transformants contai the edited genotype (JEN43). (c) Number of kanamycin-resistant cells obtained after co-transformation of targeting and editing or control templates. n the presence of the control template 5.4X 10 cfu/mi were obtained, and 4.3 lO3 cfu/ml when the editing template was used. This difference indicates an editing efficiency of about 99 % [(4.3xl05-5.4xl03)/4.3 l05]. (d) To check for the presence of edited ceils seven kanamycin-resistant clones and JEN 38 were streaked on agar plates with (ermr) or without (erm-) erythromycin. Only the positive control displayed resistance to erythromycin. The ermAM mut genotype of one of these transforma ts was also verified by DNA sequencing (Figure 29e).
[0058] Figiire 34 illustrates sequential introduction of mutations by CRISPR-mediated genome editing, (a) A schematic for sequential introduction of mutations by CRISPR-mediated genome editing. First, R6 is engineered to generate crR6Rk. crR6Rk is co-transformed with a srtA -targeting construct fused to cat for chloramphenicol selection of edited cells, along with an editing construct for a AsrtA in-frame deletion. Strain crR6 AsrtA is generated by selection on chlramphenicol. Subsequently, the AsrtA strain is co-transformed with a bgaA -targeting construct fused to aphA-3 for kanamycin selection of edited cells, and an editing constmct containing a AbgaA in-frame deletion. Finally, the engineered CRISPR locus can be erased from the chromosome by first co-transforming R.6 DNA containing the wild-type IS 1167 locus and a plasmid carrying a bgaA protospacer (pDB97), and selection on spectinomycin. (b) PCR analysis for 8 chloramphenicol (Cam)-resistant transfomiants to detect the deletion in the srtA locus, (c) β-galactosidase activity as measured by Miller assay. In S. pneumoniae, this enzyme is anchored to the cell wall, by sortase A. Deletion of the srtA gene results in the release of β-galactosidase into the supernatant. AhgaA mutants show no activity, (d) PCR analysis for 8 spectinomycin (Spec)-resistant transfomiants to detect the replacement of the CRJSPR locus by wild-type IS1167.
[0059] Figure 35 illustrates the background mutation frequency of CRISPR in S. pneumoniae, (a) Transformation of the CRISPR: :0 or CRISPR: :erm(stop) targeting constructs in JEN53, with or without the ermAM editing template. The difference in kanR CFU between CRISPR: :0 and CRJSPR: :erm(stop) indicates that Cas9 cleavage kills non-edited cells. Mutants that escape CRISPR interference in the absence of editing template are observed at a frequency of 3χ 10~'\ (b) PCR analysis of the CRISPR locus of escapers shows that 7/8 have a spacer deletio , (c) Escaper #2 carries a point mutation in cas9.
[0060] Figure 36 il lustrates that the essential elements of the S. pyogenes CRISPR locus 1 are reconstituted in E. coli using pCas9. The plasmid contained tracrRNA, Cas9, as well as a leader sequence driving the crRNA array. The pCRISPR plasmids contained the leader and the array only. Spacers may be inserted into the crRNA array between Bsal sites using annealed oligonucleotides. Oligonucleotide design is shown at bottom. pCas9 carried chloramphenicol resistance (CmR) and is based on the low-copy pACYC184 plasmid backbone. pCRISPR is based on the high-copy number pZE21 plasmid. Two plasmids were required because a pCRISPR plasmid containing a spacer targeting the E. coli chromosome may not be constructed using this organism as a cloning host if Cas9 is also present (it will kill the host).
[0061] Figure 37 illustrates CRISP -directed editing in E.coli MG1655. An oligonucleotide (W542) carrying a point mutation that both confers streptomycin resistance and abolishes CRISPR immunity, together with a plasmid targeting rpsL (pCRISPR: :rpsL) or a control plasmid (pCRISPR: :0) were co-transformed into wild-type E.coli strain MG1655 containing pCas9. Transformants were selected on media containing either streptomycin or kanamycin. Dashed line indicates limi t of detection of the transformation assay. [0062] Figure 38 illustrates the background mutation frequency of CRISPR in E. coli ί:ΪΜΕ63. (a) Transformation of the pCRISPR::0 or pCRISPR::rpsL plasmids into HME63 competent cells. Mutants that escape CRISPR interference were observed at a frequency of 2. 10 \ (b) Anrplification of the CRISPR array of escapers showed that 8/8 have deleted the spacer.
[0063] Figure 39A-D shows a circular depiction of the phylo genetic analysis revealing five families of Cas9s, including three groups of large Cas9s (- 1400 amino acids) and two of small Cas9s (~1100 amino acids),
[0064] Figure 40A-F shows the linear depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s (~1400 amino acids) and two of small Cas9s (~1 100 amino acids).
10065] Figure 41A-M shows sequences where the mutation points are located within the SpCas9 gene.
[0066] Figure 42 shows a schematic construct in which the transcriptional activation domain (VP64) is fused to Cas9 with two mutations in the catalytic domains (D10 and H840).
[0067] Figure 43A-D shows genome editing via homologous recombination, (a) Schematic of SpCas9 nickase, with D10A mutation in the RuvC I catalytic domain, (b) Schematic representing homologous recombination (HR) at the human EMXl locus using either sense or antisense single stranded oligonucleotides as repair templates. Red arrow above indicates sgRNA cleavage site; PCR primers for genotyping (Tables J and ) are indicated as arrows in right panel, (c) Sequence of region modified by HR. d, SURVEYOR assay for wildtype (wt) and nickase (D10A) SpCas9-mediated indels at the EMXl target 1 locus in =3), Arrows indicate positions of expected fragment sizes.
[0068] Figure 44A-B shows single vector designs for SpCas9.
[0069] Figure 45 shows quantification of cleavage of NLS-Csnl constructs NLS-Csnl , Csnl, Csnl-NLS, NLS-Csnl-NLS, NLS-Csnl -GFP-NLS and UnTFN.
[0070] Figure 46 shows index frequency of NLS-Cas9, Cas9, Cas9-NLS and NLS-Cas9- NLS.
[0071] Figure 47 shows a gel demonstrating that SpCas9 with nickase mutations (individually) do not induce double strand breaks. [0072] Figure 48 shows a design of the oligo DNA used as Homologous Recombination (HR) template in this experiment and a comparison of HR efficiency induced by different combinations of Cas9 protein and HR template.
[0073] Figure 49A shows the Conditional Cas9, Rosa.26 targeting vector map.
[0074] Figure 49B shows the Constitutive Cas9, Rosa26 targeting vector map.
[0075] Figure 50A-H show the sequences of each element present in the vector maps of
Figures 49A-B.
[0076] Figure 51 shows a schematic of the important elements in the Constitutive and Conditional Cas9 constructs.
[0077] Figure 52 shows the functional validation of the expression of Constitutive and Conditional Cas9 constructs.
[0078] Figure 53 shows the validation of Cas9 nuclease activity by Surveyor.
[0079] Figure 54 shows the quantification of Cas9 nuclease activity.
[0080] Figure 55 shows construct design and homologous recombination (HR) strategy.
[0081] Figure 56 shows the genomic PCR genotyping results for the constitutive (Right) and conditional (Lett) constructs at two different gel exposure times (top row for 3 min and bottom row for 1 min).
[0082] Figure 57 shows Cas9 activation in mESCs.
[0083] Figure 58 shows a schematic of the strategy used to mediate gene knockout via NHEJ using a nickase version of Cas9 along with two guide RNAs.
[0084] Figure 59 shows how DNA double-strand break (DSB) repair promotes gene editing. In the error-prone non-homologous end joining (NHEJ) pathway, the ends of a DSB are processed by endogenous DNA repair machineries and rejoined together, which can result in random insertion'tieietion (indel) mutations at the site of junction. Indel mutations occurring within the coding region of a gene can result in frame-shift and a premature stop codon, leading to gene knockout. Alternatively, a repair template in the form of a plasmid or single-stranded oligodeoxynucleotides (ssODN) can be supplied to leverage the homology-directed repair (HDR) pathway, which allows high fidelity and precise editing.
[0085] Figure 60 shows the timeline and overview of experiments. Steps for reagent design, construction, validation, and cell line expansion. Custom sgRNAs (Sight blue bars) for each target, as well as genotyping primers, are designed in siiico via our online design tool (available at the website genome-engineering.org/tools). sgRNA expression vectors are then cloned into a plasmid containing Cas9 (PX330) and verified via DNA sequencing. Completed plasmids (pCRISPRs), and optional repair templates for facilitating homology directed repair, are then transfected into cells and assayed for ability to .mediate targeted cleavage. Finally, transfected cel ls can be clonally expanded to derive isogenic cel l lines with defined mutations.
[0086] Figiire 61A-C shows Target selection and reagent preparation, (a) For S. pyogenes Cas9, 20-bp targets (highlighted in blue) must be followed by 5'~NGG, which can occur in either strand on genomic DNA. We recommend using the online tool described in this protocol in aiding target selection (www.genome-mgineering.org tools). (b) Schematic for co-transfection of Cas9 expression plasmid (PX 165) and PCR-amplified U6-driven sgRNA expression cassette. Using a U6 promoter-containing PCR template and a fixed forward primer (U6 Fwd), sgRNA - encoding DNA can appended onto the U6 reverse primer (U6 Rev) and synthesized as an extended DNA oligo (Ultramer oiigos from IDT). Note the guide sequence (blue N's) in U6 Rev- is the reverse complement of the 5'-NGG flanking target sequence, (c) Schematic for scarless cloning of the guide sequence oiigos into a plasmid containing Cas9 and sgRNA scaffold (PX330). The guide oligos (blue N's) contain overhangs for ligation into the pair of Bbsl sites on PS330, with the top and bottom strand orientations matching those of the genomic target (i.e. top oligo is the 20-bp sequence preceding 5'-NGG in genomic DNA). Digestion of PX330 with Bbsl allows the replacement of the Type lis restriction sites (blue outline) with direct insertion of annealed oiigos. It is worth noting that an extra G was placed before the first base of the guide sequence. Applicants have found that an extra G in front of the guide sequence does not adversely affect targeting efficiency. In cases when the 20-nt guide sequence of choice does not begin with guanine, the extra guanine will ensure the sgRNA is efficient])? transcribed by the U6 promoter, which prefers a guani e in the first base of the transcript.
[0087] Figure 62A-D shows the anticipated results for multiple NHEJ. (a) Schematic of the SURVEYOR assay used to determine indel percentage. First, genomic DNA from the heterogeneous population of Cas9-targeted cells is amplified by PCR.. Amplicons are then reannealed slowly to generate heteroduplexes. The reannealed hcteroduplexes are cleaved by SURVEYOR nuclease, whereas homoduplexes are left intact. Cas9-mediated cleavage efficiency (% indel) is calculated based on the fraction of cleaved DNA, as determined by integrated intensity of gel ba ds, (b) Two sgRNAs (orange a d blue bars) are designed to target the human GRIN2B and DYRKIA loci. SURVEYOR gel shows modification at both loci in transfecied cells. Colored arrows indicated expected fragment sizes for each locus, (c) A pair of sgRNAs (light blue and green bars) are designed to excise an exon (dark blue) in the human EMX1 locus. Target sequences and PAMs (red) are shown in respective colors, and sites of cleavage indicated by red triangle. Predicted junction is shown below, individual clones isolated from cell populations transfecied with sgRNA 3, 4, or both are assayed by PCR (OUT Fwd, OUT Rev), reflecting a deletion of ~270-bp. Representative clones with no modification (12/23), mono- allelic (10/23), and bi-allelic (1/23) modifications are shown. IN Fwd and IN Rev primers are used to screen for inversion events (Fig. 6d). (d) Quantification of clonal lines with EMX1 exon deletions. Two pairs of sgRNAs (3.1, 3.2 left-flanking sgRNAs; 4.1, 4.2, right flanking sgRNAs) are used to mediate deletions of variable sizes around one EMX1 exon. Transfecied cells are clonaily isolated and expanded for genotyping analysis for deletions and inversion events. Of the 105 clones are screened, 51 (49%) and 11 (10%) carrying heterozygous and homozygous deletions, respectively. Approximate deletion sizes are given since junctions may be variable.
[0088] Figure 63A-C shows the application of ssODNs and targeting vector to mediate HR with both wifdtype and nickase mutant of Cas9 in HEK293FT and HUES9 cells with efficiencies ranging from 1.0-27%.
[0089] Figure 64 shows a schematic of a PCR-based .method for rapid and efficient CRISPR targeting in mammalian ceils. A plasmid containing the human RNA polymerase III promoter U6 is PCR-amplified using a U6-specific forward primer and a reverse primer carrying the reverse complement of part of the U6 promoter, the sgRNA(+85) scaffold with guide sequence, and 7 T nucleotides for transcriptional termination. The resulting PCR product is purified and co- delivered with a plasmid carrying Cas9 driven by the CBh promoter.
[0090] Figure 65 shows SURVEYOR Mutation Detection Kit from Transgenomlcs results for each gRNA and respective controls. A positive SURVEY R result is one large band corresponding to the genomic PCR and two smaller bands that are the product of the SURVEYOR nuclease making a double-strand break at the site of a mutation. Each gRNA was validated in the mouse cell line, Neuro-N2a, by liposomal transient co-transfection with hSpCas9. 72 hours post-transfection genomic DNA was purified using QuickExtract DNA from Epicentre. PCR was performed to amplify the locus of interest. [0091] Figure 66 shows Surveyor results for 38 live pups (lanes 1-38) 1 dead pup (lane 39) and 1 wild-type pup for comparison (lane 40). Pups 1-19 were injected with gRNA Chd.8.2 and pups 20-38 were injected with gRNA Chd8.3. Of the 38 live pups, 13 were positive for a mutation. The one dead pup also had a mutation. There was no mutation detected in the wild- type sample. Genomic PCR sequencing was consistent with the SURVEYOR assay findings.
[0092] Figure 67 shows a design of different Cas9 NLS constructs. All Cas9 were the human-codon-optimized version of the Sp Cas9. LS sequences are linked to the cas9 gene at either N-terminus or C-teraiinus. All Cas9 variants with different NLS designs were cloned into a backbone vector containing so it is driven by EFla promoter. On the same vector there is a chimeric RNA targeting human EMX1 locus driven by U6 promoter, together forming a two- eomponent system.
[0093] Figure 68 shows the efficiency of genomic cleavage induced by Cas9 variants bearing different NLS designs. The percentage indicate the portion of human EMX1 genomic DNA that were cleaved by each construct. Ail experiments are from 3 biological replicates, n = 3, error indicates S.E.M.
[0094] Figure 69A shows a design of the CRISPR-TF (Transcription Factor) with transcriptional activation activity. The chimeric RNA is expressed by U6 promoter, while a human-codon-optimized, double-mutant version of the Cas9 protein (hSpCas9m), operabiy linked to triple NLS and a VP64 functional domain is expressed by a EF l a promoter. The double mutations, DIOA and H840A, renders the cas9 protein unable to introduce any cleavage but maintained its capacity to bind to target DNA when guided by the chimeric R NA.
[0095] Figure 69B shows transcriptional activation of the human SOX2 ge e with CRISPR- TF system (Chimeric RNA and the Cas9-NLS-VP64 fusion protein). 293FT cells were transfected with piasmids bearing two components: (I) U6-driven different chimeric RNAs targeting 20-bp sequences within or around the human SOX2 genomic locus, and (2) EF la- driven hSpCas9m (double mutant)-NLS-VP64 fusion protein. 96 hours post transfection, 293FT cells were harvested and the level of activation is measured by the induction of mRNA expression using a qRT-PCR assay. All expression levels are normalized against the control group (grey bar), which represents results from cells transfected with the CRISPR-TF backbone plasmid without chimeric RNA. The qRT-PCR probes used for detecting the SOX2 mRNA is Taqman Human Gene Expression Assay (Life Technologies). All experiments represents data from 3 biological replicates, n::::3, error bars show s.e.m.
[0096] Figure 70 depicts NLS architecture optimization for SpCas9.
[0097] Figure 71 shows a QQ plot for NGGNN sequences.
[CI098] Figure 72 shows a histogram of the data density with fitted normal distribution (black line) and ,99 quantile (dotted line).
[0099] Figure 73A-C shows RNA-guided repression of bgaA expression by dgRNA::cas9**. a. The Cas9 protein binds to the tracrR A, and to the precursor CRISPR RNA which is processed by RNAselll to form the crRNA. The crRNA directs binding of Cas9 to the bgaA promoter and represses transcription, b. The targets used to direct Cas9** to the bgaA promoter are represented. Putative -35, -10 as well as the bgaA start codon are in bold. c. Betagaiactosidase activity as measure by Miller assay in the absence of targeting and for the four different targets.
[00100] Figure 74A-E shows characterization of Cas9** mediated repression, a. The gfpmui2 gene and its promoter, including the -35 and -10 signals are represented together with the position of the different target sites used the study, b. Relative fluorescence upon targeting of the coding strand, c. Relative fluorescence upon targeting of the non-coding strand, d. Northern blot with probes B477 and B478 on RNA extracted from T5, T10, B10 or a control strain without a target, e. Effect of an increased number of mutations in the 5' end of the crRNA of Bl, T5 and B10.
[00101] The figures herein are for illustrative purposes only and are not necessarily drawn to scale,
DETAILED DESCRIPTION OF THE INVENTION
[00102] The terms "polynucleotide", "nucleotide", "nucleotide sequence", "nucleic acid" and "Oligonucleotide" are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonueleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (niRNA), transfer RNA, ribosomai RNA, short interfering RNA (siRNA), short-hairpin RNA (shR A), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers, A polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nuc!eotide components. A polynucleotide may be further modified after polymerizatio , such as by conjugation with a labeling component.
[00103] In aspects of the i ve tion the terms "chimeric RNA", "chimeric guide RNA", "guide RNA", "single guide RNA" and "synthetic guide RNA" are used interchangeably and refer to the polynucleotide sequence comprising the guide sequence, the tracr sequence and the tracr mate sequence. The term "guide sequence" refers to the about 20bp sequence within the guide RNA that specifies the target site and may be used interchangeably with the terms "guide" or "spacer". The term "tracr mate sequence" may also be used interchangeably with the term "direct repeat(s)".
[00104] As used herein the term "wild type" is a term of the art understood by skilled perso s and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
[00105] As used herein the term "variant" should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
[00106] The terms "non-naturally occurring" or "engineered" are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
[00107] "Complementarity" refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100%) complementary). "Perfectly complementary" means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. "Substantially complementary" as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under strirs gen t condi tion s .
[00108] As used herein, "stringent conditions" for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes wit the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non -limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter "Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y.
[00109] "Hybridization" refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PGR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the "compl ement" of the given sequence.
[00110] As used herein, "expression" refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as "gene product." If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic ceil.
[00111] The terms "polypeptide", "peptide" and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term "amino acid" includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or I, optical isomers, and amino acid analogs and peptidomimetics.
[00112 J The terms "subject," "individual," and "patient" are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.
[00113] The terms "therapeutic agent", "therapeutic capable agent" or "treatment agent" are used interchangeably and refer to a molecule or compound that confers some beneficial effect upon administration to a subject. The beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition; reducing or preventing the onset of a disease, symptom, disorder or condition; and generally counteracting a disease, symptom, disorder or pathological condition.
[00114] As used herein, "treatment" or "treating," or "palliating" or "ameliorating" are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment. For prophylactic benefit, the compositions may be administered to a subject at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, even though the disease, condition, or symptom may not have yet bee manifested .
[00115] The term "effective amount" or "therapeutically effective amount" refers to the amount of an agent that is sufficient to effect beneficial or desired results. The therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be detennined by one of ordinary skill in the art. The term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.
[00116] The practice of the present invention employs, unless otherwise indicated, conventional techniques of immunology, biochemistry, chemistry, molecular biology, microbiology, cel l biology, genomics and recombinant D A, which are within the skill of the art. See Sambrook, Fritsch and Maniatis, MOLECULAR CLONING: A LABORATORY MANUAL, 2nd edition (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (1987)); the series METHODS IN EN ZYM OLOGY (Academic Press, Inc.): PGR 2: A PRACTICAL APPROACH (M.J. MacPherson, B.D. Flames and G.R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL, and ANIMAL CELL CULTURE. (R.I. Freshney, ed. (1987)).
[00117] Several aspects of the invention relate to vector systems comprising one or more vectors, or vectors as such. Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells. For example, CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in GoeddeL GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
[00118] Vectors may be introduced and propagated in a prokaryote. In some embodiments, a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system). In some embodiments, a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism. Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein. Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protem to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Example fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31 -40), pMAL (New England Biolabs, Beverly, Mass.) and pRJT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
[001191 Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET l id (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
[00120] In some embodiments, a vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa ( uijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif).
[00121] In some embodiments, a vector drives protein expression in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
[00122] In some embodiments, a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotie cells see, e.g., Chapters 16 and 17 of Sambrook, et al., MOLECULAR. CLONING: A LABORATORY'' MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
[00123] In some embodiments, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue- specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory- elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T ceil receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Baneiji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741 -748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlimd, et al, 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally- regulated promoters are also encompassed, e.g., the murine hox promoters ( essel. and Grass, 1990. Science 249: 374-379) and the a-fetoprotein promoter ί Cam pes and Tiighman, 1989. Genes Dev. 3: 537-546).
[00124] In some embodiments, a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expressio of the one or more elements of the CRISPR system, in general, C ISPRs (Clustered Regularly Interspaced Short Palindromic Repeats), also known as SPIDRs (SPacer Interspersed Direct Repeats), constitute a family of DNA loci that are usually specific to a particular bacterial species. The CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacterid., 169:5429-5433 [1987]; and Nakata et al, J. BacterioL, 171 :3553- 3556 [ 1989]), and associated genes. Similar interspersed SSRs have been identified in Haloferax mediterranei, Streptococcus pyogenes, Anabaena, and Mycobacterium tuberculosis (See, Groenen et al., Mol. Microbiol, 10: 1057- 1065 [1993]; Hoe et al., Emerg. Infect. Dis., 5:254-263 [1999]; Masepohi et al, Biochim. Biophys. Acta 1307:26-30 [1996]; and Mojica et al, Mol. Microbiol., 17:85-93 [1995]). The CRISPR loci typically differ from other SSRs by the stmcture of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OM1CS J. Meg. Biol, 6:23-33 [2002]; and Mojica et al, Mol. Microbiol, 36:244-246 [2000]). In general, the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra). Although the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J, Bacterid., 182:2393-2401 [2000]). CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43: 1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobac lum, Sulfolobus, Archaeoglobus, Halocarcula, M ethanobacterium, M ethanococcus, M ethanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomonas, Desulfovibrio, Geobacter, Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanihomonas, Yersinia, Treponema, and Thermotoga.
[00125] In general, "CRISPR system" refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated ("Cas") genes, including sequences encoding a Cas gene, a tracr (trans -activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrR A), a tracr-mate sequence (encompassing a "direct repeat" and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer" in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus. In some embodiments, one or more elements of a CRISPR system, is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). In the context of formation of a CRISPR complex, "target sequence" refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence a d a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex. A target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a ceil. In some embodiments, the target sequence may be within an organelle of a eukaryotic cell, for example, mitochondrion or chlorop!ast. A sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an "editing template" or "editing polynucleotide" or "editing sequence". In aspects of the invention, an exogenous template poly ucleotide may be referred to as a editing template. In an aspect of the invention the recombination is homologous recombination.
[00126] Typically, in the context of an endogenous CRISPR system, formation of a CRISPR complex (comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins) results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence. Without wishing to be bound by theory, the tracr sequence, which may comprise or consist of al l or a portion of a wild- type tracr sequence (e.g. about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence), may also form part of a CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operabiy linked to the guide sequence. In some embodiments, the tracr sequence has sufficient complementarity to a tracr mate sequence to hybridize and participate in formation of a CRISPR complex. As with the target sequence, it is believed that complete complementarity is not needed, provided there is sufficient to be functional. In some embodiments, the tracr sequence has at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. In some embodiments, one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites. For example, a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operabiy linked to separate regulatory elements on separate vectors. Alternatively, two or more of the elements expressed from the same or different regulatory elements, may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5" with respect to ("upstream" of) or 3' with, respect to ("downstream" of) a second element. The coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding a C ISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
[00.1.27] In some embodiments, a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a "cloning site"). In some embodiments, one or more insertion sites (e.g. about or more than about I, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors. In some embodiments, a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulator}' element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic ceil. In some embodiments, a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to al low insertion of a guide sequence at each site. In such an arrangement, the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these. When multiple different guide sequences are used, a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell. For example, a single vector may comprise about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about .1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequenee-containing vectors may be provided, and optionally delivered to a cell.
[00128] In some embodiments, a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein. Non-limiting examples of Cas proteins include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl , Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5,
Figure imgf000037_0001
Cmrl , Cmr3, Cmr4, Cmr5, Cnrr6, Csbl , Csb2, Csb3, Csxl7, CsxM, Csx lO, Cs l6, CsaX, Csx3, Cs l, Csxl5, Csfl , Csf2, CsO, Csf4, homologs thereof, or modified versions thereof. These enzymes are known; for example, the amino acid sequence of S. pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2, In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments the CRISPR enzyme is Cas9, and may be Cas9 from S. pyogenes or S. pneumoniae. In some embodime ts, the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wifd-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate -to-a!anine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A. In some embodiments, a Cas9 nickase may be used in combination with guide sequenc(es), e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ. Applicants have demonstrated (data not shown) the efficacy of two nickase targets (i.e., sgRNAs targeted at the same location but to different strands of DNA) in inducing mutagenic NHEJ. A single nickase (Cas9-D10A with a single sgRNA) is unable to induce NBEJ and create indels but Applicants have shown that double nickase (Cas9~D10A and two sgRNAs targeted to different strands at the same location) can do so in human embryonic stem cells (hESCs). The efficiency is about 50% of nuclease (i.e., regular Cas9 without D10 mutation) in hESCs.
[00129] As a further example, two or more catalytic domains of Cas9 (RuvC I, RuvC II, and RuvC HI) may be mutated to produce a mutated Cas9 substantial ly lacking all DNA cleavage activity. In some embodiments, a DI0A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity. In some embodiments, a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01 %, or lower with respect to its non-mutated form. Other mutations may be useful; where the Cas9 or other CRISPR enzyme is from a species other than S. pyogenes, mutations in corresponding amino acids may be made to achieve similar effects.
[00130] In some embodiments, an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular ceils, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhan ced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRN As in a ceil is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database", and these tables can be adapted in a number of ways. See Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000" Nuci. Acids Res, 28:292 (2000), Computer algorithms for codon optimizing a particular sequence for expression in a particular host ceil are also available, such as Gene Forge (Aptagen: Jacobus, PA), are also available. In some embodiments, one or more codons (e.g. 1 , 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
[00131] In some embodiments, a vector encodes a CR ISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the CRISPR enzyme comprises about or more than about 1. 2, 3, 4, 5, 6, 7, 8, 9, 10. or more NLSs at or near the ami no -terminus, about or more tha about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more N LSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the ammo-terminus and one or more NLS at the earboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In a preferred embodiment of the invention, the CRISPR enzyme comprises at most 6 NLSs, In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. Typically, an NLS consists of one or more short sequences of positively charged lysines or arginines exposed on the protein surface, but other types of NLS are known. Non- limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV ; the NLS from nucleopSasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK); the c-myc NLS having the amino acid sequence PAAKRV LD or RQRRNELKRSP; the hRNPAl M9 NLS having the sequence NQSSNFGPM GGNFGGRSSGPYGGGGQYFAKPRNQGGY; the sequence R RIZFKNKGKDTA:ELRRRRVE 7S 7ELRKAKKDEQILKRRNV of the IBB domain from importin-alpha; the sequences VSR RPRP and PPKKARED of the myoma T protein; the sequence POP KKPL of human p53; the sequence SAIJKKKKK AP of mouse c- abl IV; the sequences DRLR R and PKQKKRK of the influenza vims NS 1 ; the sequence RKLKKKIKKL of the Hepatitis virus delta antigen; the sequence REKKKFLKRR of the mouse Mx1 protein; the sequence KR GDEVDGVDEVAKKKSKK of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK of the steroid hormone receptors (human) glucocorticoid.
0Θ 2 ] In general, the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI). Examples of detectable markers include fluorescent proteins (such as Green fluorescent proteins, or GFP; RFP; CFP), and epitope tags (HA tag, flag tag, SNAP lag). Cell nuclei .may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or e zyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
[00133] In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%. 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith -Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Ciustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, Sa Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In some embodiments, a guide sequence Is about or more tha about 5, 10, I I, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence- specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay. For example, the components of a CRISPR system sufficient to form a CRISPR complex, including the guide sequence to be tested, may be provided to a host ceil having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art.
[00134] A guide sequence may be selected to target any target sequence. In some embodiments, the target sequence is a sequence within a genome of a cel l. Exemplar}' target sequences include those that are u ique in the target genome. For example, for the S. pyogenes Cas9, a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNXGG where NNNNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. A unique target sequence in a genome may include an S. pyogenes Cas9 target site of the form MMMMMMMMA'IN N N N NNNXGG where mm¾¾ XGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. For the S. thermophilics CRISPRl Cas9, a unique target sequence in a genome may include a Cas9 target site of the form MMMMM MMMNNNNNNNNNNNNXXAGAAW where NNNNNNNNNNNNXXAGAAW (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome. A unique target sequence in a genome may include an S. thermophilus CRISPRl Cas9 target site of the form MM MMMMMMMN N N NNNNNXXAGAAW where
NNNNNNNNNNNXX AG A A W (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome. For the S. pyogenes Cas9, a unique target sequence in a genome may include a Cas9 target site of the form MMMMMM MMNNNNNNNNNNNNXGGXG where NNNNNNNNNNNNXG GX G (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome, A unique target sequence in a genome may include an S. pyogenes Cas9 target site of the form MMM MM MMMMNNNNNNNNNNNXGGXG where NNNNNNNNNNNXGGXG (N is A, G, T, or C; and can be anything) has a single occurrence in the genome. In each of these sequences "M" may be A, G, T, or C, and need not be considered in identifying a sequence as unique.
[00135] In some embodiments, a guide sequence is selected to reduce the degree of secondary structure within the guide sequence. Secondary structure may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFo!d, as described by Zuker and Stiegier (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfokl, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et ., 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62). Further algorithms may be found in U.S. application Serial No. TBA (attorney docket 44790.11.2022; Broad Reference BI-2013/004A); incorporated herein by reference.
[00136] In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence. In some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. Example illustrations of optimal alignment between a tracr sequence and a tracr mate sequence are provided in Figures 12B and I3B. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin. Preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences. The sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG. In an embodiment of the invention, the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In preferred embodiments, the transcript has two, three, four or five hairpins. In a further embodiment of the invention, the transcript has at most five hairpins. In some embodiments, the single transcript further includes a transcription termination sequence; preferably this is a polyT sequence, for example six T nucleotides. An example illustration of such a hairpin structure is provided in the lower portion of Figure 13B, where the portion of the sequence 5' of the final "N" and upstream of the loop corresponds to the tracr mate sequence, and the portion of the sequence 3' of the loop corresponds to the tracr sequence. Further non- limiting examples of single polynucleotides comprisi g a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5' to 3'), where "N" represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1 ) catgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT; (2) isnsnsnsnsnsnsnsns ^
acaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT; (3)
N N N N N N NNNNNNNNgtttttgtactctcaGAA^'Vtgcagaagctacaaagataaggcttcatgccgaaatca acaccctgtcattttatggcagggtgtTTTTTT; (4) NNNNNNNNNNNNNNNNNNNNgttttagagctaGAAAtagcaagttaaaataaggetagtcegttatcaacttgaaaa agtggcaccgagtcggtgcTTTTTT; (5)
NNNNNNNNNNN NgttttagagctaGAAAl'AGcaagttaaaataaggctagtccgttatcaacttgaa aaa gtgTTTTTTT; and (6)
N NNNgtittagagctagAAATAGcaagttaaaataaggcl glccgtlatcaTTTTT TTT. In some embodiments, sequences (1) to (3) are used in combinatio with Cas9 from S. thermophilus CRJSPR1. In some embodiments, sequences (4) to (6) are used in combination with Cas9 from S. pyogenes. In some embodiments, the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence (suc as illustrated in the top portion of Figure 13B).
[00137] In some embodiments, a recombination template is also provided. A recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide. In some embodiments, a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex. A template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In some embodiments, the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1 , 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more ucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1 , 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
0ΘΟ8] In some embodiments, the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme). A CR ISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains. Examples of protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methyl ase activity, demethyiase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity. Non-limiting examples of epitope tags include histidme (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP). A CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP! 6 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US201 10059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
[00139] In some aspects, the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host. cell. In some aspects, the invention further provides cells produced by such methods, and organisms (such as animals, plants, or fungi) comprising or produced from such cel ls. In some embodiments, a CRISPR enzyme in combi ation with (and optionally compiexed with) a guide sequence is delivered to a cell. Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding components of a CRISPR system to cells in culture, or in a host organism. Non-viral vector delivery systems include DNA plasniids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid compiexed with a delivery vehicle, such as a liposome. Viral vector delivery systems include DN A and RNA viruses, which have either episomal or integrated genomes after delivery to the ceil. For a review of gene therapy procedures, see Anderson, Science 256:808-813 ( 1992); Nabef & Feigner, TIBTECH 1 1 :21 1 - 217 ( 1993 ); Mitani & Caskey, TIBTECH 1 1 : 162-166 ( 1993 ); Dillon, TIBTECH 11 : 167- 175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10): 1 149-1 154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(l):33 -44 (1995); Haddada et a!., in Current Topics in Microbiology and Immunology, Doerfler and Bohm (eds) (1995); and Yu et al., Gene Therapy 1 : 13-26 (1994).
[00140] Methods of non-viral delivery of ucleic acids mciude lipoiection, nucleofeetion, microinjection, biolistics, virosomes, liposomes, immunoliposomes, poiycation or lipid :nucleic acid co jugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipoiection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administratio ) or target tissues (e.g. in vivo administration).
[00141 J The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well k own to one of skill in the art (see, e.g., Crystal, Science 270:404-410 ( 1995); Blaese et al., Cancer Gene Ther. 2:291-297 ( 1995); Behr et al, Bioconjugate Chem. 5:382-389 (1994); Remy et al, Bioconjugate Chem, 5:647-654 (1994); Gao et al, Gene Therapy 2:710-722 (1995); Ahmad et al, Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos, 4,186,183, 4,217,344, 4,235,871 , 4,261 ,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).
[00142] The use of RNA or DNA viral based systems for the deliveiy of nucleic acids takes advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo). Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associaied and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeiio-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in ma )? different cell types and target tissues.
[00143 J The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral tilers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LT s are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cel l to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia vims (GaLV), Simian Immuiio deficiency vims (SIV), human immuno deficiency vims (HIV), and combinations thereof (see, e.g., Buchscher et al, J. Virol. 66:2731 -2739 (1992); Johann et al, J. Virol. 66: 1635-1640 (1992); Sommnerfelt ei al., Virol 176:58-59 (1990); Wilson et al, J. Virol 63:2374-2378 (1989); Miller et al, J. Virol. 65:2220-2224 (1991); PCT/US94/05700).In applications where transient expression is preferred, adenoviral based systems may be used. Adenoviral based vectors are capable of very high transduction efficiency in man)? cell types and do not require ceil division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Adeno-associated vims ("AAV") vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al,, Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641 ; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94: 1351 (1994), Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251 -3260 (1985); Tratschiii, et al, Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81 :6466- 6470 (1984); and Samulski et al, J. Virol. 63:03822-3828 (1989).
[00144] Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ψ2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by producing a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide^) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess 1TR sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line may also be infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination wit adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. Additional methods for the delivery of nucleic acids to cells are known to those skilled in the art. See, for example, US200300878 1 7, incorporated herein by reference.
[00145] In some embodiments, a host cell is transiently or non-transiently transfecte with one or more vectors described herein. In some embodiments, a cell is transfected as it naturally occurs in a subject. In some embodiments, a cell that Is transfected is taken from a subject. In some embodiments, the cell is derived from cells taken from a subject, such as a cell line. A wide variety of ceil lines for tissue culture are known in the art. Examples of cell lines include, but are not limited to, C8161 , CCRF-CEM, MOLT, mlMCD-3, NHDF, HeLa-S3, Huhl , Huh4, Huh7, Nl .'V LC . HASMC, HEKn, HEKa, MiaPaCell, Panel , PC-3, TF1 , CTLL-2, C 1 R, Rat6, CV 1, RPTE, A10, T24, J82, A375, ARH-77, Calul, SW480, SW620, S OV3, SK-UT, CaCo2, P388D1 , SEM-K2, WEHI-231 , HB56, TIB55, Jurkat, J45.01 , LRMB, Bcl-1 , BC-3, IC21 , DLD2, R.aw264.7, NRK, NRK-52E, MR.C5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A, BS-C-1 monkey kidney epithelial, BALB/ 3T3 mouse embryo fibroblast, 3T3 Swiss, 3T3-L1 , 132-d5 human fetal fibroblasts; 10.1 mouse fibroblasts, 293-T, 3T3, 721, 9L, A2780, A2780ADR, A2780cis, A172, A20, A253, A431, A-549, ALC, B16, B35, BCP-1 cells, BEAS- 2B, bEnd.3, BHK-21 , BR 293, BxPC3, C3H-10T1/2, C6/36, ( 'a 1-27. CHO, CHO-7, CHO-IR, CHO-K1 , CHO-K2, CHO-T, CHO Dhfr -/-, COR-L23, COR-L23/CPR, COR-L23/5010, COR- L23/R23, COS-7, COV-434, CML Tl , CMT, CT26, D17, DH82, DU145, DuCaP, EL4, EM 2, EM3, EMT6/AR1 , EMT6/AR10.0, FM3, HI 299, H69, HB54, HB55, HCA2, HE -293, HeLa, Hepalclc7, HL-60, HMEC, HT-29, Jurkat, JY cells, 562 cells, u812, CL22, G1, KYOl, L Cap, Ma-Mel 1 -48, MC-38, MCF-7, MCF-IOA, MDA-MB-231 , MDA-MB-468, MDA-MB- 435, MDCK II, MDCK II, MGR/Q.2R, MONO-MAC 6, MTD-1A, MyEnd, NCI-H69/CPR, 'NCI-H69/L 10, NCI-H69/LX20, NCI-H69/LX4, NIH-3T3, NALM-1 , NW-145, OPCN / OPCT cell lines, Peer, PNT- 1A / PNT 2, RenCa, RIN-5F, RMA/RMAS, Saos-2 cells, Sf-9, SkBr3, T2, T-47D, T84, THP1 cell line, U373, U87, U937, VCaP, Vero cells, WM39, WT-49, X63, YAC-1, YAR, and transgenic varieties thereof. Cell lines are available from a variety of sources known to those with skill in the art (see, e.g., the American Type Culture Collection (ATCC) (Manassus, Va.j). Irs some embodiments, a cell transfeeted with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences. In some embodiments, a cel l transiently transfeeted with the components of a CRISPR system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CR1SPR complex, is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence. In some embodiments, cells transiently or non-transiently transfeeted with one or more vectors described herein, or cell lines derived from such ceils are used in assessing one or more test compounds.
| 00146| In some embodiments, one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant. In some embodiments, the transgenic animal is a mammal, such as a mouse, rat, or rabbit. In certain embodiments, the organism or subject is a plant. In certain embodiments, the organism or subject or plant is algae. Methods for producing transgenic plants and animals are known in the art, and generally begin with a method of cell transfeciion, such as described herein.
[00147] In one aspect, the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
0Θ148] In one aspect, the invention provides a method of modifying expression of a polynucleotide in a eukaryotic ceil. In some embodiments, the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
[00149] With recent advances in crop genomics, the ability to use CRISPR-Cas systems to perform efficient and cost effective gene editing and manipulation will allow the rapid selection and comparison of single and multiplexed genetic manipulations to transform such genomes for improved production and enhanced traits. In this regard reference is made to US patents and publications: US Patent No. 6,603,061 - Agrobacterium- Mediated Plant Transformation Method; US Patent No. 7,868,149 - Plant Genome Sequences and Uses Thereof and US 2009/0100536 - Transgenic Plants with Enhanced Agronomic Traits, all the contents and disclosure of each of which are herein incorporated by reference in their entirety. In the practice of the invention, the contents and disclosure of Morrell et al "Crop genomicstadvances and applications" Nat Rev Genet. 201 1 Dec 29;13(2):85-96 are also herein incorporated by reference in their entirety. In an advantageous embodiment of the invention, the CRISPR Cas9 system is used to engineer microalgae (Example 15). Accordingly, reference herein to animal cells may also apply, mutatis mutandis, to plant cells unless otherwise apparent. [00150] In one aspect, the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro. In some embodiments, the method comprises sampling a cell or population of cells from a human or non- human animal or plant (including micro-algae), and modifying the cell or cells. C alluring may occur at any stage ex vivo. The cell or cells may even be re-introduced into the non-human animal or plant (including micro-algae).
[00151] In plants, pathogens are often host-specific. For example, Fusarium oxysporum f. sp. lycopersici causes tomato wilt but attacks only tomato, and F. oxysporum f. dianthii Puccinia graminis f. sp. tritici attacks only wheat. Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability that gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants. In plants there can be non-host resistance, e.g., the host and pathogen are incompatible. There can also be Horizontal Resistance, e.g., partial resistance against all races of a pathogen, typically controlled by many genes and Vertical Resistance, e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes. In a Gene-for-Gene level, plants and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural Variability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance. The sources of resistance genes include native or foreign Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents. Using the present invention, plant breeders are provided with a new tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
[ 00152] In one aspect, the invention provides kits containing any one or more of the elements disclosed in the above methods and compositions. In some embodiments, the kit comprises a vector system and instructions for using the kit. In some embodiments, the vector system comprises (a) a first regulatory element operabiy linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme eompiexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence; and/or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence. Elements may be provide individual ly or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language.
[00153] In some embodiments, a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein. Reagents may be provided in any suitable container. For example, a kit may provide one or more reaction or storage buffers. Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyopiiiiized form). A buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof. In some embodiments, the buffer is alkaline. In some embodiments, the buffer has a pH from about 7 to about 10. In some embodiments, the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element, in some embodiments, the kit comprises a homologous recombination template polynucleotide.
[00154] In one aspect, the invention provides methods for using one or more elements of a CRISPR system. The CRISPR complex of the invention provides an effective means for modifying a target polynucleotide. The CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types. As such the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis. An exemplary CRISPR complex comprises a CRISPR enzyme eompiexed with a guide sequence hybridized to a target sequence within the target polynucleotide. The guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence. [00155] The target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell. For example, the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell. The target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA). Without wishing to be bound by theory, it is believed that the target sequence should be associated with a PAM (protospacer adjacent motif); that is, a short sequence recognized by the CR ISPR complex. The precise sequence and length requirements for the PAM differ depending on the CRISPR enzyme used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (thai is, the target sequence) Examples of PAM sequences are given in the examples section beiowr, and the skilled person will be able to identify further PAM sequences for use with a given CRISPR enzyme.
0Θ156] The target polynucleotide of a CRISPR complex may include a number of disease- associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in US provisional patent applications 61 /736,527 and 61/748,427 having Broad reference BI-2011/008/WSGR Docket No. 44063-701.1 Gland BI- 201 1/008/WSGR Docket No. 44063-701 .102 respectively, both entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on December 12, 2012 and January 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
[00157] Examples of target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide. Examples of target polynucleotides include a disease associated gene or polynucleotide. A "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cel ls of a non disease control. It may be a gene that becomes expressed at an abnormally high level; it may be a gene that becomes expressed at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease. A disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease. The transcribed or translated products may be known or unknown, and may be at a normal or abnormal level. [00158] Examples of disease-associated genes and polynucleotides are available from McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Bethesda, Md.), available on the World Wide Web.
[00159] Examples of disease-associated genes and polynucleotides are listed in Tables A and B. Disease specific information is available from McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Bethesda, Md.), available on the World Wide Web. Examples of signaling biochemical pathway-associated genes and polynucleotides are listed in Table C.
[00160] Mutations in these genes and pathways can result in production of improper proteins or proteins in improper amounts which affect function. Further examples of genes, diseases and proteins are hereby incorporated by reference from US Provisional application 61/736,527 filed on December 12, 2012 and 61/748,427 filed on February 2, 2013. Such genes, proteins and pathways may be the target polynucleotide of a CRISPR complex.
Table A
Figure imgf000053_0001
Figure imgf000054_0001
Parkinson's Disease x-Synuclein: DJ-1; 1.RR 2: Parkin; PINK!
Blood and Anemia (CDA 1 , CDA1, RPSI9, DBA, P LR, PKl, NT5C3, UMPHL coagulation diseases PSN1, RHAG, RH50A, NRAMP2, SPTB, ALAS2, ANH1, ASB, and disorders ABCB7, ABC7, AS AT); Bare lymphocyte syndrome (TAPBP, TPSN,
TAP2, ABCB3, PSF2, RING 11, MHC2TA, C2TA, RFX5, RFXAP, RFX5), Bleeding disorders (TBXA2R, P2RX1, P2X1); Factor H and factor H-iike 1 (HF1, CFH, HUS); Factor V and factor VIII (MCFD2); Factor VII deficiency (F7); Factor X deficiency (F10); Factor XI deficiency (Fll); Factor XII deficiency (F12, HAF); Factor ΧΪΙΙΑ deficiency (F13AL F13A); Factor XIIIB deficiency (F13B); Fanconi anemia (FANCA, FACA, FAl, FA, FAA, FAAP95, FAAP90, FLJ34064, FA CB, FANCC, FACC, BRCA2, FANCD1, FANCD2, FANCD, FACD, FAD, FANCE, FACE, FANCF, XRCC9, FANCG, BRIP1, BACH1, FANCJ, PHF9, FANCL, FANCM, IAA1596);
Hernophagocytic lynrphohistiocyiosis disorders (PRF1, HPLH2,
UNCI 3D, MUNCI3~4, HPLH3, HLH3, FHL3); Hemophilia A (F8, F8C, HEMA); Hemophilia B (F9, HEMB), Hemorrhagic disorders (PI, ΛΊΎ. F5); Leukocyde deficiencies and disorders (ITGB2, CD 18, LCAMB, LAD, EIF2B1, EIF2BA, E:1F2B2, EIF2B3, EIF2B5, LV WM, CACH, CLE, EIF2B4); Sickle cell anemia (HBB); Thalassemia (HBA2, HBB, HBD, LCRB, HBA1).
Cell dysregulation B-cell non-Hodgkin lymphoma (BCL7A, BCL7); Leukemia (TALI, and oncology TCL5, SCL, TAL2, FLT3, NBS i, NBS, ZNFN1A1 , IKi, LYFi, diseases and disorders HOXD4, HQX4B, BCR, CML, PHL, ALL, ARNT, KRAS2. RASK2,
GMPS, AF10, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CHIC2, BTL, FLT3, KIT, PBT, LPP, NPM1, NUP214, D9S46E, CAN, CAIN, RIJNXl , CBFA2, AM I i . WHSC1 L1, NSD3, FLT3, AF1Q, NPM 1, NUMA1 , ZNF145, PLZF, PML, MY i .. STATS B, AF10, CALM, CLTH, ARLI L ARLTS1, P2RX7, P2X7, BCR, CML, PHL, ALL, GRAF, NF1, VRNF, WSS, NFNS, PTPN1 1 , PTP2C, SHP2, NS i, BCL2, CCND i, PR A 1) 1 . BCLi, TCRA, GATAl, GFl, ERYF1, NFE1, ABLl, NQOl, DIA4, NMOR1, NUP214, D9S46E, CAN, CAIN).
I flammation and AIDS (KIR3DL1, NKAT3. NKB1, AMBI L KIR3DS1, IFNG, CXCLI2, immune related SDF1); Autoimmune lymphoproliferative syndrome (TNFRSF6, APT1, diseases and disorders FAS, CD95, ALPS 1 A); Combined immunodeficiency, (IL2RG,
SCIDX1, SCIDX, IMD4); ! I I V- ! (CCL5, SCYA5, DI7S136E, TCP228), HIV susceptibility or infection (I LK), CSIF, CMKBR2, CCR2,
CMKBR5, CCCKR5 (CCR.5)); Immunodeficiencies (CD3E, CD3G, A CDA, AID, HIGM2, TNFRSF5, CD40, IJNG, DGU, HIGM4, TNFSF5. CD40LG. HIGML IGM, FOXP3. 1PEX, AIID, XPID. PIDX, TNFRSF14B, TACI); Inflammation (IL-10, IL-1 (IL-la, IL-lb), IL-13, f I - 1 7 ( l l.- i ?a (CTLA8), IL-17b, IL-17c, IL~ 17d, IL-17f), 11-23, Cx3crl, ptpn22, TNFa, NOD2/CARD15 for IBD, IL-6, IL-12 (IL-12a, IL-12b), CTLA4, Cx3cll); Severe combined immunodeficiencies (SCIDs)(JAK3, JAKL, DCLRE1 C, ARTEMIS, SCIDA, RAG I , RAG2, ADA, PTPRC, CD45, LCA, IL7R, CD3D, T3D, IL2RG, SCIDX1, SCIDX, IMD4).
Metabolic, liver, Amyloid neuropathy (TTR, PALB); Amyloidosis (APOA1, APP, AAA, kidney and protein CVAP, ADl, GSN, FGA, LYZ, TTR, PALB); Cirrhosis (KRT18, KRT8, diseases and disorders CIRH 1A, NAIC, TEX292, KJAA1988); Cystic fibrosis (CFTR, ABCC7,
CF, MRP7); Glycogen storage diseases (SLC2A2, GLUT2, G6PC, G6PT, G6PTI, GAA, LAMP2, LAMPB, AGL, GDE, GBE1, GYS2, PYGL, PFKM); Hepatic adenoma, 142330 (TCFl, HNF1 A, MODY3), Hepatic failure, early onset, and neurologic disorder (SCOD1, SCOl), Hepatic lipase deficiency (LIPC), Hepatoblastoma, cancer and carcinomas (CTNNBl , PDGFRL, PDGRL, PRLTS, AX I I , AXIN, CTNNB1, TP53, P53, LFS1, IGF2R, MPRI, MET, CASP8, MCH5; Medullary cystic kidney disease (UMOD, HNFJ, FJHN, MC D2, ADMCKD2); Phenylkeionuria (PAH, PKU1 , QDPR, DHPR, PTS); Polycystic kidney and hepatic disease (FCYT, PKHDl, ARPKD, PKDl, oi. PKD4, P DTS, PRKCSH, G19P1, PCLD, SEC63).
Muscular / Skeletal Becker muscular dystrophy (DMD, BMD, MYF6), Duchenne Muscular d seases and disorders Dystrophy (DMD, BMD); Eniery-Dreifuss muscular dystrophy (LMNA, LMN1, EMD2, FPU). CMD.1 A, !!GPS. LGMD1B, LMNA, LMNl,
EMD2, FPLD, CMD1A); Facioscapulohumeral muscular dystrophy (FSHMD 1 A, FS HD 1 A); Muscular dystrophy (FKRP, MDC 1 C,
LGMD2I, L.AMA.2, LAMM, LARGE, KIAA0609, MDC ID, FCMD, TTID, MYOT, CAPN3, CANP3, DYSF, LGMD2B, SGCG, LGMD2C, DMDA1, SCG3, SGCA, ADL, DAG2, LGMD2D, DMDA2, SGCB, LGMD2E, SGCD, SGD, LGMD2F, CMD1L, TCA.P, LGMD.2G, CMDIN, TRIM32, HT2A, LGMD2H, FKRP, MDC1C. LGMD2I, TTN. CMD1G, TMD, LGMD2J, POMT1 , CAV3, LGMD1C, SEPN.1, SELN, RSMD1, PLEC1, PLTN, EBSl); Osteopetrosis (LRP5, BMND1, LRP7, LR3, OPPG, VBCH2, CLCN7, CLC7, OPTA.2, OSTMl, GL, TCIRG1, TIRC7, OC116, OPTBl); Muscular atrophy (VAPB, VA.PC, ALS8, SMNl, SMAL SMA2, SMA3, SMA4, BSCL2, SPG17, GARS, SMAD1, CMT2D, HEXB, IGHMBP2, SMUBP2, CATF.1, SMARDl),
Neurological and ALS (SOD1, ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal, diseases and VEGF-c); Alzheimer disease i'APP, AAA, CVAP, ADl, APOE, AD2, disorders PSEN2, AD4, STM2, APBB2, FE65L1, NOS3, PLAU, URK, ACE,
DCPl , ACEL MPO, PACIP1, PAXIP1L, PTIP, A2M, BLMH, BMH, PSEN1, AD3); Autism (Mecp2, B.ZRAP1, MDGA2, SemaSA, Neurexin 1, GLOl, MECP2, RTT, PPMX, MR 16, MRX79, NLGN3, NLGN4, IAA1260, AUTSX2); Fragile X Syndrome (F R2, FXR1, FXR2, mGLUR5); Huntington's disease and disease like disorders (HD, IT15, PRNP, PR1P, J PI 13. JP3, HDL2, TBP, SCA17); Parkinson disease (NR4A2, NUR 1, NOT, TINUR, SNCAIP, TBP, SCA17, SNCA, NACP, PARK I, PARK4, DJ1, PARK7, LRRK2, PARKS, ΡΓΝΚ1, PARK6, UCHL1, PARKS, SNCA, NACP, PARK1, PARK4, PRKN, P.ARK2, PDJ, DBH, NDUFV.2); Rett, syndrome (MECP.2, RTT, PPMX, MRX16, MRX79, CDKL5, STK9, MECP2, RTT, PPMX, MRX16, MRX79, x-Synuclein, DJ-1); Schizophrenia (Neuregulinl (Nrgl), Erb4 (receptor for Neuregulin), Complexinl (Cplxl), Tphl Tnq3tophan hydroxylase, Tph2, Tryptophan hydroxylase 2, Neurexin 1, GSK3, GSK3a", GSK3b, 5-HTT (Slc6a4)," COMT, DRD (Drdla), SLC6A3, DAOA, DTNBP1, Dao (Daol)); Secretase Related Disorders (APH-1 (alpha and beta), Presenilin (Psenl), nicastrin, (Ncstn), PEN-2, Nosl, Parpl, Natl, Nat2); Trinucleotide Repeat Disorders (HTT (Huntington's Dx), SBMA/SMAX1/AR (Kennedy's Dx), FXN/X25 (Friedrich's Ataxia), ATX3 (Machado- Joseph's Dx), ATXN1 and ATXN2
(spinocerebellar ataxias), DMPK (myotonic dystrophy), Atrophin-1 and Ami (DRPLA Dx), CBP (Creb-BP - global instability), VLDLR
(Alzheimer's), Atxn7, AtxnlO).
Occular diseases and Age-related macular degeneration (Abcr, Ccl2, Cc2, cp (ceruloplasmin), disorders Ti.mp3, cathepsinD, Vidir, Ccr2); Cataract. (CRYAA, CRYA1, CRYBB2,
CRYB2, PITX3, BFSP2, CP49, CP47, CRYAA, CRYAI, PAX6, AN2, MGDA, CRYBA.1, CRYB1, CRYGC, CRYG3, (XL. L1M2, MP19, CRYGD, CRYG4, BFSP2, CP49, CP47, HSF4, CTM, FISF4, CTM,
MIP, AQPO, CRYAB, CRYA2, CTPP2, CRYrBBL CRYGD, CRYG4, CRYBB2, CRYB2, CRYGC, CRYG3, CCL, CRY A A, CRYA1 , GJA8, CX50, CAEl, GJA3, CX46, CZP3, CAE3, CCMl, CAM, KRLTi); Corneal clouding and dystrophy (APGAL TGFBI, CSD2, CDGGl, CSD, BIGH3, CDG2, TACSTD2, TROP2, 1S1 , VSX!. RINX, PPCD, PPD, KTCN, COL8A2, FECD, PPCD2, PIP5K3, CFD); Cornea plana congenital ( ERA, CNA2 ; Glaucoma (MYOC, TIG , GLCIA, JOAG, GPOA, OPTN, GLC1E, FIP2, FIYPL, NRP, CYPIBI, GLC3A, OPA1, NTG, NPG, CYPIBI, GLC3A); Leber congenital amaurosis iCRBi, RP12, CRX, CORD2, CRD, RPGRIPl, LCA6, CORD9, RPE65, RP20, AIPLi, LCA4, GUCY2D, GUC2D, LCAi, CORD6, RDH12, LCA3); Macular dystrophy (ELOVL4, ADMD, STGD2, STGD3, RDS, RP7, PRPH2, PRPH, AV I). AOFMD, VMD2).
Figure imgf000057_0001
Figure imgf000058_0001
Figure imgf000059_0001
Figure imgf000060_0001
Figure imgf000061_0001
P KD1 ; MAPKl 0; RELA; PRKCD; MAPK9; ABCB1 ;
TRAF2; TLR4; TNF; INSR; 1 B KG; RELB; MAP3K7; IL8;
CHUK; NR1H2; TJP2; NFKB1; ESR1; SREBF1; FGFR.4;
JUN; IL1R1; PRKCA; IL6
IGF-1 Signaling IGF1; PRKCZ; ELK1; MAPKl; PTPN11; NEDD4; AKT2;
PIK3CA; PRKCI; PTK2; FOS; PIK3CB; PIK3C3; MAPK8;
IGF1R; IRS1; MAPK3; IGFBP7; KRAS; PIK3C2A;
YWHAZ; PXV. RAF1; CASP9; MAP2K2; AKT1; PJX3R1;
PDPK1; MAP2K1; IGFBP2; SI N; JUN; CYR61; AKT3;
FOXOl; SRF; CTGF; RPS6KB1
NRF2~mediated PRKCE; EP300; SOD2; PRKCZ; MAPKl; SQSTMl;
Oxidative
Stress Response NQOl; PIK3CA; PRKCI; FOS; PIK3CB; PIK3C3; MAPK8;
PRKDl; MAPK3; KRAS; PRKCD; GSTP1; MAPK9; FTL;
NFE2L2; PIK3C2A; MAPKl 4; RAF1; MAP3K7; CREBBP;
MAP2K2; AK.T1; PIK3R1 ; MAP2K1; PPIB; JUN; KEAP1;
GSK3B; ATF4; PRKCA; E1F2AK3; !!SPvOAAi
Hepatic Fibrosis/ epatic EDN1; IGF l ; KDR; FLTl; SMAD2; FGFR1; MET; PGF;
Stellate Cell Activation SMAD3; EGFR; FAS; CSF1; NFKB2; BCL2; MYH9;
IGFIR; IL6R; RELA; TLR4; PDGFRB; TNF; RELB; IL8;
PDGFRA; NFKBI; TGFBR1; SMAD4; VEGFA; BAX;
ILIRI; CCL2; HGF; MMPl; STAT1; IL6; CTGF; MMP9
PPAR Signaling EP300; IN : TRAF6; PPARA; RXRA; MAPKl; 1KB KB;
NCOR2; FOS; NFKB2; MAP3K14; STAT5B; MAPK3;
NRJP1; KRAS; PPARG; RELA; STATS A; TRAF2;
PPARGC1A; PDGFRB; TNF; INSR; RAF!; IKBKG;
RELB; MAP3K7; CREBBP; MAP2K2; CeiJK; PDGFRA;
MAP2K1; NFKBI; JUN; IL1R1; HSP90AA1
Fc Epsilon RI Signaling PRKCE; RAC 1 ; PRKCZ; LYN; MAPKl ; RAC2; PTPN11 ;
AKT2; PIK3CA; SYK; PRKCI; PIK3CB; PIK3C3; MAPK8;
PRKD1; MAPK3; MAPK10; KRAS; MAPKl 3; PRKCD;
MAPK9; PIK3C2A; BTK; MAPK14; TNF; RATI; FYN;
MAP2K2; AKT1; PIK3R1; PDPK1; MAP2K1; AKT3;
VAV3; PRKCA
G-Protein Coupled PRKCE; RAP1 A; RGS16; MAPKl; GNAS; AKT2; 1KBKB;
Receptor Signaling P1K3CA; CREB1; GNAQ; NFKB2; CAMK2A; P1K3CB;
PIK3C3; MAPK3; KRAS; RELA; SRC; PIK3C2A; RAF1;
IKBKG; RELB; FYN; MAP2K2; AKT1; PJK3R1; CHUK;
PDPK1; STAT3; MAP2KI; NFKBI; BRAF; ATF4; AKT3;
PRKCA
Inositol Phosphate PRKCE; IRAKI; PRKAA2; EIF2AK2; PTEN; GRK6;
Metabolism MAP l; PLKl; AKT2; PIK3CA; CDK8; PIK3CB; PIK3C3;
MAPK8; MAPK3; PRKCD; PRKAAl ; MAPK9; CDK2;
PIM1; PIK3C2A; DYRKI A; MAP2K2; PIP5K1 A; PIK3R1;
MAP2K1; PAK3; ATM; TTK; CSNK1A1; BRAF; SGK
Figure imgf000063_0001
Figure imgf000064_0001
Signaling
Figure imgf000065_0001
Regulation PRKDC; ATM; SFN; CDKN2A
Figure imgf000066_0001
Signaling Coagulation System BDKRBl ; F2 ; SERPINE1 ; F3
Dopamine Receptor PPP2R1A; PPP2CA; PP 1CC; PPP2R5C
Signaling
Glutathione Metabolism 11)1 12: GSTP1; ANPEP; ! l i l
Glyeerolipid Metabolism ALDH1A 1; GPAM; SPHK l ; SPH 2
Liiioleic Acid PRDX6; GR ; YWHAZ; CYPIBI
Metabolism
Methionine Metabolism DNMT1 ; DNMT3B; AHCY; DNMT3A
Pyruvate Metabolism GLOl ; ALDH IA I ; PKM2; LDHA
Argiiiine and Proline ALDH1A1; NOS3; NOS2A
Metabolism
Eicosanoid Signali g PRDX6; GRN; YWHAZ
Fructose and Mannose HK2; GCK; UK I
Metabolism
Galactose Metabolism HK2; GCK; HK1
Sti!bene, Coumarirse and PRDX6; PRDX1 ; TYR
Lignin Biosynthesis
Antigen Presentation CALR; B2M
Pathway
Biosy thesis of Steroids NQ01; DHCR7
Butanoate Metabolism ALDHIAI; NLGN1
Citrate Cvcle 11» 12; IDHl
Fatty Acid Metabolism ALDHIAI ; CYPIBI
Glyeerophospholipid PRDX6; CHKA
Metabolism
Histidirse Metabolism PRMT5; ALDHI AI
Inositol Metabolism EROIL; APEX1
Metabolism of GSTP1; CY IBI
Xenobiotics
by Cytochrome p450
Methane Metabolism PRDX6; PRDX1
Phenylalanine PRDX6; PRDX1
Metabolism
Propanoate Metabolism ALDHI AI; LDHA
Selenoamino Acid PRMT5; A1:-ICY
Metabolism
Sphingolipid Metabolism SPHKl ; SPHK2
Aminophosplionate PRMT5
Metabolism
Androgen and Estrogen PRMT5
Metabolism
Ascorbate and Aldarate ALDHIAI
Metabolism
Bile Acid Biosynthesis ALDHIAI
Cysteine Metabolism LDHA Fatty Acid Biosynthesis FASN
Glutamate Receptor GNB2L1
Signaling
NRF2 -mediated PRDX1
Oxidative
Stress Response
Pentose Phosphate GPI
Pathway
Pentose and Glucuronate UCHL1
Iiiterconversions
Retinol Metabolism ALDH1A1
Riboflavin Metabolism TYR
Tyrosine eiabolism PRMT5, TYR
Ubiquinone Biosynthesis PRMT5
Valine, Leucine and ALDH1 A1
Isoleucine Degradation
Glycine, Serine and CH A
Threonine Metabolism
Lysine Degradation ALDH1A 1
Pain/Taste TRPM5; TRPA1
Pain TRPM7; TRPC5; TRPC6; TRPC1; Cnrl ; cnr2; Grk2;
Trpal ; Pome; Cgrp; Crf; Pka; Era; Nr2b; TRPM5; Prkaca;
Prkacb; Prkarl a; Prkar2a
Mitochondrial Function AIF; CytC; SMAC (Diablo); Aifm-1; Aifm-2
Developmental BMP-4; Chordin (Chrd); Noggin (Nog); WNT (Wnt2;
Neurology
Wnt2b; Wnt3a; Wnt4; Wnt5a; Wnt6; Wnt7b; Wnt8b;
Wnt9a; Wnt9b; Wntl Oa; Wntl Ob; Wntl6); beta-catenin;
Dkk-1; Frizzled related proteins; Otx-2; Gbx2; FGF-8;
Reelin; Dab! ; unc-86 (Pou4fl or Brn3a); Numb; Rein
[00161] Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairmg particular mutations associated with DNA repeat instability and neurological disorders (Robert D, Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct 13, 2011 - Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeal instability: role of RNA¾DNA hybrids. Mclvor EI, Polak U, Napierala M. RNA Biol. 2010 Sep-Oct;7(5):551-8). The CRISPR- Cas system may be harnessed to correct these defects of genomic instability.
[00162] A further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease. Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence, A few cases of the disease may be caused by mutations in genes yet to be identified. The disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression. Other genetic abnormalities associated with epilepsy may also be targeted by the CRISPR-Cas system and the underlying genetics is further described in Genetics of Epilepsy and Genetic Epilepsies, edited by Giuliano Avanzini, Jeffrey L. Noebels, Mariani Foundation Paediatric Neurology:20; 2009),
[00163] In yet another aspect of the invention, the CRISPR-Cas system .may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
[00164] Several further aspects of the invention relate to correcting defects associated with a wide range of genetic diseases which are further described on the website of the National Institutes of Elealth under the topic subsection Genetic Disorders (website at health.nih.gov/topic/GeneticDisorders). The genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussier-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NINDS Colpocephaly. These diseases are further described on the website of the National Institutes of Health under the subsection Genetic Brain Disorders.
[00165] In some embodiments, the condition may be neoplasia. In some embodiments, where the condition is neoplasia, the genes to be targeted are any of those listed in Table A (in this case PTEN and so forth). In some embodiments, the condition may be Age-related Macular Degeneration, In some embodiments, the condition may be a Schizophrenic Disorder. In some embodiments, the condition may be a Trinucleotide Repeat Disorder. In some embodiments, the condition may be Fragile X Syndrome. In some embodiments, the condition may be a Secretase Related Disorder. In some embodiments, the condition may be a Prion - related disorder. In some embodiments, the condition may be ALS. In some embodiments, the condition may be a drug addiction. In some embodiments, the condition may be Autism. In some embodiments, the condition may be Alzheimer's Disease. In some embodiments, the condition may be inflammation. In some embodiments, the condition may be Parkinson 's Disease.
[00166] Examples of proteins associated with Parkinson 's disease include but are not limited to a-synuclein, DJ~1 , LRRK2, PIN 1 , Parkin, UCHL1 , Synphilin-1 , and XL RR i .
[00167] Examples of addiction-related proteins may include ABAT for example.
[00168] Examples of inflammation-related proteins may include the monocyte ehemoattraetant protein- 1 (MCP1 ) encoded by the Ccr2 gene, the C-C chemokine receptor type 5
(CCR5) encoded by the Ccr5 gene, the IgG receptor IIB (FCGR2b, also termed CD32) encoded by the Fcgr2b gene, or the Fc epsi lon Ri g (FCERl g) protein encoded by the Fcerl g gene, for example.
[00169] Examples of cardiovascular diseases associated proteins may include IL1B (mterieiikm 1 , beta), XDH (xanthine dehydrogenase), TPS 3 (tumor protein p53 ), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), TLA (interieukm 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTS (cathepsin K), for example.
[00170] Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme I (UBA1) encoded by the UBA1 gene, or the NEDD8~activating enzyme El catalytic subunit protein (UBE1 C) encoded by the UBA3 gene, for example.
[00171] Examples of proteins associated Autism Spectrum Disorder may include the benzodiazepine receptor (peripheral) associated protein 1 (BZRA P1 ) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog 1 protein (FXR 1 ) encoded by the FXR1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
0Θ172] Examples of proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABCl) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, or the chemokine (C-C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
[00173] Examples of proteins associated Schizophrenia may include NRG1 , ErbB4, CPLXl , TPHl , TPH2, NRXNl , GS 3A, BDNF, DISC I , GSK3B, and combinations thereof. [00174] Examples of proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v-erb-b2 erythroblastic leukemia viral oncogene homoiog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homoiog 3), ERBB4 (v-erb~b2 erythroblastic leukemia viral oncogene homoiog 4), Notch 1, Notch2, Notch 3, or Notch 4, for example.
[00175] Examples of proteins associated with a secretase disorder may include PSENEN (presenilis enhancer 2 homoiog (C. elegans)), CTSB (cathepsin B), PSEN1 (preseniSin 1 ), APP (amyloid beta (A4) precursor protein), APH1B (anterior pharynx defective 1 homoiog B (C, elegans)), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cleaving enzyme 1), for example.
[00176] Examples of proteins associated with Amyotrophic Lateral Sclerosis may include SODl (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascuiar endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
[00177] Examples of proteins associated with prion diseases may include SODl (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA. (vascular endothelial growth factor A), VAGFB (vascuiar endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
[ 00178] Examples of proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-Macroglobulin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Actin alpha 2 smooth muscle aorta), ADAM22 (ADAM metailopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRAID (Alpha- ID adrenergic receptor for Alpha- I D adrenoreceptor), for example.
[00179] Examples of proteins associated with Immunodeficiency may include A2M [aipha-2- macroglobulinj; AANAT [arylalkylamine N-acetyltransferase] ; ABCA1 [ATP -binding cassette, sub-family A (ABC1), member 1]; ABCA2 [ATP-binding cassette, sub-family A (ABO), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3]; for example. [00180] Examples of proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntingtm), or DMPK (dystrophia myotonic a-protem kinase), FXN (frataxin), ATXN2 (ataxin 2), for example.
[00181 ] Examples of proteins associated with Neurotransmission Disorders include SST (somatostatin), NOSI (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, a!pha-2A-, receptor), ADRA2C (adrenergic, alpha-2C-, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamme (serotonin) receptor 2C), for example.
[00182] Examples of neurodevelopmental-associated sequences include A2BP1 [ataxin 2- binding protein 1 ], AADAT [ammoadipate aminotransferase] , AANAT [arylalkyiamine N- acetyltransferase], ABAT [4-aminobutyrate aminotransferase], ABCA 1 [ATP-binding cassette, sub-family A (ABO), member 1], or ABC A i 3 [ATP-binding cassette, sub-family A (ABO), member 13], for example.
[00183] Further examples of preferred conditions treatable with the present system include may be selected from: Aieardi-Goutieres Syndrome; Alexander Disease; Allan-Herndon-Dudiey Syndrome; POLG-Related Disorders; Alpha-Mannosidosis (Type II and III); Alstrom Syndrome; Angelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta- rrhalassemia; Bilateral Optic Atrophy and (Infantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFS1]; Cerebrotcndinous Xanthomatosis; Cornelia de Lange Syndrome; MAPT-Reiated Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dystrophy; Galactosiaiidosis; Gaucher Disease; Organic Acidemias; Hemophagocytic Lymphohistiocytosis; Hutehin son-Gilford Progeria Syndrome; Mucolipidosis II; Infantile Free Sialic Acid Storage Disease; PLA2G6- Associated Neurodegeiieration; Jervell and Lange-Nielsen Syndrome; Junctional Epidermolysis Bullosa; Huntington Disease; Kxabbe Disease (Infantile); Mitochondrial DNA-Associated Leigh Syndrome and NARP; Lesch-Nyhan Syndrome; LIS1- Associated Lissencephaly; Lowe Syndrome; Maple Syrup Urine Disease; MECP2 Duplication Syndrome; ATP7A-Related Copper Transport Disorders; LAMA2-Related Muscular Dystrophy; Arylsulfatase A Deficiency; Mucopolysaccharidosis Types I, II or III; Peroxisome Biogenesis Disorders, Zellweger Syndrome Spectrum; Neurodegeneration with Brain Iron Accumulation Disorders; Acid Sphingomyelinase Deficiency; Niemann-Pick Disease Type C; Glycine Encephalopathy; ARX-Related Disorders; Urea Cycle Disorders; COL 1 Al /2-Related Osteogenesis Imperfecta; Mitochondrial DNA Deletion Syndromes; PLP1 -Related Disorders; Perry Syndrome; Phelan-McDermid Syndrome; Glycogen Storage Disease Type 11 (Pompe Disease) (Infantile); MAPT-Related Disorders; MECP2 -Related Disorders; Rhizomelic Chondrodysplasia Punctata Type 1 ; Roberts Syndrome; Sandhoff Disease; Sehindler Disease - Type 1; Adenosine Deaminase Deficiency; Smith-Lemli-Opitz Syndrome; Spinal Muscular Atrophy; Infantile-Onset Spinocerebellar Ataxia; Hexosaminidase A Deficiency; Thanatophoric Dysplasia Type 1; Collagen Type VI-Related Disorders; Usher Syndrome Type I; Congenital Muscular Dystrophy; Wolf-Birsehhora Syndrome; Lysosomal Acid Lipase Deficiency; and Xeroderma Pigmentosum.
[00184] As wil l be apparent, it is envisaged that the present system can be used to target any polynucleotide sequence of interest. Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
EXAMPLES
[00185] The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present invention in any fashion. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplar}', and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
Example I: CRISP R Complex Activity in the Nucleus of a Eukaryotic Cell
[00186] An example type II CRISPR system is the type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Casl, Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each). n this system, targeted DNA double-strand break (DSB) is generated in four sequential steps (Figure 2A). First, two non-coding RNAs, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the direct repeats of pre- crRNA, which is then processed into mature crRNAs containing individual spacer sequences. Third, the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heterodupiex formation between the spacer region of the crRNA and the protospacer DNA. Finally, Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer (Figure 2A). This example describes an example process for adapting this RNA-programmable nuclease system to direct CRISPR complex activity in the nuclei of eukaryotic cel ls.
[00187] Cell culture and transfection
[00188] Human embryonic kidney (HEK) cell line HEK 293FT (Life Technologies) was maintained in Duibeeeo's modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (HyClone), 2 m VI GlutaMAX ( Life Technologies), lOOU/mL penicillin, and 100p.g/mL streptomycin at 37°C with 5% C02 incubation. Mouse neuro2A (N2A) cell line (ATCC) was maintained with DMEM supplemented with 5% fetal bovine semm (HyClone), 2mM GlutaMAX (Life Technologies), lOOU/mL penicillin, and l OQ g/mL streptomycin at 37°C with 5% CO;.
[00189] HEK 293 FT or N2A cells were seeded into 24-wel! plates (Corning) one day prior to transfection at a density of 200,000 ceils per well. Cells were transfected using Lipofectamine
2000 (Life Technologies) following the manufacturer's recommended protocol. For each well of a 24-weil plate a total of 800ng of plasmids were used.
[00190] Surveyor assay and sequencing analysis for genome modification
[00191] HEK 293FT or N2A cells were transfected with plasmid DNA as described above.
After transfection, the cells were incubated at 37°C for 72 hours before genomic DNA extraction.
Genomic DNA was extracted using the QuickExtract DNA extraction kit (Epicentre) following the manufacturer's protocol. Briefly, cells were resuspended in QuickExtract solution and incubated at 65°C for 15 minutes and 98°C for 10 minutes. Extracted genomic DNA. was immediately processed or stored at -20°C.
[00192] The genomic region surrounding a CRISPR target site for each gene was PGR amplified, and products were purified using QiaQuick Spin Column (Qiagen) following manufacturer's protocol. A total of 00ng of the purified PGR products were mixed with 2μ1 10 Taq polymerase PGR buffer (Enzymaties) and ultrapure water to a final volume of 20μ1, and subjected to a re-annealing process to enable heterodupiex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute. After re- annealing, products were treated with Surveyor nuclease and Surveyor enhancer S (Transgenomics) following the manufacturer's recommended protocol, and analyzed on 4-20% Novex TBE poly-acrylamide gels (Life Technologies). Gels were stained with SYBR Gold DNA stain (Life Technologies) for 30 minutes and imaged with a Gel Doc gel imaging system (Bio-rad). Quantification was based on relative band intensities, as a measure of the fraction of cleaved DNA. Figure 8 provides a schematic il lustration of this Surveyor assay.
[00193] Restriction fragment length polymorphism assay for detection of homologous recombination
[00194] HE 293FT and N2A cells were transfected with plasmid DNA, and incubated at 37°C for 72 hours before genomic DNA extraction as described above. The target genomic region was PGR amplified using primers outside the homology arms of the homologous recombination (HR) template. PGR products were separated on a 1% agarose gel and extracted with MinElute GelExtraetion Kit (Qiagen). Purified products were digested with Hmdlll (Fermentas) and analyzed on a 6% Novex TBE poly-acrylamide gel (Life Technologies).
[00195] RN A secondary structure prediction and analysis
[00196] RNA secondary structure prediction was performed using the online webserver RNAfold developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et at, 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62).
[00197] Bacterial plasmid transformation interference assay
[00198] Elements of the S. pyogenes CRISPR locus 1 sufficient for CRISPR activity were reconstituted in E. coli using pCRISPR plasmid (schematically illustrated in Figure 10A), pCRISPR contained tracrRNA, SpCas9, and a leader sequence driving the crRNA array. Spacers (also referred to as "guide sequences") were inserted into the crRNA array between Bsal sites using annealed oligonucleotides, as illustrated. Challenge plasmids used in the interference assay were constructed by inserting the protospacer (also referred to as a "target sequence") sequence along with an adjacent CRISPR motif sequence (PAM) into pUC19 (see Figure 10B). The challenge plasmid contained ampicillin resistance. Figure IOC provides a schematic representation of the interference assay. Chemical ly competent E. coli strains already carrying pCRISPR and the appropriate spacer were transformed with the challenge plasmid containing the corresponding protospacer-PAM sequence. pUC19 was used to assess the transformation efficiency of each pCRIS PR-carrying competent strain. CRISPR activity resulted in cleavage of the pPSP piasmid carrying the protospacer, precluding ampicillin resistance otherwise conferred by pUC19 lacking the protospacer. Figure ! OD illustrates competence of each pCRISPR- carrying E. cofi strain used in assays illustrated in Figure 4C.
[00199] RNA purification
[00200] FJEK 293FT cells were maintained and transfected as stated above. Cells were harvested by trypsinization followed by washing in phosphate buffered saline (PBS). Total cell RNA was extracted with TRI reagent (Sigma) following manufacturer's protocol. Extracted total RNA was quantified using Naonodrop (Thermo Scientific) and normalized to same concentration.
[00201] Northern blot analysis ofcrRNA and tracrKNA expression in mammalian cells
[00202] RNAs were mixed with equal volumes of 2X loading buffer (Ambion), heated to 95°C for 5 min, chilled on ice for 1 min, and then loaded onto 8% denaturing polyacrylamide gels (SequaGel, National Diagnostics) after pre-running the gel for at least 30 minutes. The samples were electrophoresed for 1.5 hours at 40W limit. Afterwards, the RNA was transferred to Hybond N+ membrane (GE Healthcare) at 300 mA in a semi-dry transfer apparatus (Bio-rad) at room temperature for 1 .5 hours. The RNA was crosslinked to the membrane using autocrossiink button on Stratagene UV Crosslinker the Stratalinker (Stratagene). The membrane was pre-hyhridized in ULTRAhyb-Oligo Hybridization Buffer (Ambion) for 30 min with rotation at 42°C, and probes were then added and hybridized overnight. Probes were ordered from IDT and labeled with [gamma-""?] ATP s erk in Elmer) with T4 polynucleotide kinase (New England Biolabs). The membrane was washed once with pre-warmed (42°C) 2xSSC, 0.5% SDS for 1 min followed by two 30 minute washes at 42°C. The membrane was exposed to a phosphor screen for one hour or overnight at room temperature and then scanned with a phosphorimager (Typhoon).
[0Θ203] Bacterial CRISPR system construction and evaluation
[00204] CRISPR locus elements, including tracrRNA, Cas9, and leader were PGR amplified from Streptococcus pyogenes SF370 genomic DNA with flanking homology arms for Gibson. Assembly. Two Bsal type IIS sites were introduced in between two direct repeats to facilitate easy insertion of spacers (Figure 9). PGR products were cloned into EcoRV-digested pACYC184 downstream of the tet promoter using Gibson Assembly Master Mix (NEB). Other endogenous CRISPR system elements were omitted, with the exception of the last 50bp of Csn2. Oligos (Integrated DNA Technology) encoding spacers with complimentary overhangs were cloned into the i&al-digested vector pDCOOO (NEB) and then ligated with T7 ligase (Enzymatics) to generate pCRISPR plasmids. Challenge pfasmids containing spacers with PAM sequences (also referred to herein as "CRISPR motif sequences") were created by ligating hybridized oligos carrying compatible overhangs (Integrated DNA Technology) into BanMl- digested pUC19. Cloning for all constructs was performed in E. coli strai JM109 f'Zymo Research).
[00205] pCRJSPR-carrying cells were made competent using the Z-Competent E. coli Transformation Kit and Buffer Set (Zymo Research, T3001 ) according to manufacturer's instructions. In the transformation assay, 50uL aliquots of competent cells carrying pCRISPR were thawed on ice and tra sformed with lug of spacer plasmid or pUC19 on ice for 30 minutes, followed by 45 second heat shock at 42°C and 2 minutes on ice. Subsequently, 250ul SOC (Invitrogen) was added followed by shaking incubation at 37°C for Ihr, and 100 uL of the post- SOC outgrowth was plated onto double selection plates (12.5 ug/ml chloramphenicol, 100 ug/ml ampicillin). To obtain cfu/ng of DNA, total colony numbers were multiplied by 3.
[00206] To improve expression of CRISPR components in mammalian cells, two genes from the SF370 locus 1 of Streptococcus pyogenes (S. pyogenes) were codon-optimized, Cas9 (SpCas9) and RNase III (SpRNase III). To facilitate nuclear localization, a nuclear localization signal (NLS) was included at the amino (N)- or carboxyl (C)-termini of both SpCas9 and SpRNase III (Figure 2B). To facilitate visualization of protein expression, a fluorescent protein marker was also included at the N- or C-termini of both proteins (Figure 2B). A version of SpCas9 with an NLS attached to both N- and C-termini (2xNLS-SpCas9) was also generated. Constructs containing NLS-fused SpCas9 and SpRNase III were transfected into 293FT human embryonic kidney (HEK) cells, and the relative positioning of the NLS to SpCas9 and SpRNase III was found to affect their nuclear localization efficiency. Whereas the C -terminal NLS was sufficient to target SpRNase II I to the nucleus, attachment of a single copy of these particular NLS's to either the N- or C -terminus of SpCas9 was unable to achieve adequate nuclear localization in this system. In this example, the C-terminal. NLS was that of nucleoplasmin (KRPAAT KAGQAKKKK), and the C-terminal NLS was that of the SV40 large T-antigen (P KKRKV). Of the versions of SpCas9 tested, only 2xNLS-SpCas9 exhibited nuclear localization (Figure 2B).
[002071 The tracrRNA from the CRISPR locus of S. pyogenes SF370 has two transcriptional start sites, giving rise to two transcripts of 89~nucleotid.es (nt) and 171nt that are subsequently processed into identical 75nt mature tracrR As. The shorter 89nt tracrRNA was selected for expression in mammalian cells (expressio constructs illustrated in Figure 7 A, with functionality as determined by results of the Surveyor assay shown in Figure 7B). Transcription start, sites are marked as +1, and transcription terminator and the sequence probed by northern blot are also indicated. Expression of processed tracrRNA was also confirmed by Northern blot. Figure 7C shows results of a Northern blot analysis of total RNA extracted from 293FT cells transfected with U6 expression constructs carrying long or short tracrRNA, as well as SpCas9 and DR- EMX1(1)-DR. Left and right panels are from 293FT cells transfected without or with SpRNase III, respectively. U6 indicate loading control blotted with a probe targeting human U6 snRNA. Transfection of the short tracrRNA expression construct led to abundant levels of the processed form of tracrRNA (~75bp). Very low amounts of long tracrRNA are detected on the Northern blot.
[00208] To promote precise transcriptional initiation, the RNA polymerase Ill-based U6 promoter was selected to drive the expression of tracrRNA (Figure 2C). Similarly, a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "tracr-mate sequences"; Figure 2C). The initial spacer was designed to target a 33-base-pair (bp) target site (30-bp proto spacer plus a 3 -bp CRISPR motif (PAM) sequence satisfying the NGG recognition motif of Cas9) in the human EMXl locus (Figure 2C), a key gene in the development of the cerebral cortex.
[00209] To test whether heterologous expression of the CRISPR system (SpCas9, SpRNase III, tracrRNA, and pre-crRNA) in mammalian cells can achieve targeted cleavage of mammalian chromosomes, HEK 293FT cells were transfected with combinations of CRISPR components. Since DSBs in mammalian nuclei are partially repaired by the non-homologous end joining (NHEJ) pathway, which leads to the formation of indels, the Surveyor assay was used to detect potential cleavage activity at the target. EMXl locus (Figure 8) (see e.g. Guschin et al., 2010, Methods Moi Biol 649: 2.47). Co -transfection of ail four CRISPR components was able to induce up to 5.0% cleavage in the protospacer (see Figure 2D). Co-transfection of all CRJSPR components minus SpRNase I I I also induced up to 4.7% indel in the protospacer, suggesting that there may he endogenous mammalian RNases that are capable of assisting with crRNA maturation, suc as for example the related Dicer and Drosha enzymes. Removing any of the remaining three components abolished the genome cleavage activity of the CRISPR system (Figure 2D). Sanger sequencing of amplicons containing the target locus verified the cleavage activity: in 43 sequenced clones, 5 mutated alleles (1 1 .6%) were found. Similar experiments using a variety of guide sequences produced indel percentages as high as 29% (see Figures 4-7, 12, and 13). These results define a three-component system for efficient CRISP R-mediaied genome modification in mammalian cells. To optimize the cleavage efficiency, Applicants also tested whether different isoforms of tracrRNA affected the cleavage efficiency and found that, in this example system, only the short (89-bp) transcript form was able to mediate cleavage of the human EMX1 genomic locus (Figure 7B).
[002 J O] Figure 14 provides an additional Northern blot analysis of crRNA processing in mammalian ceils. Figure 14A illustrates a schematic showing the expression vector for a single spacer flanked by two direct repeats (DR-EMXl(i)-DR). The 30bp spacer targeting the human EMX1 locus protospacer 1 (see Figure 6) and the direct repeat sequences are shown in the sequence beneath Figure 14 A. The line indicates the region whose reverse-complement sequence was used to generate Northern blot probes for EMX1(1) crRNA detection. Figure 14B shows a Northern blot analysis of total RNA extracted from 293 FT cells transtected with U6 expression constructs carrying DR-EMX 1(1 )-DR. Left and right panels are from 293 FT cells transtected without or with SpRNase III respectively. DR-EMX1 (1 )-DR was processed into mature crRNAs only in the presence of SpCas9 and short tracrRNA and was not dependent on the presence of SpRNase III. The mature crRNA detected from traiisfected 293FT total RNA is ~33bp and is shorter than the 39-42bp mature crRNA from S, pyogenes. These results demonstrate that a CRISPR system can be transplanted into eukaryotic cells and reprogrammed to facilitate cleavage of endogenous mammalian target polynucleotides.
[00211] Figure 2 illustrates the bacterial CRISPR system described in this example. Figure 2 A illustrates a schematic showing the CRISPR locus 1 from Streptococcus pyogenes SF370 and a proposed mechanism of CRISPR -mediated DNA cleavage by this system. Mature crRNA processed from the direct repeat-spacer array directs Cas9 to genomic targets consisting of complimentary protospacers and a protospacer-adjacent motif (PAM). Upon target-spacer base pairing, Cas9 mediates a double-strand break in the target DNA. Figure 2B illustrates engineering of S. pyogenes Cas9 (SpCas9) and RNase III (SpRNase III) with nuclear localization signals (NLSs) to enable import into the mammalian nucleus. Figure 2C illustrates mammalian expression of SpCas9 and SpRNase 111 driven by the constitutive EFla promoter and tracrRNA and pre-crRNA array (DR-Spacer-DR) driven by the RNA Pol3 promoter U6 to promote precise transcription initiation and termination. A protospacer from the human EMXl locus with a satisfactory PAM sequence is used as the spacer in the pre-crRNA array. Figure 2D illustrates surveyor nuclease assay for SpCas9-mediated minor insertions and deletions. SpCas9 was expressed with and without SpRNase III, tracrRNA, and a pre-crRNA array carrying the EMX1- target spacer. Figure 2E illustrates a schematic representation of base pairing between target locus and EMXl -targeting crRNA, as well as an example chromatogram showing a micro deletion adjacent to the SpCas9 cleavage site. Figure 2F illustrates mutated alleles identified from sequencing analysis of 43 clonal amplicons showing a "variety of micro insertions and deletions. Dashes indicate deleted bases, and non-aligned or mismatched bases indicate insertions or mutations. Scale bar ::: lOjim.
0Θ212] To further simplify the three-component system, a chimeric crRNA-tracrRNA hybrid desig was adapted, where a mature crRNA (comprising a guide sequence) is fused to a partial tracrRNA via a stem-loop to mimic the natural crRNA:tracrRNA duplex (Figure 3A). To increase co-delivery efficiency, a bicistronic expression vector was created to drive co- expression of a chimeric RNA and SpCas9 in transfected ceils (Figures 3 A and 8). In parallel, the bicistronic vectors were used to express a pre-crRNA (DR-guide sequence-DR) with SpCas9, to induce processing into crRNA with a separately expressed tracrRNA (compare Figure 13B top and bottom). Figure 9 provides schematic illustrations of bicistronic expression vectors for pre- crRNA array (Figure 9 A) or chimeric crRNA (represented by the short line downstream of the guide sequence insertion site and upstream of the EF l a promoter in Figure 9B) with hSpCas9, showing locatio of various elements and the point of guide sequence insertion. The expanded sequence around the location of the guide sequence insertion site in Figure 9B also shows a partial DR sequence (GTTTAGAGCTA) and a partial tracrRNA sequence (TAGCAAGTTAAAATAAGGCTAGTCCGTTTTT). Guide sequences can be inserted between Bbsl sites using annealed oligonucleotides. Sequence design for the oligonucleotides are shown below the schematic illustrations in Figure 9, with appropriate ligation adapters indicated. WPRE represents the Woodchuck hepatitis virus post-transcription al regulatory element. The efficiency of chimeric RNA-mediated cleavage was tested by targeting the same EMXl locus described above. Using both Surveyor assay and Sanger sequencing of amplicons, Applicants confirmed that the chimeric RNA design facilitates cleavage of human EMXl locus with approximately a 4.7% modification rate (Figure 4).
[00213] Genera!izability of C ISPR -mediated cleavage in eukaryotic ceils was tested by targeting additional genomic loci in both human and mouse ceils by designing chimeric RNA targeting multiple sites in the human EMXl and PVALB, as well as the .mouse Th loci. Figure 15 illustrates the selection of some additional targeted protospacers in human PVALB (Figure 15 A) and mouse Th (Figure 15B) loci. Schematics of the gene loci and the location of three protospacers within the last exon of each are provided. The underlined sequences include 30bp of protospacer sequence and 3bp at the 3' end corresponding to the PAM sequences. Protospacers on the sense and anti-sense strands are indicated above and below the DNA sequences, respectively. A modification rate of 6.3% and 0.75% was achieved for the human P VALB and mouse Th loci respectively, demonstrating the broad applicabi lity of the CRISPR system in modifying different loci across multiple organisms (Figures 3B and 6). While cleavage was only detected with one out of three spacers for each locus using the chimeric constructs, all target sequences were cleaved with efficiency of indel production reaching 27%> when using the co-expressed pre-crRNA arrangement (Figure 6).
[00214] Figure 13 provides a further illustration that SpCas9 can be reprogrammed to target multiple genomic loci in mammalian cells. Figure 13A provides a schematic of the human EMXl Socus showing the location of five protospacers, indicated by the underlined sequences. Figure 13B provides a schematic of the pre-crRNA/trcrRNA complex showing hybridization between the direct repeat region of the pre-crRNA and tracrRNA (top), and a schematic of a chimeric RNA design comprising a 20bp guide sequence, and tracr mate and tracr sequences consisting of partial direct repeat and tracrRNA sequences hybridized in a hairpin structure (bottom). Results of a Surveyor assay comparing the efficacy of Cas9-mediated cleavage at five protospacers in the human EMXl locus is illustrated in Figure 13C. Each protospacer is targeted using either processed pre-crR A/tracrRNA complex (crRNA) or chimeric RNA (chiRNA). [00215] Since the secondary stmcture of RNA can be crucial for intermolecuiar interactions, a structure prediction algorithm based on minimum free energy and Boltzmann-weighted structure ensemble was used to compare the putative secondary structure of all guide sequences used in our genome targeting experiment (Figure 3B) (see e.g. Gruber et al, 2008, Nucleic Acids Research, 36: W70). Analysis revealed that in most cases, the effective guide sequences in the chimeric crRNA context were substantially free of secondary structure motifs, whereas the ineffective guide sequences were more likely to form internal secondary structures that could prevent base pairing with the target protospacer DNA. It is thus possible that variability in the spacer secondary structure might impact the efficiency of CRISPR-mediated interference when using a chimeric crRNA.
[00216] Figure 3 illustrates example expression vectors. Figure 3 A provides a schematic of a bi-cistronic vector for driving the expression of a synthetic crRNA-tracrRNA chimera (chimeric RNA) as well as SpCas9. The chimeric guide RNA contains a 20-bp guide sequence corresponding to the protospacer in the genomic target site. Figure 3B provides a schematic showing guide sequences targeting the human EMXI, PVALB, and mouse Th loci, as well as their predicted secondary structures. The modification efficiency at each target site is indicated below the RNA secondary structure drawing (EMXI, n = 216 amplicon sequencing reads; PVALB, n 224 reads; Th, n— 265 reads). The folding algorithm produced an output with each base colored according to its probability of assuming the predicted secondary structure, as indicated by a rainbow scale that is reproduced in Figure 3B in gray scale. Further vector designs for SpCas9 are shown in Figure 44, which illustrates single expression vectors incorporating a U6 promoter linked to an insertion site for a guide oligo, and a Cbh promoter linked to SpCas9 coding sequence. The vector shown in Figure 44b includes a tracrRNA coding sequence linked to an HI promoter.
[00217] To test whether spacers containing secondary structures are able to function in prokaryotic cells where CRISPRs naturally operate, transformation interference of protospacer- bearing plasmids were tested in an E, coli strain heterologously expressing the S. pyogenes SF370 CR1SPR locus 1 (Figure 10). The CRiSPR locus was cloned into a low-copy E. coli expression vector and the crRNA array was replaced with a single spacer flanked by a pair of DRs (pCRlSPR). E. coli strains harboring different pCRlSPR plasmids were transformed with challenge plasmids containing the corresponding protospacer and PAM sequences (Figure IOC). In the bacterial assay, all spacers facilitated efficient CRISPR interference (Figure 4C). These results suggest that there may be additional factors affecting the efficiency of CRISPR activity in mammalian cells.
[00218] To investigate the specificity of CRISPR-mediated cleavage, the effect of single- nucleotide mutations in the guide sequence on protospacer cleavage in the mammalian genome was a alyzed using a series of EMXl -targeting chimeric crRNAs with single point mutations (Figure 4A). Figure 4B illustrates results of a Surveyor nuclease assay comparing the cleavage efficiency of Cas9 when paired with different mutant chimeric RNAs, Single-base mismatch up to 12-bp 5' of the PAM substantially abrogated genomic cleavage by SpCas9, whereas spacers with mutations at farther upstream positions retained activity against the original protospacer target (Figure 4B). In addition to the PAM, SpCas9 has single-base specificity within the last 12-bp of the spacer. Furthermore, CRISPR is able to mediate genomic cleavage as efficiently as a pair of TALE nucleases (TALEN) targeting the same EMXl protospacer. Figure 4C provides a schematic showing the design of TALENs targeting EMXL and Figure 4D shows a Surveyor gel comparing the efficiency of TALEN and Cas9 (n=3).
[00219] Having established a set of components for achieving CRISPR-mediated gene editing in mammalian cells through the error-prone N EJ mechanism, the ability of CRISPR to stimulate homologous recombination (HR), a high fidelity gene repair pathway for making precise edits in the genome, was tested. The wild type SpCas9 is able to mediate site-specific DSBs, which can be repaired through both NHEJ and HR. In addition, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of SpCas9 was engineered to convert the nuclease into a nickase (SpCas9n; illustrated in Figure 5 A) (see e.g. Sapranauskas et al, 2011, Nucleic Acids Research, 39: 9275; Gasiunas et al, 2012, Proc. Natl. Acad. Sci. USA, 109:E2579), such that nicked genomic DNA undergoes the high-fidelity homo logy-directed repair (HDR). Surveyor assay confirmed that SpCas9n does not generate indels at the EMXl protospacer target. As illustrated in Figure 5B, co-expression of EMXl -targeting chimeric crRNA with SpCas9 produced indels in the target site, whereas co-expression with SpCas9n did not (n=3). Moreover, sequencing of 327 amplicons did not detect any indels induced by SpCas9n. The same locus was selected to test CRISPR-mediated HR by co-transfecting HE 293FT cells with the chimeric RNA targeting EMXl, hSpCas9 or hSpCas9n, as well as a HR template to introduce a pair of restriction sites (Hindlll and NheT) near the protospacer. Figure 5C provides a schematic illustration of the HR strategy, with relative locations of recombination points and primer annealing sequences (arrows). SpCas9 and SpCas9n indeed catalyzed integration of the HR template into the EMXl locus. PCR amplification of the target region followed by restriction digest with HwdlH revealed cleavage products corresponding to expected fragment sizes (arrows in restriction fragment length polymorphism gel analysis shown in Figure 5D). with SpCas9 and SpCas9n mediating similar levels of HR efficiencies. Applicants further verified HR using Sanger sequencing of genomic amplicons (Figure 5E). These results demonstrate the utility of CRISPR for facilitating targeted gene insertion in the mammalian genome. Given the 14-bp (12-bp from the spacer and 2 -bp from the PA ) target specificity of the wild type SpCas9, the availability of a nickase can significantly reduce the likelihood of off- target modifications, since single strand breaks are not substrates for the error-prone NHEJ pathway.
[00220] Expression constructs mimicking the natural architecture of CRISPR loci with arrayed spacers (Figure 2A) were constructed to test the possibility of multiplexed sequence targeting. Using a single CRISPR array encoding a pair of EMXl- and J¾Z2?-targeting spacers, efficient cleavage at both loci was detected (Figure 4F, showing both a schematic design, of the crRNA array and a Surveyor blot showing efficient mediation of cleavage). Targeted deletion of larger genomic regions through concurrent DSBs using spacers against two targets within EMXl spaced by 119bp was also tested, and a 1 .6% deletion efficacy (3 out of 182 amplicons; Figure 4G) was detected. This demonstrates that the CRISPR system can mediate multiplexed editing within a single genome.
Example 2: CRISPR system modifications and alternatives
[00221] The ability to use RNA to program sequence-specific DNA cleavage defines a new class of genome engineering tools for a variety of research and industrial applications. Several aspects of the CRISPR system can be further improved to increase the efficiency and versatility
•J _|_ of CRISPR. targeting. Optimal Cas9 activity may depend on the availability of free Mg" at levels higher than that present in the mammalian nucleus (see e.g. Jinek et al, 2012, Science, 337:816), and the preference for an NGG motif immediately downstream of the protospacer restricts the ability to target on average every 12-bp in the human genome (Figure 1 1 , evaluating both plus and minus strands of human chromosomal sequences). Some of these constraints can be overcome by exploring the diversity of CRISPR loci across the microbial metagenome (see e.g. Makarova et al, 2011, Nat Rev Microbiol, 9:467). Other CRISPR loci may be transplanted into the mammalian cellular milieu by a process similar to that described in Example 1. For example, Figure 12 illustrates adaptation of the Type II CRISPR system from CRISPR 1 of Streptococcus thennophilus LMD-9 for heterologous expression in mammalian cells to achieve CRISPR-mediated genome editing. Figure 12A provides a Schematic il lustration of CRISPR 1 from S. thennophilus LMD-9. Figure 12B illustrates the design of an expression system for the S. thermophilus CRISPR system. Human eodon-optimized hSiCas is expressed using a constitutive EFla promoter. Mature versions of tracrRNA and crRNA are expressed using the U6 promoter to promote precise transcription initiation. Sequences from the mature crRNA and tracrRNA are illustrated. A single base indicated by the lower case "a" in the crRNA sequence is used to remove the polyU sequence, which serves as a RNA polIII transcriptional terminator. Figure 12C provides a schematic showing guide sequences targeting the human EMX1 locus as well as their predicted secondary structures. The modification efficiency at each target site is indicated below the RNA secondary structures. The algorithm generating the structures colors each base according to its probability of assuming the predicted secondary structure, which is indicated by a rainbow scale reproduced in Figure 12C in gray scale. Figure 12D shows the results of hStCas9-mediated cleavage in the target locus using the Surveyor assay. RNA guide spacers 1 and 2 induced 14% and 6.4%, respectively. Statistical analysis of cleavage activity across biological replica at these two protospacer sites is also provided in Figure 6. Figure 16 provides a schematic of additional protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR system in the human EMX! locus. Two protospacer sequences are highlighted and their corresponding PAM sequences satisfying NNAGAAW motif are indicated by underlining 3' with respect to the corresponding highlighted sequence. Both protospacers target the anti-sense strand.
Example 3: Sample target sequence selection algorithm.
[00222] A software program is designed to identify candidate CRISPR target sequences on both strands of an input DNA sequence based on desired guide sequence length and a CRISPR motif sequence (PAM) for a specified CRISPR enzyme. For example, target sites for Cas9 from S. pyogenes, with PAM sequences NGG, may be identified by searching for 5'-Nx-NGG-3' both on the input sequence and on the reverse-complement of the input. Likewise, target sites for Cas9 of S. thermophilus CRISPR 1, with PAM sequence NNAGAAW, may be identified by searching for 5 '-Nx-N AGAAW-3 ' both on the input sequence and on the reverse-complement of the input. Likewise, target sites for Cas9 of S. thermophihis CRISPR3, with PAM sequence NGGNG, may be identified by searching for 5'-Nx- GGNG-3' both on the input sequence and on the reverse-complement of the input. The value "x" in Nx .may be fixed by the program or specified by the user, such as 20.
[00223] Since multiple occurrences in the genome of the DNA target site may lead to nonspecific genome editing, after identifying all potential sites, the program filters out sequences based on the number of times they appear in the relevant reference genome. For those CRISPR enzymes for which sequence specificity is determined by a 'seed' sequence, such as the l i~12bp 5 ' from the PAM sequence, including the PAM sequence itself, the filtering step may be based on the seed sequence. Thus, to avoid editing at additional genomic loci, results are filtered based on the number of occurrences of the seed:PA sequence in the relevant genome. The user may be allowed to choose the length of the seed sequence. The user may also be allowed to specify the number of occurrences of the seed:PAM sequence in a genome for purposes of passing the filter. The default is to screen for unique sequences. Filtration level is altered by changing both the length of the seed sequence and the number of occurrences of the sequence in the genome. The program may in addition or alternatively provide the sequence of a guide sequence complementary to the reported target sequence(s) by providing the reverse complement of the identified target sequence(s).
[00224] Further details of methods and algorithms to optimize sequence selection can be found in U.S. application Serial No. 61/836,080 (attorney docket 44790.1 1.2022); incorporated herein by reference.
Example 4: Evaluation of multiple chimeric crRNA-tracrRNA hybrids
[00225] This example describes results obtained for chimeric RNAs (chiRNAs; comprising a guide sequence, a tracr mate sequence, and a tracr sequence in a single transcript) having tracr sequences that incorporate different lengths of wild-type tracrRNA. sequence. Figure 18a illustrates a schematic of a bicistronic expression vector for chimeric RNA. and Cas9. Cas9 is driven by the CBh promoter and the chimeric RNA is driven by a U6 promoter. The chimeric guide RNA consists of a 20bp guide sequence (Ns) joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript), which is truncated at various positions as indicated. The guide and tracr sequences are separated by the tracr-mate sequence GUUUUAGAGCUA followed by the loop sequence GAAA. Results of SU RVEYOR assays for Cas9-mediated indels at the human EMX1 and PVALB loci are illustrated in Figure 1 8b and 1 8c, respectively. Arrows indicate the expected SURVEYOR fragments. ChiRNAs are indicated by their "+n" designation, and crRNA refers to a hybrid NA where guide and tracr sequences are expressed as separate transcripts. Quantification of these results, performed in triplicate, are illustrated by histogram in Figures 19a and 19b, corresponding to Figures 18b and 18c, respectively ("N.D." indicates no indels detected). Protospacer IDs and their corresponding genomic target, protospacer sequence, PAM sequence, and strand location are provided in Table D. Guide sequences were designed to be com lementary to the entire protospacer sequence in the case of separate transcripts in the hybrid system, or only to the underlined portion in the case of chimeric RNAs.
Figure imgf000087_0001
[00226] Cell culture and transfection
[00227] Human embryonic kidney (HEK) cell line 293FT (Life Technologies) was maintained in Dulbecco's modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (HyClone), 2mM GlutaMAX (Life Technologies), lQQU/mL penicillin, and IQQjig/mL streptomycin at 37°C with 5% C02 incubation. 293FT cells were seeded onto 24-well plates (Coming) 24 hours prior to transfection at a density of 150,000 ceils per well. Cells were transfected using Lipofectamine 2000 (Life Technologies) following the manufacturer's recommended protocol. For each well of a 24- well plate, a total of 500ng plasmid was used. 100228] SURV EY OR assay for genome modification [00229] 293 FT cells were transfected with plasmid DNA as described above. Cells were incubated at 37°C for 72 hours post-transfection prior to genomic DNA extraction. Genomic DNA was extracted using the QuickExtract DNA Extraction Solution (Epicentre) following the manufacturer's protocol. Briefly, pelleted cells were resuspended in QuickExtract solution and incubated at 65°C for 15 minutes and 98°C for 10 minutes. The genomic region flanking the CRISPR target site for each gene was PGR amplified (primers listed in Table E), and products were purified using QiaQuick Spin Column (Qiagen) following the manufacturer's protocol. 400ng total of the purified PCR products were mixed with 2μ1 10X Taq DNA Polymerase PGR buffer (Enzymatics) and ultrapure water to a final volume of 20μ1, and subjected to a re- annealing process to enable heteroduplex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute. After re-annealing, products were treated with SURVEYOR nuclease and SURVEYOR enhancer S (Transgcnomies) following the manufacturer's recommended protocol, and analyzed on 4-20% Novex TBE poly-acrylamide gels (Life Technologies). Gels were stained with SYBR Gold DNA stain (Life Technologies) for 30 minutes and imaged with a Gel Doc gel imaging system (Bio-rad). Quantification was based on relative band intensities.
Table E:
Figure imgf000088_0001
[00230] Com utational identification of unique CRISPR target sites
[00231] To identify unique target sites for the S. pyogenes SF370 Cas9 (SpCas9) enzyme in the human, mouse, rat, zebrafish, fruit fly, and C. elegans genome, we developed a software package to scan both strands of a DNA sequence and identify all possible SpCas9 target sites. For this example, each SpCas9 target site was operationally defined as a 20bp sequence followed by an NGG protospacer adjacent motif (PAM) sequence, and we identified all sequences satisfying this 5'-N2o-NGG-3' definition on all chromosomes. To prevent non-specific genome editing, after identifying all potential sites, all target sites were filtered based on the number of times they appear in the relevant reference genome. To take advantage of sequence specificity of Cas9 activity conferred by a 'seed' sequence, which can be, for example, approximately 1 1 -12bp sequence 5' from the PAM sequence, 5 '-NNNNNNN N -NGG-3 ' sequences were selected to be unique in the relevant genome. All genomic sequences were downloaded from the UCSC Genome Browser (Human genome hgl9, Mouse genome mm9, Rat genome rn5, Zebrafish genome danRer?, D. melanogaster genome dm4 and C. elegans genome cel O). The full search results are available to browse using UCSC Genome Browser information. An example vi sualization of some target si tes in the human genome is provided in Figure 21.
[00232] Initially, three sites within the EMX1 locus in human HEK 293FT cells were targeted. Genome modification efficiency of each cm'RNA was assessed using the SURVEYOR nuclease assay, which detects mutations resulting from DNA double-strand breaks (DSBs) and their subsequent repair by the non-homologous end joining (NHEJ) DNA damage repair pathway. Constructs designated chiRNA(+n) indicate that up to the +n nucleotide of wild-type tracrRNA is included in the chimeric RNA construct, with values of 48, 54, 67, and 85 used for n. Chimeric RNAs containing longer fragments of wild-type tracrRN A (chiRNA(+67) and chiRNA(+85)) mediated DNA cleavage at all three EMX1 target sites, with chiRNA(+85) in particular demonstrating significantly higher levels of DNA cleavage than the corresponding crRNA/tracrRNA hybrids that expressed guide and tracr sequences in separate transcripts (Figures 18b and 19a). Two sites in the PVALB locus that yielded no detectable cleavage using the hybrid system (guide sequence and tracr sequence expressed as separate transcripts) were also targeted using chiRNAs. chiRNA(+67) and chiRNA(+85) were able to mediate significant cleavage at the two PVALB protospacers (Figures 1 8c and 19b).
[00233] For all five targets in the EMX1 and PVALB loci, a consistent increase in genome modification efficiency with increasing tracr sequence length was observed. Without wishing to be bound by any theory, the secondary structure formed by the 3' end of the tracrRNA may play a role in enhancing the rate of CR1SPR complex formation. An illustration of predicted secondary structures for each of the chimeric RNAs used in this example is provided in Figure 21. The secondary structure was predicted using RNAfold (http://ma.tbi.univie.ac.at/cgi- bin/RNAfold.cgi) using minimum free energy and partition function algorithm. Pseudocolor for each based (reproduced in grayscale) indicates the probability of pairing. Because chiRNAs with longer tracr sequences were able to cleave targets that were not cleaved by native CRISPR crRNA''tracrRNA hybrids, it is possible that chimeric RNA may be loaded onto Cas9 more efficiently than its native hybrid counterpart. To facilitate the application of Cas9 for site- specific genome editing in eukaryotic cells and organisms, all predicted unique target sites for the S. pyogenes Cas9 were computationally identified in the human, mouse, rat, zebra fish, C. elegans, and D. melanogaster genomes. Chimeric RNAs can be designed for Cas9 enzymes from other microbes to expand the target space of CR ISPR RNA -programmable nucleases.
[00234] Figure 22 illustrates an exemplary bicistro ic expression vector for expression of chimeric RNA including up to the +85 nucleotide of wild-type tracr RNA sequence, and SpCas9 with nuclear localization sequences. SpCas9 is expressed from a CBh promoter and terminated with the bGH po yA signal (bGH pA). The expanded sequence illustrated immediately below the schematic corresponds to the region surrounding the guide sequence insertion site, and includes, from 5' to 3', 3 '-portion of the U6 promoter (first shaded region), Bbsl cleavage sites (arrows), partial direct repeat (tracr mate sequence GTTTTAGAGCTA, underlined), loop sequence GAAA, and +85 tracr sequence (underlined sequence following loop sequence). An exemplary guide sequence insert is illustrated below the guide sequence insertion site, with nucleotides of the guide sequence for a selected target represented by an "N".
|00235| Sequences described in the above examples are as follows (polynucleotide sequences are 5' to 3'):
[00236] U6~short tracrRNA (Streptococcus pyogenes SF370):
[00237] GAGGGCCTATTTCCCATGATTCCTTCATATTTGCATATACGATACAAGGCT
GTTAGAGAGATAATTGGAATTAATTTGACTGTAAACACAAAGATATTAGTACAAAA
TACX iXjACXTI GAAAGTAATAATTTCn'TGGGTAGTTTGC^AGTTTTAAAATTATGTTTT
AAAATGGACTATCATATGCTTACCGTAACTTGAAAGTATTTCGATTTCTTGGCTTTAT
ATATCTTGTGGAAAGGACGAAACACCGGAACCATTCAAAACAGCATAGCAAGTTA
AAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTT
TTT (bold = tracrRNA sequence; underline = terminator sequence)
[0Θ238] U6-long tracrRNA (Streptococcus pyogenes SF370):
[00239] GAGGGCCTATTTCCCATGATTCCTTCATATTTGCATATACGATACAAGGCT GTTAGAGAGATAATTGGAATTAATTTGACTGTAAACACAAAGATATTAGTACAAAA TACGTGACGTAGAAAGTAATAATTTCTTGGGTAGTTTGCAGTTTTAAAATTATGTTTT
Figure imgf000090_0001
ATATCTTGTGGAAAGGACGAAACACCGGTAGTATTAAGTATTGTTTTATGGCTGATA AATTTCTTTGAATTTCTCCTTGATTATTTGTTATAAAAGTTATAAAATAATCTTGTTG
GAACCATTCAAAACAGCATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA
ΛΛΛΛ(;Ί'( ί('Λί 'ί ()Λ(Π CGG'i Gi ΊΎ I 1 'ΙΊ'Ί'
[00240] U6~DR-Bbs! backbone-DR {Streptococcus pyogenes SF370):
[00241] ΟΑΟί: ϊ(: Ί Ί 1 : ; :ΑΊ :ίΑΤΊ ΤΊΧΑΊ Ί Ί :κΑΊ Ί,Α(θΑΊ εΑΑΟΟ€Ί^
GTTAGAGAGATAATTGGAATTAATTTGACTGTAAACACAAAGATATTAGTACAAAA
TACGTGACXri GAAAGTAATAATTTCTTGGGTAGTTTGCAGTTTTAAAATTATGTTTT
AAAATGGACTATCATATGCTTACCGTAACTTGAAAGTATTTCGATTTCTTGGCTTTAT
ATATCTTGTGGAAAGGACGAAACACCGGGTTTTAGAGCTATGCTGTTTTGAATGGTC
CCAAAACGGGTCTTCGAGAAGACGTTTTAGAGCTATGCTGTTTTGAATGGTCCCAAA
AC
[0Θ242] U6-cliimeric RNA-BbsI backbone (Streptococcus pyogenes SF370)
[00243] GAGGGCCTATTTCCCATGATTCCTTCATATTTGCATATACGATACAAGGCT
GTTAGAGAGATAATTGGAATTAATTTGACTGTAAACACAAAGATATTAGTACAAAA.
TACGTGACGTAGAAAGTAATAATTTCTTGGGTAGTTTGCAGTTTTAAAATTATGTTTT
ΑΛΑΛΊ GGACX7Yr<VVrA/rG( T
ATATCTTGTGGAAAGGACGAAACACCGGGTCTTCGAGAAGACCTGTTTTAGAGCTA
GAAATAGCAAGTTAAAATAAGGCTAGTCCG
[00244] NLS-SpCas9-EGFP:
[00245] MD Y DHDGD YKDH DID YK.DD DD KM AP K KRKVGIHG VP A ADKK.YS iGLDI
GTNSVGWAVITDEYKVPSKKFKVLGNTDR SIK NLIGALLFDSGETAEATRL RTARR
RYTRR RICYLQEIFSNEMAKVDDSFFHRLEESFLVTEDKKHERHPIFGNIVDEVAYHE
KYPTIYHLR LVDSTDKADLRLIYLALAHMIKFRGHFUEGDLNPD'NSDVDKLFIQLVQ
TYNQLFEENPLNASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFG LIALSLGLTPN
F SNFDLAEDA LQLSKDTYDDDLDNLLAQ1GDQYADLFLAA. NLSDAILLSDILR.VNT
ElTKAPLSASMIi RYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKj GYAGYIDGGASQ
EEFY FI PILEKMDGTEELLVKL REDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFY
PFLKDNREKIEOLTFRiPYYVGPLARGNSRFAWMTiKSEETITPWNFEEVVD GASAQS
FIERMTNFDKNLPNE VLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKLAIV
DLLFKTNRKVTV QL EDYFKKJECFDSVEISGVEDRFNASLGTYHDLL IIKDKDFLDN
EENEDILEDR'XTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLIN GIRD QSG: ILDFL SDGFANRNFMQLJHDDSL FKEDIQKAQ\^SGQGDSLHEH:IANLA
GSPAIKKGILQTVKA7VDELVKYMGRH PENIVIEMARENQTTQ GQKNSRERM RIEEG
I ELGSQIL E PVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVD IVPQSF
LKDDSIDNKYL RSDK RGKSDNVPSEEVV M NYWRQLLNAKIJTQRK.FDNLTKAE
RGGLSELD AGFI RQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVS
DFRKDFQFYKVREINNYHHAHDAYLNA A7GTALJKXYPKLESEFVYGDY VYDVRKLVLI
AKSEQEIGKJ^TAKYFFYSNIMNFFKTEITI^NGEIRKRPLIETNGETGEIVWDKGRDFATV
RKAXSMPQ IV XTEVQTGGFSKE.SILPKRNSDKLIARKXDWDPK YGGFDSPTVAYS
VLVVAKYEKGKSKKL SVKELLGiTiMERSSFE NPIDFLEAKGYKEV KDLlIKLP YS
LFELENGRKRMLASAGELQKGNELALPS YVNFLYLASHYEKL GSPEDNEQ QLFVE
QFiKFr^LDElIEQISEFS RVlLADANLDKVLSAYNKHRD PiREQAENiifiLFTLTNLGAP
AAF YFDTTIDR RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDAAAVSKGEELFTG
VVPILVELDGD GHKFSVSGEGEGDATYGKLTLKFICTTGKLP\7PWPTL\7TTLTYGVQ
CFSRYPDHMKQHDFF SAMPEGYVQERTIFFKDDGNYKTRAEV FEGDTLVNRIEL GI
DFKSDGNILGHKXEYNYNSHNVYIMADKQKNGIKA'NFKIRFiNIEDGSVQLADHYQQNT
PIGDGPVLLPDNHYLSTQSALS DPNE RDHMVLLEFVTAAGITLGMDELY
i 002461 SpCas9-EGFP-NLS :
[00247] MDKKYS1GLDIGTNSVGWAVITDEYKWSKKFKVLGNTDRHSIKK LIGALLF DSGETAEATRLKRTARRRYTRRK RICYLQElFSNEMAKVDDSFFHRLEESFLVEEDiCK HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEG DLNPDNSDVD LFIQLVQTYNQLFEENPnSfASGVDAKAILSARLS SRRLENLIAQLPGE
KKNGLFGNLIALSLGLTP FKS FDLAEDAKLQLSKDTYDDDLD LLAQIGDQYADLFL
AA NLSDAlI.LSDlLRV TEITKAPLSASMl RYDEHHQDi rLLKALVRQQLPEKYKEIFF
DQSKNGYAGYIDGGASQEEFYKFIKPILEK¾'1DGTEELLVKLNREDLLRKQRTFDNGSIPH
QIHLGELEiAILRRQEDFYPFLIO^NREKJEKILTFRIPYYVGPLARGNSRFAWMTRKSEETI
TPWNFEEVVD GASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVY ELT V YVTE
GMRKPAFLSGEQKKATvT)LLFKTTSIRKV KQLKEDYFKK]ECFDSVEISGVEDRFNASL
GTYHDLLKIJKDKDFLD EENEDILEDIYLTLTLFEDREIVIIEERL TYABLFDDKVM QL
KRRRYTGWGRLSRK1..INGIRD QSG TILDFL SDGFANRNFMQLIHDDSLTFKEDIQKA
QVSGQGDSiJrlEHJANLAGSPAiKKGJLQTV YVDELV VMGRBKPE iVIE ARE QTT
Q GQK SRERMKRIEEGIKELGSQILKEHPVENTQLQ EKLYLYYLQNGRDMYVDQEL DIN LSDYDVDHIVPQSFL DDS1DNKVLTRSD RG SDNVPSEEVVKKMKNYWRQL I XA lj1'OHKF[) i;! AFRi!G[Af:[J) AG!:! RQF VF ! ROrr )[VAQ!lj)SkV!X ! KY!)|; D lIREVKVITLKSKLVSDFR DFQFYKVREINNYHFLAHDAYLNAVVGTALiKKYPKL
ESEFVYGDY VYDVRKMIAKSEQEIG ATAKYFFYSNIMNFF TEITLANGEIRKRPLIET
NGETGEIVWDKGRDFATVRKVLSMPQVNIV KTEVQTGGFSKESILPKRNSDKLIARKK
DWDPK YGGFDSPTVAYSVLVVAK G SKKL S\7KELLGITIMERSSFEKNPIDFLE
AKGYKEVK DLII LP YS LFELENGRKRM LAS AGELQKGNEL ALPS Y VNF LYLAS Y
EKL GSPEDNEQKQLFVEQBKBYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPI
REQAENIiBLFTLTNLGAPAAF YFDTTIDRKRYTSTKEVLDATLIFiQSrTGLYETRJDLSQ
LGGDAAAVSKGEELFTGWPILVELDGDVNGH FSVSGEGEGDATYGKLTLKFICTTG
LPVPWPTLVTTLTYGVQCFSRYPDBMKQBDFFKSAMPEGYVQERTIFF DDGNY TRA
EV FEGDTLVNRIELKGIDFKEDGNJLGB LEYNYNSHNVYIMADKQKNG1 V F IRH
NIEDGSVQLADHYQQNTPIGDGP 7LLPDNHYLSTQSALSKDPNEKRDHMVLLEF 7TAAG
ITLGMDELY KRPAAT AGQAK K
[00248] NLS-SpCas9-EGFP-NLS :
[002491 DY DBDGDYKDFIDIDY DDDDKMAPK KRKVGIFIGVPAADK YSIGLDI
GTNSVGWAVITDEYKVPSK F VLGNTDRBSIKKNLIGALLFDSGETAEATRLKJITARR
RYTRR NRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKBERHPIFGNIVDEVAYHE YPTFYHLRKKLVDSTD ADLRLRYLALAHMI F'RGBFLIEGDLNPD'NSDVD LFIQLVQ
TYNQLFEENPINASGVDA. AJLSARLSK.SRRLENLIAQLPGE KNGLFGNLIALSLGLTPN
FKSNFDI^EDAKLQLSKZ)TYDDDLDNLI^Q]GDQYADLFI^A NLSDAILLSD[LRVNT
EITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPE YKEIFFDQSKNGYAGYIDGGASQ
EEFYKFIKPILE MDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFY
PFLKDNREKIEKILTFRIPYY 7GPLARGNSRFAWMTR SEETITPTOFEEVVDKGASAQS
FIERMTT^FDKNLPNEKVLPKFISI YEYFTVYNEI V YVTEGMRKPAFLSGEQ ALV
DLLIT TNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDN
EENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLIN
GIRD QSG: ILDFL SDGFANRNFMQLJHDDSL FKEDIQKAQ\^SGQGDSLHEH:IANLA
GSPAIKKGILQTV V^DELV VMGRHKPE IVIEMARENQTTQ GQKNSRERMKRIEEG
I ELGSQILKEBPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDBIVPQSF
L DDSIDN VLTRSDKNRGKSDNVPSEEVVKK¾'1KNYWRQLLNA LITQRKFDNLTKAE RGGLSELD AGFIKIlQLVETRQiTKHYAQILDSRMNT YDENDKLIREVKVITL S LVS
DFR DFQFY Y^REiNNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKYYDVR MI
A SEQEJGKATA YFFYS iMNFF TEITLA GEIR RPLlETNGETGEIVWD GRDFATV
R VLSMPQVNIVKKTEVQTGGFSKESILP RNSDKLIAR K.DWDPK. YGGFDSPTV YS
VLVVAKVE GK-SKXL SVKELLGrriMERSSFEKNPIDFLEAKGY EVKKDLII LPKYS
LFELENGR R_MLASAGELQKGNELALPS YVNFLYLASHYEKL GSPEDNEQ QLFVE
QH HYLDEIIEQISEFSKRVILADANLD VLSAYN HRDKPIREQAENIIHLFTLTNLGAP
AAF YFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDAAAVS GEELFTG
VVPiLVEL GDVNGfi FSVSGEGEGDATYG LTLKFiCTTGKLPVPWPTLVTTLTYGVQ
CFSRWDHMKQHDFF SAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIEL GI
DFKEDGNlLGfi LEYNYNSFINVYIMADKQKNGl VNF IRFINIEDGSVQLADFiYQQNT
PlGDGPVLLPDNHYLSTQSALSiGDPNEiOUDHMVLLEFVTAAGITLGlsmELYiGaiPAATK
KAGQAKKKK
[00250] NLS-SpCas9-NLS :
[00251] MDYKDHDGDYKDHDroYKDDDDKMAPKKKRKVGfflGWAADKKYSIGLDI
GTNSVGWAVITDEYKVPSKKFKVLGNTDR SIK NLIGALLFDSGETAEATRL RTARR RYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDK HERHPIFGNIVDEVAYHE KYPTIYHLRKKLVDSTDKADLRLIYLAIAH^
TYNQLFEENPRNASGVDAKALLSARLSKSRRLENLIAQLPGEKKNGLFGNLL\LSLGLTPN FKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ
EITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQS NGYAGYIDGGASQ
EEFYKFIKPILEKA'IDGTEELLV LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFY
PFL DNREKIE JLTFRIPYYVGPLARGNSRFAWMTR SEETITPWNFEEVVD GASAQS
FIERMTNFDK LPNEKVLPKHSLLYEYFTV ¾TELT V YVTEGMRKPAFLSGEQKiLAlV
!)IJj;K1'NR V ^' QF ΐ )ΥΓ ΚΠ (Ί F)SVH[S( V! )R!; ASIXnY'!! lJ !!K!) !)!;F I)\
EENEDlLEDIYLTLTLFEDREMIEERL TYAHLFDD VM QLKI]ilYTGWGRLSRKLIN
GIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLA
GSPAJ KGiLQTVKVVDELVKVMGRHKPE iVIEMAJENQTTQKGQKNSRERMKRIEEG
IKELGSQILKE.HPVENTQLQNEKLYLYYLQNGRDMYVDQELDF RLSDYDVDHIVPQSF
LKDDSIDN VLTRSDKNRGKSDNVPSEEVVKKMKNYWR.QLLNA LITQRKFDNLTKAE
RGGLSELDKAGFIKRQLVETRQITKIiV'AQILDSRMNT YDENDKI-IREVKVITL SKLV'S DFRKDFQFYKVREIN TVHHAHDAYLNAVVGTALIK YPKLESEFVYGDYKVYDVRKIVII
AKSEQEIGKATA YFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATV'
RKVLSMPQWIVKKTEVQTGGFS ESILPKRNSDKLIARK DWDPK YGGFDSPTVAYS
VLVVAKYEKGKSKKL SVKELLGiTiMERSSFE NPIDFLEAKGYKEV KDLilKLP YS
LFELENGR RMLASAGELQ GNELALPSKYVNFLYLASHYE LKGSPEDNEQ .QLFVE
QHKHYLDEIIEQISEFS R\7ILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAP
AAFKYFDTTIDR RYTST EVLDATLIHQSITGLYETRIDLSQLGGD RPAAT XAGQA
KK
[00252] NLS-mCherry-SpRNase3 :
[00253] MFLFLSLTSFLSSSRTLVSKGEEDNMAHKEFMRFKVHMEGSVNGHEFEIEGE
GEGRPYEGTQTAKLKYT GGPLPFAWDILSPQFMYGS AYVKHPADIPDYL LSFPEGF
KWERVM FEDGGVVTVTQDSSLQDGEFJY VKLRGTNFPSDGPVMQK TMGWEASSE
RA1YPEDGAL GEIKQRLKL DGGHYDAEVKTTYK,\KKP\7QLPGAYNWIKLDITSHNE
DYTIVEQYERAEGRHSTGGMDELYKGS QLEELLSTSFDIQFNDLTLLETAFT TSYANE
HRLLNVSHNERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREE.SLAGFSRFC
SFDAYIKLGKGEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFL QVMIPQVEKG
NFERVKDYKTCLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIWNGAVLS GLGKSK
KLAEQDAAKNALAQLSEV
[00254] SpRNase3-mCherry-NLS :
[00255] MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNERLEFLGDAV LQLIISEYLFAKYP KTEGDMS LRSMIVREESLAGFSRFCSFDAYIKLGKGEE SGGRR
RDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVE GNFERVKDY TCLQEFLQTK
GDVAIDYQVISE GPAHA QFEVSIWNGAVLSKGLGKSKKLAEQDAA NALAQLSEV
GSVSKGEEDNMAIIKEFMRFKVHA1EGSWGHEFEIEGEGEGRPYEGTQTAKL VT GGP
LPFAWDlLSPQF YGSKAYVKIiPADIPDYLKISFPEGFKWERVMNFEDGGVVTV QDS
SLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEI QRLiiLKD
GGIWDAEVKTTY A KPVQLPGAY VNI LDITSHNEDYTIVEQYERAEGRHSTGGMD
ELYK 1RPAAT KAGQAKKKK
[00256] NLS-SpCas9ii-NLS (the D10A nickase mutation is lowercase):
[002571 DY DHDGDYKDHDIDY DDDDKMAPK KRKVGIHGVPAADK YSiGLai
GTNSVGWA\7ITDEY 7PSKKFKVLGNTDRHSIK NLIGALLFDSGETAEATRLKRTARR RYTRRK RJCYLQEIFSNEMAKVDDSFFHRLEESFLVEED XHERHPIFGNIVDEVAYHE KYPTIYHLRKKLVDSTDKADLRLIYI^AHMIKFRGHFLIEGDL PDNSDVDKLFIQLVQ
TYNQLFEENPINASGVDAKAILSARLS SRRLENLIAQLPGE KNGLFGNLIALSLGLTPN
FKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAK LSDAILLSDILRVNT
EIT APLSASMI RYDEFIHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQ
EEFYKFIKPILEKMDGTEELLVKL REDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFY
PFL DNREKIE n ll¾lPYYVGPLARG SRFAWMTR SEE r]TPW FE:EVVDKGASAQS
FIERA1TNFDKNLPNE VLPKHSLLYEYFTV ¾TELTKVKY 7TEGMRKPAFLSGEQKKAIV
DLLFKTNRKVTVKQLKEDYF KIECFDSVEISGVEDRFNASLGTYHDLLKIIKD DFLDN
EENEDILEDIVLTLTLFEDREMffiERLKTYAHLFDD VMKQLKRRRYTGWGRLSRKLIN
GiRDKQSGKTlLDFLKSDGFA R TMQLIHDDSLTFKEDIQKAQVSGQGDSLilEHiANLA
GSPAIK GlLQTV VVDELV VMGiH J'E iVIEMARENQTTQ GQKNSRERM lIllEEG
I EEGSQILKEHPVENTQLQNEKLYLYYLQNGRDAIYVDQELDINRLSDYDVDHIVPQSF
L DDSIDNKVLTRSDK^iRG SDNVPSEEVV KMKNYWRQLLNA LITQRiFDNLT AE
RGGLSELD AGFIKRQLVE RQITKH\7AQILDSRAINTKYDENDKLIREV VITLKSKLA7S
DFRKDFQFYK.VREINNYHHAHDAYLNAVVGTALI KYP LESEFVYGDYKVYDVRKMI
AKSEQElGiATAKYFFYSNIMNFF TEITLANGEIRKRPLlETNGETGEIVWDKGRDFATV
R VLSMPQV IVK TEVQTGGFS ESIL-P RNSDKLIARKKDWDP KYGGFDSPTVAYS
VLWAKVE GKSKKLKSVKELLGITIMERSSFEKNProFLEAKGYKEVKKDLII LP YS
LFELENGRKRMLASAGELQ GNELALPS YVNFLYLASfiYEKLKGSPEDNEQ QLFVE
QHKHYLDE] 1EQISEFS RVJ LADA LDKVLSAYNKFiRD PlREQAE lIFILFTLTNLGAP
AAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDKRPAATKKAGQAK
K K
[00258] hEMXl-HR Template-Hindn-Nhel:
[00259] GAATGCTGCCCTCAGACCCGCTTCCTCCCTGTCCTTGTCTGTCCAAGGAGA ATGAGGTCTCACTGGTGGATTTCGGACTACCCTGAGGAGCTGGCACCTGAGGGACA AGGCCCCCCACCTGCCCAGCTCCAGCCTCTGATGAGGGGTGGGAGAGAGCTACATG AGGTTGCTAAGAAAGCCTCCCCTGAAGGAGACCACACAGTGTGTGAGGTTGGAGTC
TCTAGCAGCGGGTTCTGTGCCCCCAGGGATAGTCTGGCTGTCCAGGCACTGCTCTTG ΑΊΑ'ΓΛΛΛί Λ(Χ Λ( 'Ί (X'l'AC) 1 'ΓΛΊ (ίΛΑΛ('( Λ'Γ(}ί ( ('ΛΊΊ ("1 (i( C''f'C Ύ< 'TGTATGGAA AAGAGCATGGGGCTGGCCCGTGGGGTGGTGTCCACTTTAGGCCCTGTGGGAGATCA TGGGAACCCACGCAGTGGGTCATAGGCTCTCTCATTTACTACTCACATCCACTCTGT GAAGAAGCGATTATGATCTCTCCTCTAGAAACTCGTAGAGTCCCATGTCTGCCGGCT
TCCAGAGCCTGCACTCCTCCACCTTGGCTTGGCTTTGCTGGGGCTAGAGGAGCTAGG
ATGCACAGCAGCTCTGTGACCCTTTGTTTGAGAGGAACAGGAAAACCACCCTTCTCT
nXX XXVVCTGTGTC ίΊΧ Ί'Ί'( ( Ί'(!('('ί Ί'ί;('('ΛΊ'( ('('(']'!'('] (}Ί'ί·ΛΛ'Γ(!'ΓΊ'Λ(ίΛ('( ( ΛΊ
GGGAGCAGCTGGTCAGAGGGGACCCCGGCCTGGGGCCCCTAACCCTATGTAGCCTC
Λ( ) ] (' ] '!'( ΧΧ'ΛΊΧ 'Λί ;G( Ί ( Ί'( Λ(ί( '!'( AGC X'TG AGTGTIX ·Λ( ;G( ί C '( 'Λ( ΠΧΧ ·( ΊΧΧ Ί ( Τ
GGGGGCCTCCTGAGTTTCTCATCTGTGCCCCTCCCTCCCTGGCCCAGGTGAAGGTGT
GGTTCCAGAACCGGAGGACAAAGTACAAACGGCAGAAGCTGGAGGAGGAAGGGCC
TGAGTCCGAGCAGAAGAAGAAGGGCTCCCATCACATCAACCGGTGGCGCATTGCCA
CGAAGCAGGCCAATGGGGAGGACATCGATGTCACCTCCAATGACaagcttgctagcGGTGG
GCAACCACAAACCCACGAGGGCAGAGTGCTGCTTGCTGCTGGCCAGGCCCCTGCGT
GGGCCCAAGCTGGACTCTGGCCACTCCCTGGCCAGGCTTTGGGGAGGCCTGGAGTC
Figure imgf000097_0001
GCTGGCTGAGGCCTGGGACCACTTGGCCTTCTCCTCGGAGAGCCTGCCTGCCTGGGC
( ί( XsC '( '( s( '( '( X ·( X 'AC C XX A.GC " f'C '( X'AGi Ί'ί ·( " f'C " f'C '( ΧΠί Γ( " f'C X 'ΛΛΊΧ " Γ( '( "Π " Γ I ϊ
TT TGATGCATTTCTGT TTAATTTATTTTCCAGGCACCACTGTAGTTTAGTGATCCCC
AGTGTCCCCCTTCCCTATGGGAATAATAAAAGTCTCTCTCTTAATGACACGGGCATC
CAGCTCCAGCCCCAGAGCCTGGGGTGGTAGATTCCGGCTCTGAGGGCCAGTGGGGG
CTGGTAGAGCAAACGCGTTCAGGGCCTGGGAGCCTGGGGTGGGGTACTGGTGGAGG
GGGTC AA TAATTrAr! AAaCXTaCT^
CAGCTCCACAGCAGGAGAAACAGGCTAGACATAGGGAAGGGCCATCCTGTATCTTG
Λ(ί( XsAGG AC 'Λί XX C X'AC Π { "ΠΊΧΎΎΛΑί XJFATT A AC Π ( XX JAA.TC 'Λί XX C '( 'AC s
GTAGTTCAATGGGAGAGGGAGAGTGCTTCCCTCTGCCTAGAGACTCTGGTGGCTTCT
CCAGTTGAGGAGAAACCAGAGGAAAGGGGAGGATTGGGGTCTGGGGGAGGGAACA
CCATTCACAAAGGCTGACGGTTCCAGTCCGAAGTCGTGGGCCCACCAGGATGCTCA
CCTGTCCTTGGAGAACCGCTGGGCAGGTTGAGACTGCAGAGACAGGGCTTAAGGCT
GAGCCTGCAACCAGTCCCCAGTGACTCAGGGCCTCCTCAGCCCAAGAAAGAGCAAC
GTGCCAGGGCCCGCTGAGCTCTTGTGTTCACCTG [00261] V! RPAA AGQA S !A GlJ)i(i]GSVG\OU^ V Xn;flf! XSR!F!}A A(^i:\NlAR! rNRQGR ! AKRK !IRR\1U NRIJ:hf:SG[J ! ΙΊ' Ι ΙΝΙ ΡΥΟΙ.Κλ' ί!!.
TDELSNEELFIALK MVKHRGISYLDDASDDGNSSVGDYAQIVKENS QLET TPGQIQL
ERYQTYGQLRGDFTVEKDGKK RLINVFPTSAYRSEALRJLQTQQEFNPQITDEFINRYL
EILTG R YYHGPGNEK.SRTDYGRYRTSGETLD JFGI UG CTFYPDEFRAAKASYTAQ
EF LLNDLNNLTVPTETKELSKT.QKNQIINY\7KNEILAMGPAKLF YIAKLLSCD\7ADIK
GYRIDKSGI AEIHTFEAYR MKTLETLDIEQMDRETLDKLAYVLTLNTEREGIQEALEHE
FADGSFSQ QVDEL 7QFRK,ANSSIFG GWHNFSVKLMMELIPELYETSEEQMTILTRLG
KQK TSSSN TKYIDEKIJ.TEE]YNPVVA.KSVRQA:I IVNAAIKRY:RGDFDNLVIEMARE N
EDDEKKAIQKIQKAN-ODEKDAAMLKAA ^
GERCI^TGKTISIHDLINNSNQFEVDHILPLSLTFDDSLANKVLVYATANQEKGQRTPYQ ALDSMDDAWSFRELKAFVRES TLSNKKKEYLLTEEDISKFDVRKKFIERNLVDTRYAS
RV\XNALQEHFRAHK1DTK\7S\7VRGQFTSQLRRHWGIEKTRDTYHHHAVDALIIAASSQ
LNLWKKQ NTLVSYSEDQLLDIETGELISDDEY ESVF APYQHFVDTL S EFEDSILF
SYQVDSKF R ISDATIYATRQAK 7GKDKADETYVLGK1KDIYTQDGYDAFMK1YKKD
KSKFLMYRHDPQTFE VIEPILENYPN QINEKGKEVPCNPFLKYKEEHGYIRKYSKKGN
GPEIKSLKYYDSKLGNHIDITPKDSNN VVLQSVSPWRADVYFNKTTG YEILGL YAD
LQFE GTGTY ISQEKYNDIK. KEGVDSDSEFKFTLY NDLLLV DTET EQQLFRFLSR
TMP Q BYVELKI^D Q FEGGEALIKVLG VANSGQC KGLG SNiSIYKVRTDVLG
NQHIIK EGDKPKLDFKRPAATKKAGQAKKKK
[00262] U6-St_tracrRNA(7-97):
[002631 GAGGGCCTATTTCCCATGATTCCTTCATATTTGCATATACGATACAAGGCT GTTAGAGAGATAATTGGAATTAATTTGACTGTA^
TACGTGACGTAGAAAGTAATAATTTCTTGGGTAGTTTGCAGTTTTAAAATTATGTTTT
AAAATGGACTATCATATGCTTACCGTAACTTGAAAGTATTTCGATTTCTTGGCTTTAT
ATATCTTGTGGAAAGGACGAAACACCGTTACTTAAATCTTGCAGAAGCTACAAAGA
TAAGGCTTCATGCCGAAATCAACACCCTGTCATTTTATGGCAGGGTGTTTTCGTTATT
TAA
[00264] U6-DR-spacer-DR (S. pyogenes SF370)
[00265] gagggcctatttcccaigattccttcatatttgcaiatacgatacaaggctgtiagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgt^ ttaccgtaacttgaaagtatttcgatitctiggctttatatatctigtggaaaggacgaaacaccgggitttagagctatgctgttttgaatggiccc a acNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
TTTTTT (lowercase underline = direct repeat; N = guide sequence; bold = terminator)
[00266] Chimeric RNA containing +48 tracr RNA (S, pyogenes SF370)
[00267] gagggcetatttcccatgattccttcatatttgcatatacgatacaaggctgitagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaataegtgacgtagaaagt^
ttaccgtaacttgaaagtatttcgaittettggctttataiatettgtggaaaggacgaaacaccN NNNNNN N gttttagagctagaaatagcaagttaaaataaggctagtccgTTTTTTT (N = guide sequence; first underline = tracr mate sequence; second underline = tracr sequence; bold = terminator)
[00268] Chimeric RNA containing +54 tracr RNA (S. pyogenes SF370)
[00269] gagggcciatticccatgattccttcataittgcatatacgatacaaggctgttagag
cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgc ttaccgtaacttgaaagtatttcgarrtcttggcttt^^
NNgttttagagctagaaatagcaagttaaaataaggctagtccgttatcaTTTTTTTT (N = guide sequence; first underline = tracr mate sequence; second underline = tracr sequence; bold = terminator)
|00270| Chimeric UNA containing +67 tracr RNA (S. pyogenes SF370)
[00271 ] gagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagataitagtacaaaatacgtgacgtagaaagtaataatitctigggiagtltgcagttttaaa
ttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacaccNNNNNNNNNNNNNNNNNN Ngt ttagagc ^ (N = guide sequence; first underline :::: tracr mate sequence; second underline ::: tracr sequence; bold :::: terminator)
[00272] Chimeric RNA containing +85 tracr RNA (S. pyogenes SF370)
[00273] gagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagrtttaaaa
ttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacaccNNiNN;NN;NN;NN;NN;NNNNNN Ngttttagagcta^
(N = guide sequence; first underline = tracr mate sequence; second underline = tracr sequence; bold = terminator)
! 00274 ! CBh-NLS-SpCas9-NLS [00275] CGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACC CCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTT TCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATC AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCG
C '( "!'G( ·( 'ΛΤΤΛΊΧ sC( X AGTAC 'ΛΊ'ί · Λ( ( ΊΎΑΊ X sG AC ΊΊΊ X X TAC 1 TGi ·( 'AC Π'ΛΓΛΎί ΎΛ
CGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTC
α ί Λτα ί ( χ χχ τα c ί Λ( ^^
TGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGCGGGGCGG
GGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCG
GCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAA
AAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCC
GCTCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCAC
AGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCTGAGCAAGAGG
lA AC iGC nilA AC iGC iAl iGl'I GC ni X n i nAllA Al nilAAl'I AC ( Ί ίΛί ίί 'Λί
CTGCCTGAAATCACTTTTTTTCAGGTTGGaccggtgccaccATGGACTATAAGGACCACGA
( X ;G AG ACT AC A AC sGATCATC ; ΑΤΛΊΊΧ ; ATTAC 'ΛΑ Λ( · Λ( ( i A'iX · AC C s ATA AC ; ΑΊ X ;G( C X
CAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCCGACAAGAAGTA
CAGCATCGGCCTCGACATCGGCACCA ^^
AGTACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACCGACCGGCACAGC ATCAAGAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGGCGAAACAGCCGAGGC
( Λ(Γ( GGC TGAAGAGAAC X (X ^
TGCTATCTGCAAGAGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGCTTCTTC
C 'Λ( AGACTGC s AGAG!C X TTC X TC sG!C ;G A AC ; AC sG AT A AG A AC ;( Ά( 'GAG( X ;GC A( X X
CATCTTCGGCAACATCGTGGACGAGGTGGCCTACCACGAGAAGTACCCCACCATCT
ACCACCTGAGAAAGAAACTGGTGGACAGCACCGACAAGGCCGACCTGCGGCTGATC
TATCTGGCCCTGGCCCACATGATCAAGTTCCGGGGCCACTTCCTGATCGAGGGCGAC
CTGAACCCCGACAACAGCGACGTGGACAAGCTGTTCATCCAGCTGGTGCAGACCTA
CAACCAGCTGTTCGAGGAAAACCCCATCAACGCCAGCGGCGTGGACGCCAAGGCCA
TCCTGTCTGCCAGACTGAGCAAGAGCAGACGGCTGGAAAATCTGATCGCCCAGCTG
( X X X sC 'GAGA AC ; AAGA ΑΊ X ;G( X TC ' ΙΧ G( ·( 'AACC'i GATTGC X X TC s AC ;( '( Ί X ;G( ·( XT
GACCCCCAACTTCAAGAGCAACTTCGACCTGGCCGAGGATGCCAAACTGCAGCTGA GCAAGGACACCTACGACGACGACCTGGACAACCTGCTGGCCCAGATCGGCGACCAG
TACGCCGACCTGTTTCTGGCCGCCAAGAACCTGTCCGACGCCATCCTGCTGAGCGAC
ATCCTGAGAGTGAACACCGAGATCACCAAGGCCCCCCTGAGCGCCTCTATGATCAA
GAGATACGACGAGCACCACCAGGACCTGACCCTGCTGAAAGCTCTCGTGCGGCAGC
Λ(ί('Ί Ϊ('{ Ί'(·Λ{;ΛΛ(}'ΓΛ('ΛΛΛ{;Λ{;Λ'Π F'f'C ΊΊΐ GAC( AGA X A G ACG Xl AC XX C
GGCTACATTGACGGCGGAGCCAGCCAGGAAGAGTTCTACAAGTTCATCAAGCCCAT
('( Τ( A Λ AC ; ΑΤ( -GA( ΧΚ X'AC '( XiAGC s AAC'i GC TC ( ;TGA AC X'TGA AC 'Λ( ·Λ( ·Λ( -GA( '
CTGCTGCGGAAGCAGCGGACCTTCGACAACGGCAGCATCCCCCACCAGATCCACCT
GGGAGAGCTGCACGCCATTCTGCGGCGGCAGGAAGATTTTTACCCATTCCTGAAGG
ACAACCGGGAAAAGATCGAGAAGATCCTGACCTTCCGCATCCCCTACTACGTGGGC
CCTCTGGCCAGGGGAAACAGCAGATTCGCCTGGATGACCAGAAAGAGCGAGGAA
CCATCACCCCCTGGAACTTCGAGGAAGTGGTGGACAAGGGCGCTTCCGCCCAGAGC
TTCATCGAGCGGATGACCAACTTCGATAAGAACCTGCCCAACGAGAAGGTGCTGCC
C 'ΛΛ(.Ϊ{ A.CAC )( { TC K' GTAC XJAGTAC "f'TC A( C C sTG'i ATA AC ΪΑΧ ϊ( T( ·Λ( C A AAGTC s A
AATACGTGACCGAGGGAATGAGAAAGCCCGCCTTCCTGAGCGGCGAGCAGAAAAA
( { Α Γ(Χ |{;αΛ(ΧΊ Ο(ΊΧΠΊΧ \Λ(}Λ(ΧΑΛ( { ( iAAA(n ;A{ CX7r(iAA( AG( Ί(;Α
AAGAGGACTACTTCAAGAAAATCGAGTGCTTCGACTCCGTGGAAATCTCCGGCGTG
GAAGATCGGTTCAACGCCTCCCTGGGCACATACCACGATCTGCTGAAAATTATCAAG
GACAAGGACTTCCTGGACAATGAGGAAAACGAGGACATTCTGGAAGATATCGTGCT
GACCCTGACACTGTTTGAGGACAGAGAGATGATCGAGGAACGGCTGAAAACCTATG CCCA£CTGTTCGACGACAAAARGAIGAAGCM}CRGAM}CGGCGGAGAIACACCGGC TGGGGCAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGACAAGCAGTCCGGCAA GACAATCCTGG^^
GATCCACGACGACAGCCTGACCTTTAAAGAGGACATCCAGAAAGCCCAGGTGTCCG
GCCAGGGCGATAGCCTGCACGAGCACATTGCCAATCTGGCCGGCAGCCCCGCCATT
AAGAAGGGCATCCTGCAGACAGTGAAGGTGGTGGACGAGCTCGTGAAAGTGATGGG
CCGGCACAAGCCCGAGAACATCGTGATCGAAATGGCCAGAGAGAACCAGACCACCC
AGAAGGGACAGAAGAACAGCCGCGAGAGAATGAAGCGGATCGAAGAGGGCATCAA
AGAGCTGGGCAGCCAGATCCTGAAAGAACACCCCGTGGAAAACACCCAGCTGCAGA
AC X}AGA AC K'TGTAC T'TGTAC "F'A( C TC X'AC ΪΛ ATGC XX C SC ΪΛΤΑΊΧΧΙ AC XXI GC ;AC '( 'AC )
GAACTGGACATCAACCGGCTGTCCGACTACGATGTGGACCATATCGTGCCTCAGAG TTTCTGAAGGACGACTCCATCGACAACAAGGTGCTGACCAGAAGCGACAAGAACC
GGGGCAAGAGCGACAACGTGCCCTCCGAAGAGGTCGTGAAGAAGATGAAGAACTA
CTGGCGGCAGCTGCTGAACGCCAAGCTGATTACCCAGAGAAAGTTCGACAATCTGA
CCAAGGCCGAGAGAGGCGGCCTGAGCGAACTGGATAAGGCCGGCTTCATCAAGAG
Figure imgf000102_0001
GGA iAACAC 'SAACn-AC GA( GAGAATGA( AAGrTGAT(X'GG( AGTGAAAGTGA Λ(ΧΧΊ (ί (;'Γ(ΧΆΑ(ί('ΊΧ)(ίΊΧ;'Γ(ΧΧί ΊΊ'Ί XX iAAGCiA'jT j (X AGTI FTAC AAAGTC- CGCGAGATCAACAACTACCACCACGCCCACGACGCCTACCTGAACGCCGTCGTGGG AACCGCCCTGATCAAAAAGTACCCTAAGCTGGAAAGCGAGTTCGTGTACGGCGACT ACAAGGTGTACGACGTGCGGAAGATGATCGCCAAGAGCGAGCAGGAAATCGGCAA GGCTACCGCCAAGTACTTCTTCTACAGCAACATCATGAACTTTTTCAAGACCGAGAT TACCCTGGCCAACGGCGAGATCCGGAAGCGGCCTCTGATCGAGACAAACGGCGAAA CCGGGGAGATCGTGTGGGATAAGGGCCGGGATTTTGCCACCGTGCGGAAAGTGCTG AG AIXK X AAGTGAAj7\T( iTGAAAAAGA(X IAGG1X
CAAAGAGTCTATCCTGCCCAAGAGGAACAGCGATAAGCTGATCGCCAGAAAGAAGG
AC ΊΧ ϊ(ί( SAC XX'T G AC sTAC C sGC X ϊ(ί( "f'TC G AC 'AC ;(XX A( X X ΠΧ ·( ΧΊΆΊΊ CTGTC j( '
TGGTGGTGGCCAAAGTGGAAAAGGGCAAGTCCAAGAAACTGAAGAGTGTGAAAGA
GCTGCTGGGGATCACCATCATGGAAAGAAGCAGCTTCGAGAAGAATCCCATCGACT
TTCTGGAAGCCAAGGGCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCT
AAGTACTCCCTGTTCGAGCTGGAAAACGGCCGGAAGAGAATGCTGGCCTCTGCCGG
(Χ·ΑΑ(ΊΧ AGAACiGCiA CX AAC 1(X: ΊΧ Χ ΊΧ C\\AAl AlXnX}AACll(XlX
ACCTGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGATAATGAGCAGAAA
C Ά( ;('TG"i TG'i G ΪΛ C AGC ACAA ;C 'AC TA(X"i GC iAC 'G AG ATC ΆΊ ( ; AC K'AC s TC AG
CGAGTTCTCCAAGAGAGTGATCCTGGCCGACGCTAATCTGGACAAAGTGCTGTCCGC
CTACAACAAGCACCGGGATAAGCCCATCAGAGAGCAGGCCGAGAATATCATCCACC
TGTTTACCCTGACCAATCTGGGAGCCCCTGCCGCCTTCAAGTACTTTGACACCACCA
TCGACCGGAAGAGGTACACCAGCACCAAAGAGGTGCTGGACGCCACCCTGATCCAC
CAGAGCATCACCGGCCTGTACGAGACACGGATCGACCTGTCTCAGCTGGGAGGCGA
CTTTCTTTTTCTTAGCTTGACCAGCTTTCTTAGTAGCAGCAGGACGCTTTAA (underline LS-hSpCas9-NLS) [00276] Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PAM of NNAGAAW)
i 00277! N N N N NNNNNNNNNNNNgtttttgtacictcaa atttaGAAAtaaatcttgcagaagctacaa agataagacttcatgccgaaatc^c (N ::: guide sequence; first underline :::: tracr mate sequence; second underline ::: tracr sequence; bold ::: terminator)
[00278j Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PAM of NNAGAAW)
[00279! ]\ Ν ΝΠΝΤ ΝΝΝ^
tgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (N guide sequence; first underline
= tracr mate sequence; second underline = tracr sequence; bold = terminator)
[00280] Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PA M of
NNAGAAW)
[00281] Ν Ν Ν ΝΠ Ι^^
tgccgaaatcaacaccctgtcattttatggcagggtgtTTTTTT (N ::: guide sequence; first underline :::: tracr mate sequence; second underline = tracr sequence; bold = terminator)
[00282J Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PAM of NNAGAAW)
[00283] NNNNNNNNNh^ gttattgtactctcaaga tttaGAAAtaaatcttgcagaagctacaa agataaggcttcatgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (N = guide sequence; first underline ::: tracr mate sequence; second underline :::: tracr sequence; bold = terminator)
[002841 Example chimeric RNA for S. thermophilus LMD-9 CRISPRl Cas9 (with PA M of NNAGAAW)
[CI0285] NNNNNNNNNNNNNNNNNNNNgttattgtactctcaGAAAtgcagaagctacaaagataaggcttca tgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (N = guide sequence; first underline
= tracr mate sequence; second underline = tracr sequence; bold = terminator)
[002861 Example chimeric RNA for S. thermophilus LMD-9 CRISPR l Cas9 (with PAM of
NNAGAAW)
[ 00287] NNN^N^N^NNNNNNNNNNNNgttattgtactctcaGAAAtgcagaagctacaaagaraaggcttca tgcegaaatcaacaccctgtcattttatggeagggtgtTTTTTT (N = guide sequence; first underline = tracr mate sequence; second underline :::: tracr sequence; bold :::: terminator) [00288] Example chimeric RNA for S. ihermophilus LMD-9 CRJSPRl Cas9 (with PAM of NNAGAAW)
[002891 N N N N N NNNNNNNNNNgttattgtactctcaagatttaGAAAtaaatcttgcagaagctacaa tgataaggcttcatgj^ (N = guide sequence; first underline :::: tracr mate sequence; second underline ::: tracr sequence; bold ::: terminator)
[00290] Example chimeric RNA for S. thennophilus LMD-9 CRISPR1 Cas9 (with PAM of NNAGAAW)
[00291] Ν>ΓΝ>ΓΝ>ΓΝ>Γ^
tgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (N = guide sequence; first underline
= tracr mate sequence; second underline = tracr sequence; bold = terminator)
[00292] Example chimeric RNA for S. thermophilus LMD-9 CRISPR1 Cas9 (with PAM of
NNAGAAW)
[00293] ]^Ν>ΓΝ>^^
tgccgaaatcaacaccctgtcattttatggcagggtgtTTTTTT (N ::: guide sequence; first underline = tracr mate sequence; second underline = tracr sequence; bold = terminator)
[00294] Example chimeric RNA for S. thermophilus LMD-9 CRISP 3 Cas9 (with PAM of NGGNG)
[00295] NNNNNNNNNNNlSn^
cgtactcaacttgaaaaggtggcaecgattcggtgtTTTTTT (N = guide sequence; first underline = tracr mate sequence; second underline :::: tracr sequence; bold :::: terminator)
[00296] Codon-optimized version of Cas9 from S. thermophilus LMD-9 CRISPR3 locus (with an NLS at both 5' and 3' ends)
[CI0297] AI CiAAAAC X X iCX 'i Λί ιΛΛΛΛΛί ^ ( Gi X'AC 'AAAAAAGAAA
AAGACCAAGCCCTACAGCATCGGCCTGGACATCGGCACCAATAGCGTGGGCTGGGC
CGTGACCACCGACAACTACAAGGTGCCCAGCAAGAAAATGAAGGTGCTGGGCAACA
CCTCCAAGAAGTACATCAAGAAAAACCTGCTGGGCGTGCTGCTGTTCGACAGCGGC
ATTACAGCCGAGGGCAGACGGCTGAAGAGAACCGCCAGACGGCGGTACACCCGGC
GGAGAAACAGAATCCTGTATCTGCAAGAGATCTTCAGCACCGAGATGGCTACCCTG
GACGACGCCTTCTTCCAGCGGCTGGACGACAGCTTCCTGGTGCCCGACGACAAGCG
GGACAGCAAGTACCXX'ATCTI CGGCAACCTGGTGGAAGAGAAGGCCTACCACGACG
AGTTCCCCACCATCTACCACCTGAGAAAGTACCTGGCCGACAGCACCAAGAAGGCC GACCTGAGACTGGTGTATCTGGCCCTGGCCCACATGATCAAGTACCGGGGCCACTTC
CTGATCGAGGGCGAGTTCAACAGCAAGAACAACGACATCCAGAAGAACTTCCAGGA
CTTCCTGGACACCTACAACGCCATCTTCGAGAGCGACCTGTCCCTGGAAAACAGCAA
GCAGCTGGAAGAGATCGTGAAGGACAAGATCAGCAAGCTGGAAAAGAAGGACCGC
ΛΊ ( Χ 'Ί'( ίΛΑ( )( 'Ί ( s'!"l'( ( ( '('( iC iCi ·Λί ·ΛΑ(ίΑΛ( Λ(}ί ( ίΛΑΊΧ ΊΎ( AGi GAGTTTC ΊΧ ΪΑΛ
GCTGATCGTGGGCAACCAGGCCGACTTCAGAAAGTGCTTCAACCTGGACGAGAAAG
Figure imgf000105_0001
TATATCGGCGACGACTACAGCGACGTGTTCCTGAAGGCCAAGAAGCTGTACGACGC
TATCCTGCTGAGCGGCTTCCTGACCGTGACCGACAACGAGACAGAGGCCCCACTGA
GCAGCGCCATGATTAAGCGGTACAACGAGCACAAAGAGGATCTGGCTCTGCTGAAA
GAGTACATCCGGAACATCAGCCTGAAAACCTACAATGAGGTGTTCAAGGACGACAC
CAAGAACGGCTACGCCGGCTACATCGACGGCAAGACCAACCAGGAAGATTTCTATG
TGTACCTGAAGAAGCTGCTGGCCGAGTTCGAGGGGGCCGACTACTTTCTGGAAAAA
Figure imgf000105_0002
CTACCAGATCCATCTGCAGGAAATGCGGGCCATCCTGGACAAGCAGGCCAAGTTCT
AC XVVri C X sGi C \\AGA A( Λ ΛΛ
CCTTACTACGTGGGCCCCCTGGCCAGAGGCAACAGCGATTTTGCCTGGTCCATCCGG AAGCGCAATGAGAAGATCACCCCCTGGAACTTCGAGGACGTGATCGACAAAGAGTC
CAGCGCCGAGGCCTTCATCAACCGGATGACCAGCTTCGACCTGTACCTGCCCGAGG AAAAGGTGCTGCCCAAGCACAGCCTGCTGTACGAGACATTCAATGTGTATAACGAG
Figure imgf000105_0003
AAGCAGAAAAAGGACATCGTGCGGCTGTACTTCAAGGACAAGCGGAAAGTGACCG ΛΊ AAGG AC ΛΊ CATC AG'! AC '( 'TG( ACGC X V\T( TAC XX Ί 7\{ C s ATi JG( ΛΊ CGAGC "IX 1 AAGGGCATCGAGAAGCAGTTCAACTCCAGCCTGAGCACATACCACGACCTGCTGAA CATTATCAACGACAAAGAATTTCTGGACGACTCCAGCAACGAGGCCATCATCGAAG AGATCATCCACACCCTGACCATCTTTGAGGACCGCGAGATGATCAAGCAGCGGCTG AGCAAGTTCGAGAACATCTTCGACAAGAGCGTGCTGAAAAAGCTGAGCAGACGGCA CTACACCGGCTGGGGCAAGCTGAGCGCCAAGCTGATCAACGGCATCCGGGACGAGA AGTCCGGCAACACAATCCTGGACTACCTGATCGACGACGGCATCAGCAACCGGAAC
Figure imgf000105_0004
( ( Ai iA AT( G( iG( iA( GAGG A CA AGGGCA A CA'S'C AA AG AAG I < GT A AGTC ( CTGi CCGGCAGCCCCGCCATCAAGAAGGGAATCCTGCAGAGCATCAAGATCGTGGACGAG
CTCGTGAAAGTGATGGGCGGCAGAAAGCCCGAGAGCATCGTGGTGGAAATGGCTAG
A G A G A AC C AGT AC A CC A ATC AGGGC A AG AGC A AC AGC C AGC AG AG ACTG AA G A G A
CTGGAAAAGTCCCTGAAAGAGCTGGGCAGCAAGATTCTGAAAGAGAATATCCCTGC
C WAGi TGTC 'ΛΛ( ίΛ'Γ( Χ ίΛ('ΑΛ( ΛΛί ( )( '( { '!'{ J( ' AC ) ΑΛ( 'ί ·Λ( ( ( )( ί( 'ΊΧ )Ί Λ( ( 'ΊΧ )Ί Λ( Ί'
ACCTGCAGAATGGCAAGGACATGTATACAGGCGACGACCTGGATATCGACCGCCTG
AGCAACTACGACATCGACCATATTATCCCCCAGGCCTTCC^
GACAACAAAGTGCTGGTGTCCTCCGCCAGCAACCGCGGCAAGTCCGATGATGTGCC
CAGCCTGGAAGTCGTGAAAAAGAGAAAGACCTTCTGGTATCAGCTGCTGAAAAGCA
AGCTGATTAGCCAGAGGAAGTTCGACAACCTGACCAAGGCCGAGAGAGGCGGCCTG
AGCCCTGAAGATAAGGCCGGCTTCATCCAGAGACAGCTGGTGGAAACCCGGCAGAT
CACCAAGCACGTGGCCAGACTGCTGGATGAGAAGTTTAACAACAAGAAGGACGAGA
ACAACCGGGCCGTGCGGACCGTGAAGATCATCACCCTGAAGTCCACCCTGGTGTCC
CAGTTCCGGAAGGACTT(XiAGCri jTATAAAGTGCX5CGAGATCAATGACTTTCACCAC
GCCCACGACGCCTACCTGAATGCCGTGGTGGCTTCCGCCCTGCTGAAGAAGTACCCT
AAGCTGGAACCXXjAGTTCGTGTACGGCXjACrrACCCX^AAGTACAACTCCTTCAGAGA
GCGGAAGTCCGCCACCGAGAAGGTGTACTTCTACTCCAACATCATGAATATCTTTAA
GAAGTCCATCTCCCTGGCCGATGGCAGAGTGATCGAGCGGCCCCTGATCGAAGTGA
ACGAAGAGACAGGCGAGAGCGTGTGGAACAAAGAAAGCGACCTGGCCACCGTGCG
GCGGGTGCTGAGTTATCCTCAAGTGAATGTCGTGAAGAAGGTGGAAGAACAGAACC
ACGGCCrGGATCGGGGCAAGCCCAAGGGCCTar'TCAACGCCAACCrGTCCAGCAAG
CCTAAGCCCAACTCCAACGAGAATCTCGTGGGGGCCAAAGAGTACCTGGACCCTAA
( JAAC HAC iC ί Χ}ΛΊ ( C i( X '( : Λ Γ( ΊΧ Χ-ΑΛ ΓΛί ΧΊΊΧ \ ί ( ΧΓ! ( ΊΧ GI GA AC iC X 'A
CAATCGAGAAGGGCGCTAAGAAAAAGATCACAAACGTGCTGGAATTTCAGGGGATC
TCTATCCTGGACCGGATCAACTACCGGAAGGATAAGCTGAACTTTCTGCTGGAAAAA
GGCTACAAGGACATTGAGCTGATTATCGAGCTGCCTAAGTACTCCCTGTTCGAACTG
AGCGACGGCTCCAGACGGATGCTGGCCTCCATCCTGTCCACCAACAACAAGCGGGG
CGAGATCCACAAGGGAAACCAGATCTTCCTGAGCCAGAAATTTGTGAAACTGCTGT
ACCACGCCAAGCGGATCTCCAACACCATCAATGAGAACCACCGGAAATACGTGGAA
AA( ACAAGAAAGAGTTTGAGGAA(jrGTTCTA(rrACATCCTGGAGTTCAACGAGAA
CTATGTGGGAGCCAAGAAGAACGGCAAACTGCTGAACTCCGCCTTCCAGAGCTGGC AGAACCACAGCATCGACGAGCTGTGCAGCTCCTTCATCGGCCCTACCGGCAGCGAG
CGGAAGGGACTGTTTGAGCTGACCTCCAGAGGCTCTGCCGCCGACTTTGAGTTCCTG
GGAGTGAAGATCCCCCGGTACAGAGACTACACCCCCTCTAGTCTGCTGAAGGACGC
CACCCTGATCCACCAGAGCGTGACCGGCCTGTACGAAACCCGGATCGACCTGGCTA
Λί Ί 'ί ίΛί ίαί ίΛΛΛί ίί Π'ί ( ΊΧ ;( Ί ( Ί·Λ( Ί ΑΛί ιΛΑΛί Ί ΠΧ A AC 'l'AAC iA A A AAGAAATAA
Example 5: RNA-guided editing of bacterial genomes using CRISPR-Cas systems
[00298] Applicants used the CRIS PR-associated endonuclease Cas9 to introduce precise mutations in the genomes of Streptococcus pneumoniae and Escherichia coli. The approach relied on Cas9-directed cleavage at the targeted site to kill unmutated cells and circumvented the need for selectable markers or counter-selection systems. Cas9 specificity was reprogrammed by changing the sequence of short CRISPR RNA (crRNA) to make si gle- and muiti-iiucieotide changes carried on editing templates. Simultaneous use of two erRNAs enabled multiplex mutagenesis. In S. pneumoniae, nearly 100% of ceils that survived Cas9 cleavage contai ed the desired mutation, and 65% when used in combination with recombineering in E. coli. Applicaiits exhaustively analyzed Cas9 target requirements to define the range of targctah!e sequences and showed strategies for editing sites that do not meet these requirements, suggesting the versatility of this technique for bacterial genome engineering.
[00299] The understanding of gene function depends on the possibility of altering DNA sequences within the cel l in a controlled fashion. Site-specific mutagenesis in eukaryotes is achieved by the use of sequence-specific nucleases that promote homologous recombination of a template DNA containing the mutation of interest. Zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALE s) a d homing megaiiucieases can be programmed to cleave genomes in specific locations, but these approaches require engineering of new enzymes for each target sequence. In prokaryotic organisms, mutagenesis methods either introduce a selection marker in the edited locus or require a two-step process that includes a counter- selection system. More recently, phage recombination proteins have been used for recombineering, a tech ique that promotes homologuous recombination of linear DNA or oligonucleotides. However, because there is no selection of mutations, recombineering efficiency can be relatively low (0.1 -10% for point mutations down to 10"5-10"6 for larger modifications), in many cases requiring the screening of a large number of colonies. Therefore new technologies that are affordable, easy to use and efficient are still in need for the genetic engineering of both eukaryottc and prokaryotic organisms.
[003001 Recent work on the CRISPR (clustered, regularly interspaced, short jjalindromie repeats) adaptive immune system of prokaryot.es has led to the identification of nucleases whose sequence specificity is programmed by small RNAs. CRISPR loci are composed of a series of repeats separated by 'spacer' sequences that match the genomes of bacteriophages and other mobile genetic elements. The repeat-spacer array is transcribed as a long precursor and processed within repeat sequences to generate small crRNA that specify the target sequences (also known as protospacers) cleaved by CRISPR systems. Essential for cleavage is the presence of a sequence motif immediately downstream of the target region, known as the protospacer-adjacent motif (PAM). CRISPR-associated (cas) genes usually flank the repeat-spacer array and encode the enzymatic machinery responsible for crRNA biogenesis and targeting. Cas9 is a dsDNA endonuclease that uses a crRNA guide to specify the site of cleavage. Loading of the crRNA guide onto Cas9 occurs during the processing of the crRNA precursor and requires a small R A amisense to the precursor, the tracrRNA, and RNAse III. In contrast to genome editing with ZFNs or TALENs, changing Cas9 target specificity does not require protein engineering but only the design of the short crRNA guide.
[00301] Applicants recently showed in S. pneumoniae that the introduction of a CRISPR system targeting a chromosomal locus leads to the killing of the transformed cells. It was observed that occasional survivors contained mutations in the target region, suggesting that Cas9 dsDNA endonuclease activity against endogenous targets could be used for genome editing. Applicants showed that marker-less mutations can be introduced through the transformation of a template DNA fragment that will recombine in the genome and eliminate Cas9 target recognition. Directing the specificity of Cas9 with several different crR As allows for the introduction of multiple mutations at the same time. Applicants also characterized in detail the sequence requirements for Cas9 targeting and show that the approach can be combined with recombmeering for genome editing in E. coli.
[00302] RESULTS: Genome editing by Cas9 cleavage of a chromosomal target
[00303] S. pneumoniae strain crR6 contains a Cas9-based CRISPR system that cleaves a target sequence present in the bacteriophage φ8232.5. This target was integrated into the srtA chromosomal locus of a second strain R6b2j2'\ An altered target sequence containing a mutation in the PAM region was integrated into the srtA locus of a third strain R6i /lJ i , rendering this strain 'immune' to CR1SPR cleavage (Figure 28a). Applicants transformed R68iJ '5 and R6~ /u"1 cells with genomic DNA from crR6 cells, expecting that successful transformation of R682"' ;> cells should lead to cleavage of the target locus and cell death. Contrary to this expectation, Applicants isolated R68232'5 transformants, albeit with approximately 10-fold less efficiency than R6J /( transformants (Figure 28b). Genetic analysis of eight Rg823-1-5 transformants (Figure 28) revealed that the great majority are the product of a double recombination event that eliminates the toxicity of Cas9 targeting by replacing the φ8232.5 target with the crR6 genome's wild-type srtA locus, which does not contain the protospacer required for Cas9 recognition. These results were proof that the concurrent introduction of a CRISPR system targeting a genomic locus (the targeting construct) together with a template for recombination into the targeted locus (the editing template) led to targeted genome editing (Figure 23a).
[00304] To create a simplified system for genome editing, Applicants modified the CRISPR locus in strain crR6 by deleting cas cas2 and csn2, genes which have been shown to be dispensable for CRISPR targeting, yielding strain crR6M (Figure 28a). This strain retained the same properties of crR6 (Figure 28b). To increase the efficiency of Cas9~based editing and demonstrate that a template DNA of choice can be used to control the mutation introduced, Applicants co-transformed R68 ':> cells with PGR. products of the wild-type srtA gene or the mutant R6370'1 target, either of which should be resistant to cleavage by Cas9. This resulted in a 5- to 10-fold increase of the frequency of transformation compared with genomic crR6 DNA alone (Figure 23b). The efficiency of editing was also substantially increased, with 8/8 transformants tested containing a wild-type srtA copy and 7/8 containing the PAM mutation present in the R637 ' 1 target (Figure 23b and Figure 29a). Taken together, these results showed the potential of genome editing assisted by Cas9.
[00305] Analysis of Cas9 target requirements: To introduce specific changes in the genome, one must use an editing template carrying mutations that abolish Cas9-mediated cleavage, thereby preventing cell death. This is easy to achieve when the deletion of the target or its replacement by another sequence (gene insertion) is sought. When the goal is to produce gene fusions or to generate single -nucleotide mutations, the abolishment of Cas9 nuclease activity will only be possible by introducing mutations in the editing template that alter either the PAM or the protospacer sequences. To determine the constraints of CRISPR-mediated editing, Applicants performed an exhaustive analysis of PAM and protospacer mutations that abrogate CRISPR targeting.
[003061 Previous studies proposed that S. pyogenes Cas9 requires an NGG PAM immediately downstream of the protospacer. However, because only a very limited number of PAM- mactivating mutations have been described so far, Applicants conducted a systematic analysis to find ail 5 -nucleotide sequences following the protospacer that eliminate CRISPR cleavage. Applicants used randomized oligonucleotides to generate all possible 1 ,024 PAM sequences in a heterogeneous PGR product that was transformed into crR6 or R6 cells. Constructs carrying functional PAMs were expected to be recognized and destroyed by Cas9 in erR6 but not R6 cells (Figure 24a). More than 2x 10"' colonies were pooled together to extract DNA for use as template for the co-amplification of al l targets. PGR products were deep sequenced and found to contain all 1,024 sequences, with coverage ranging from 5 to 42,472 reads (See section "Analysis of deep sequencing data"). The functionality of each PAM was estimated by the relative proportion of its reads in the crR6 sample over the R6 sample. Analysis of the first three bases of the PAM, averaging over the two last bases, clearly showed that the NGG pattern was under-represented in crR6 transformants (Figure 24b). Furthermore, the next two bases had no detectable effect on the NGG PAM (See section "Analysis of deep sequencing data"), demonstrating that the NGG N sequence was sufficient to license Cas9 activity. Partial targeting was observed for NAG PAM sequences (Figure 24b). Also the NNGGN pattern partially inactivated CRISPR targeting (Table G), indicating that the NGG motif can still be recognized by Cas9 with reduced efficiency when shifted by 1 bp. These data shed light onto the molecular mechanism of Cas9 target recognition, and they revealed that NGG (or CCN on the complementary strand) sequences are sufficient for Cas9 targeting and that NGG to NAG or NNGGN mutations in the editing template should be avoided. Owing to the high frequency of these tri-nucleotide sequences (once every 8 bp), this means that almost any position of the genome ca be edited. Indeed, Applicants tested ten randomly chosen targets carrying various PAMs and all were found to be functional (Figure 30).
[00307] Another way to disrupt Cas9~mediated cleavage is to introduce mutations in the protospacer region of the editing template. It is known that point mutations within the 'seed sequence' (the 8 to 10 protospacer nucleotides immediately adjacent to the PAM) can abolish cleavage by CRISPR nucleases. However, the exact length of this region is not known, and it is unclear whether mutations to any nucleotide in the seed can disrupt Cas9 target recognition. Applicants followed the same deep sequencing approach described above to randomize the entire protospacer sequence involved in base pair contacts with the crRNA and to determine all sequences that disrupt targeting. Each position of the 20 matching nucleotides ( 1 ) in the spcl target present in R6C cells (Figure 23 a) was randomized and transformed into crR6 and R6 cel ls (Figure 24a). Consistent with the presence of a seed sequence, only mutations in the 12 nucleotides immediately upstream of the PAM abrogated cleavage by Cas9 (Figure 24c). However, different mutations displayed markedly different effects. The distal (from the PAM) positions of the seed (12 to 7) tolerated most mutations and only one particular base substitution abrogated targeting. In contrast, mutations to any nucleotide in the proximal positions (6 to 1, except 3) eliminated Cas9 activity, although at different levels for each particular substitution. At position 3, only two substitutions affected CRJSPR. activity and with different strength. Applicants concluded that, although seed sequence mutations can prevent CRISPR targeting, there are restrictions regarding the nucleotide changes that can be made in each position of the seed. Moreover, these restrictions can most likely vary for different spacer sequences. Therefore Applicants believe that mutations in the PAM sequence, if possible, should be the preferred editing strategy. Alternatively, multiple mutations in the seed sequence may be introduced to prevent Cas9 nuclease activity.
[00308] Cas9~mediated geraome editing lis 5. pneumoni :To develop a rapid and efficient method for targeted genome editing, Applicants engineered strain crR6Rk, a strain in which spacers can be easily introduced by PGR (Figure 33). Applicants decided to edit the β~ galactosidase (bgaA) gene of S. pneumoniae, whose activity can be easily measured. Applicants introduced alanine substitutions of amino acids in the active site of this enzyme: R481A (R→A) and 563A,E564A (NE-→AA) mutations. To illustrate different editing strategies, Applicants designed mutations of both the PAM sequence and the protospacer seed. In both cases the same targeting construct with a crRNA complementary to a region of the β-galactosidase gene that is adjacent to a TGG PAM sequence (CCA in the complementary strand, Figure 26) was used. The R→A editing template created a three-nucleotide mismatch on the protospacer seed sequence (CGT to GCA, also introducing a BtgZl restriction site). In the NE--->AA editing template Applicants simultaneously introduced a synonymous mutation that created an inactive PAM (TGG to TTG) along with mutations that are 21 8 nt downstream of the protospacer region (AAT GAA to GCT GCA, also generating a Tsel restriction site). This last editing strategy demonstrated the possibility of using a remote PAM to make mutations in places where a proper target may be hard to choose. For example, although the S. pneumoniae R6 genome, which has a 39.7% GC content, contains on average one PAM motif every 12 bp, some PAM motifs are separated by up to 194 bp (Figure 33). In addition Applicants designed a AbgaA in-frame deletion of 6,664 bp. in all three cases, co-transformation of the targeting and editing templates produced 10-times more kanamycin-resistant cells than co-transformation with a control editing template containing wild-type bgaA. sequences (Figure 25b). Applicants genotyped 24 transformants (8 for each editing experiment) and found that all but one incorporated the desired change (Figure 25c). DNA sequencing also confirmed not only the presence of the introduced mutations but also the absence of secondary mutations in the target region (Figure 29b, c). Finally, Applicants measured β-galactosidase activity to confirm that all edited cells displayed the expected phenotype (Figure 25 d).
[00309] Cas9-mediated editing can also be used to generate multiple mutations for the study of biological pathways. Applicants decided to illustrate this for the sortase-dependent pathway that anchors surface proteins to the envelope of Gram-positive bacteria. Applicants introduced a .sona.se deletion by co-transformation of a chloramphenicol-resistant targeting construct and a AsrtA editing template (Figure 33a,b), followed by a AbgaA deletion using a kanamycin-resistant targeting construct that replaced the previous one. In S, pneumoniae, β-galactosidase is covalentiy linked to the cell wall by sortase. Therefore, deletion of srtA results in the release of the surface protein into the supernatant, whereas the double deletion has no detectable β- galactosidase activity (Figure 34c). Such a sequential selection can be iterated as many times as required to generate multiple mutations.
[003 J O] These two mutations may also be introduced at the same time. Applicants designed a targeting construct containing two spacers, one matching srtA and the other matching bgaA, and co-transformed it with both editing templates at the same time (Figure 25e). Genetic analysis of transformants showed that editing occurred in 6/8 cases (Figure 25 f). Notably, the remaining two clones each contained either a AsrtA or a AbgaA deletion, suggesting the possibility of performing combinatorial mutagenesis using Cas9. Finally, to eliminate the CRISPR sequences, Applicants introduced a plasmid containing the bgaA target and a spectinomycin resistance gene along with genomic DNA from the wild-type strain R.6. Spectinomycin-resistant transformants that retain the plasmid eliminated the CRISPR sequences (Figure 34a,d). [00311] Mechanism and efficiency of editing: To understand the mechanisms underlying genome editing with Cas9, Applicants designed an experiment in which the editing efficiency was measured independently of Cas9 cleavage. Applicants integrated the ermAM erythromycin resistance gene in the srtA locus, and introduced a premature stop codon using Cas9-mediated editing (Figure 33). The resulting strain (JEN53) contains an ermAM(stop) allele and is sensitive to erythromycin. This strain may be used to assess the efficiency at which the ermAM gene is repaired by measuring the fraction of cells that restore antibiotic resistance with or without the use of Cas9 cleavage. JENS 3 was transformed with an editing template that restores the wild- type allele, together with either a kanamycin-resistant CRISPR construct targeting the ermAM(stop) allele (CRISPR: : ermAM (stop)) or a control construct without a spacer (CRISPR: :0) (Figure 26a,b). In the absence of kanamycin selection, the fraction of edited colonies was on the order of 10""' (erythromycin-resistant cfu/totai cfu) (Figure 26c), representing the baseline frequency of recombination without Cas9-mediated selection against u edited ceils. However, if kanamycin selection was applied and the control CRISPR construct was co- transformed, the fractio of edited colonies increased to about 10"1 (kanamycin- and erythromycin-resistant cru/kanamycin-resistant cfu) (Figure 26c). T his result shows that selection for the recombination of the CRISPR locus co-selected for recombination in the ermAM locus independen tly of Cas9 cleavage of the genome, suggesting that a subpopulation of cells is more prone to transformation and/or recombination. Transformation of the CRISPR: : ermAM (stop) construct followed by kanamycin selection resulted in an increase of the fraction of erythromycin-resistant, edited cells to 99 % (Figure 26c). To determine if this increase is caused by the killing of non-edited cells, Applicants compared the kanamycin- resistant colony forming units (cfu) obtained after co-transformation of JEN53 cells with the CRISPR: :ermAM(stop) or CRISPR: :0 constructs.
[00312] Applicants counted 5.3 times less kanamycin-resistant colonies after transformation of the crmAM(stop) construct (2.5x l04/4.7¾103, Figure 35a), a result that suggests that indeed targeting of a chromosomal locus by Cas9 leads to the killing of non-edited cells. Finally, because the introduction of dsDNA breaks in the bacterial chromosome is known to trigger repair mechanisms that increase the rate of recombi ation of the damaged DNA, Applicants investigated whether cleavage by Cas9 induces recombination of the editing template. Applicants counted 2.2 times more colonies after co -transformation with the CRISPR: :erm(stop) construct than with the CRISPR: :0 construct (Figure 26d), indicating that there was a modest induction of recombination. Taken together, these results showed that co-selection of transformable cells, induction of recombination by Cas9-mcdiated cleavage and selection against non-edited ceils, each contributed to the high efficiency of genome editing in S, pneumoniae,
[00313] As cleavage of the genome by Cas9 should kill non-edited cells, one would not expect to recover any ceils that received the kanamycin resistance-containing Cas9 cassette but not the editing template. However, in the absence of the editing template Applicants recovered many kanamycin-resistant colonies after transformation of the CRISPR: :ermAM(stop) construct (Figure 35a). These cells that 'escape' CRISPR-ind uced death produced a background that determined a limit of the method. This background frequency may be calculated as the ratio of CRISPR: :ermAM(stop)/CRISPR : :0 cfu, 2.6* 10"3 (7.J xl0V2.7xl04) in this experiment, meaning that if the recombination frequency of the editing template is less than this value, CRISPR selection may not efficiently recover the desired mutants above the background. To understand the origin of these cel ls, Applicants genotyped 8 background colonies and found that 7 contained deletions of the targeting spacer (Figure 35b) and one harbored a presumably inactivating mutation in Cas9 (Figure 35c).
0Θ314] Gesiome editing with Cas9 in E. colt The activation of Cas9 targeting through the chromosomal integration of a CR ISPR-Cas system is only possible in organisms that are highly recombino genie. To develop a more general method that is applicable to other microbes, Applicants decided to perform genome editing in E, coli using a plasmid-based CRISPR-Cas system. Two plasmids were constructed: a pCas9 plasmid carrying the tracrRNA, Cas9 and a chloramphenicol resistance cassette (Figure 36), and a pCRISPR kanamycin-resistant plasmid carrying the array of CRISPR spacers. To measure the efficiency of editing independently of CRISPR selection. Applicants sought to introduce an A to C transversion in the rpsL gene that confers streptomycin resistance. Applicants constructed a pCRlSPR::rpsL plasmid harboring a spacer that would guide Cas9 cleavage of the wild-type, but not the mutant rpsL allele (Figure 27b). The pCas9 plasmid was first introduced into E. coli MG 1655 and the resulting strain was co-transformed with the pCRISPR::rpsL plasmid and W542, an editing oligonucleotide containing the A to C mutation, streptomycin-resistant colonies after transformation of the pCR!SPR::rpsL plasmid were only recovered, suggesting that Cas9 cleavage induces recombination of the oligonucleotide (Figure 37). However, the number of streptomycin-resistant colonies was two orders of magnitude lower than the number of kanamycin-resistant colonies, which are presumably cells that escape cleavage by Cas9. Therefore, in these conditions, cleavage by Cas9 facilitated the introduction of the mutation, but with an efficiency that was not enough to select the mutant cells above the background of 'escapers'.
[00315] To improve the efficiency of genome editing in E. coli, Applicants applied their CRISPR system with recombineering. using Cas9-induced cell death to select for the desired mutations. The pCas9 plasmid was introduced into the recombineering strain H E63 (31), which contains the Gam, Exo and Beta functions of the Cli-red phage. The resulting strain was co- transformed with the pCRISPR::rpsL plasmid (or a pCRISPR::0 control) and the W542 oligonucleotide (Figure 27a). The recombineering efficiency was 5.3 x 10°, calculated as the fraction of total cells thai become streptomycin-resistant when the control plasmid was used (Figure 27c). In contrast, transformation with the pCRJSPR::rpsL plasmid increased the percentage of mutant ceils to 65 ± 14 % (Figures 27c and 29f). Applicants observed that the number of cfu was reduced by about three orders of magnitude after transformation of the pCRISPR::rpsL plasmid than the control plasmid (4, 8x 1075.3x lQ2, Figure 38a), suggesting that selection results from CRISPR-induced death of non-edited cells. To measure the rate at which Cas9 cleavage was inactivated, an important parameter of Applicants' method. Applicants transformed cells with either pCRISPR::rpsL or the control plasmid without the W542 editing oligonucleotide (Figure 38a). This background of CRISPR 'escapers', measured as the ratio of pCRISPR: :rpsL/pCR!SPR: :0 cfu, was 2.5x 1 G"4 (1.2xl02/4.8xl05). Genotyping eight of these escapers revealed that in all cases there was a deletion of the targeting spacer (Figure 38b). This background was higher than the recombineering efficiency of the rpsL mutation, 5.3x 10°, which suggested that to obtain 65% of edited cells, Cas9 cleavage must induce oligonucleotide recombination. To confirm this. Applicants compared the number of kanamycin- and streptomycin-resistant cfu after transformation of pCRISPR::rpsL or pCRISPR::0 (Figure 27d). As in the case for S. pneumoniae. Applicants observed a modest induction of recombination, about 6.7 fold ( 2.0 10 1 10 5). Taken together, these results indicated that the CRISPR system provided a method for selecting mutations introduced by recombineering.
[00316] Applicants showed that CRISPR-Cas systems may be used for targeted genome editing in bacteria by the co-introduction of a targeting constmct that killed wild-type cells and an editing template that both eliminated CRISPR cleavage and introduced the desired mutations. Different types of mutations (insertions, deletions or sear-less single-nucleoiide substitutions) may be generated. Multiple mutations may be introduced at the same time. The specificity and versatility of editing using the CRISPR system relied on several unique properties of the Cas9 endonuclease: (i) its target specificity may be programmed with a small RNA, without the need for enzyme engineering, (ii) target specificity was very high, determined by a 20 bp RNA-DNA interaction with low probability of no -target recognition, (iii) almost any sequence may be targeted, the only requirement being the presence of an adjacent NGG sequence, (iv) almost any mutation in the NGG sequence, as well as mutations in the seed sequence of the protospacer, eliminates targeting.
[00317] Applicants showed that genome engineering using the CRISPR system worked not only in highly recombinogenic bacteria such as S. pneumoniae, but also in E, coli. Results in E. coli suggested that the method may be applicable to other microorganisms for which plasmids may be introduced. In E. coli, the approach complements recombineering of mutagenic oligonucleotides. To use this methodology in microbes where recombineering is not a possible, the host homologous recombination machinery may be used by providing the editing template on a plasmid. In addition, because accumulated evidence indicates that CRJS PR-mediated cleavage of the chromosome leads to cell death in many bacteria and arehaca , it is possible to envision the use of endogenous CRISPR-Cas systems for editing purposes.
[00318] In both S. pneumoniae and E. coli, Applicants observed that although editing was facilitated by a co-selection of transformable cells and a small induction of recombination at the target site by Cas9 cleavage, the mechanism that contributed the most to editing was the selection against no -edited ceils. Therefore the major limitatio of the method was the presence of a background of cells that escape CRISPR-induced cell death and lack the desired mutation. Applicants showed that these 'escapers' arose primarily through the deletion of the targeting spacer, presumably after the recombination of the repeat sequences that flank the targeting spacer. Future improvements may focus on the engineering of flanking sequences that can still support the biogenesis of functional crRNAs but that are sufficiently different from one another to eliminate recombination. Alternatively, the direct transformation of chimeric crRNAs may be explored. In the particular case of E. coli, the constructio of the CRISPR-Cas system was not possible if this organism was also used as a cloning host. Applicants solved this issue by placing Cas9 and the tracrRNA on a different plasmid than the CR1SPR array. The engineering of an inducible system may also circumvent this limitation.
[003191 Although new DNA synthesis technologies provide the ability to cost-effectively create any sequence with a high throughput, it remains a challenge to integrate synthetic DNA in living cells to create functional genomes. Recently, the co-selection M AGE strategy was shown to improve the mutation efficiency of recombineering by selecting a subpopulation of cells that has an increased probability to achieve recombination at or around a given locus. In this method, the introduction of selectable mutations is used to increase the chances of ge erating earby non- selectable mutations. As opposed to the indirect selection provided by this strategy, the use of the CRISPR system makes it possible to directly select for the desired mutation and to recover it with a high efficiency. These technologies add to the toolbox of genetic engineers, and together with DNA synthesis, they may substantially advance both the ability to decipher gene function and to manipulate organisms for biotechnological purposes. Two other studies also relate to CRISPR-assisted engineering of mammalian genomes, it is expected that these crRNA-directed genome editing technologies may be broadly useful in the basic and medical sciences.
[00320J Strains and culture conditions. S. pneumoniae strain R6 was provided by Dr. Alexander Tomasz. Strain crR6 was generated in a previous study. Liquid cultures of S. pneumoniae were grown in THYE medium (30g/l Todd-Hewitt agar, 5 g/1 yeast extract). Cells were plated on tryptic soy agar (TSA) supplemented with 5 % defibrinated sheep blood. When appropriate, antibiotics were added as followings: kanamycin (400 ug/ml), chloramphenicol (5 erythromycin (1 μg/mϊ) streptomycin (100 .g/ml) or spectinomycin (100 uu rn! ). Measurements of β-galactosidase activity were made using the Miller assay as previously described.
[00321] E, coli strai s MG1655 and HME63 (derived from MG1655, A(argF-lac) U169 λ cI857 Acro-bioA galK tyr 145 UAG mutS<>amp) (31) were provided by Jeff Roberts and Donald Court, respectively. Liquid cultures of E. coli were grown in LB medium (Difco). When appropriate, antibiotics were added as followings: chloramphenicol (25 μ-g/ml), kanamycin (25 §/ηιί) and streptomycin (50 μ^'πιΓ).
[00322] S. pneumoniae transformation. Competent cells were prepared as described previously (23). For all genome editing transformations, cells were gently thawed on ice and resuspended in 10 volumes of M2 medium supplemented with 100 ng/ml of competence- stimulating peptide CSP1(40), and followed by addition of editing constmcts (editing constructs were added to cells at a final concentration between 0.7 ng/μί to 2.5 p,g/ul). Cells were incubated 20 min at 37 °C before the addition of 2 μΐ of targeting constmcts and then incubated 40 min at 37 °C. Serial dilutions of cells were plated on the appropriate medium to determine the colony forming units (efu) count.
[00323] E, coli Lambda-red reeonifoiiieering. Strain HME63 was used for ail recombineermg experiments. Recombineering cells were prepared and handled according to a previously published protocol (6). Briefly, a 2 ml overnight culture (LB medium) inoculated from a single colony obtained from a plate was grown at 30 °C. The overnight culture was diluted 100-fold and grown at 30 °C with shaking (200rpm) until the ODeoo is from 0.4-0.5 (approximately 3 hrs). For Lambda-red induction, the culture was transferred to a 42 °C water bath to shake at 200rpm for 15 min. Immediately after induction, the culture was swirled in an ice- water slurry and chilled on ice for 5-10 min. Ceils were then washed and aliquoted according to the protocol. For electro-transformation, 50 μ! of cells were mixed with ImM of salt-free oligos (IDT) or 100-150 ng of piasmid DNA (prepared by QIAprep Spin Miniprep Kit, Qiagen). Cel ls were electroporated using 1mm Gene Puiser cuvette (Bio-rad) at 1.8kV and were immediately resuspended in 1 ml of room temperature LB medium. Cells were recovered at 30 °C for 1-2 hrs before being plated on LB agar with appropriate antibiotic resistance and incubated at 32 °C overnight.
[00324] Preparation of S. pneumoniae genomic DNA. For transformation purposes, S. pneumoniae genomic DNA was extracted using the Wizard Genomic DNA Purification Kit, following instructions provided by the manufacturer (Promega). For genotyping purposes, 700ul of overnight S. pneumoniae cultures were pelleted, resuspended in 60ul of lysozyme solution (2mg/ml) and incubated 30min at 37°C. The genomic DNA was extracted using QIAprep Spin Miniprep Kit (Qiagen).
[003251 Strain construction. All primers used in this study are provided in Table G. To generate S. pneumoniae crR6M, an intermediate strain, LAM226, was made. In this strain the aphA-3 gene (providing kanamycin resistance) adjacent to the CRISPR array of S. pneumoniae crR6 strain was replaced by a cat gene (providing chloramphenicol resistance). Briefly, crR6 genomic DNA was amplified using primers L448/L444 and L447/L481, respectively. The cat gene was amplified from piasmid pC194 using primers L445/L446. Each PGR product was gel- purified and all three were fused by SOEing PGR with primers L448/L481. The resulting PGR product was transformed into competent S, pneumoniae crR6 cells and chloramphenicol -resistant transformants were selected. To generate S. pneumoniae crR6M, S. pneumoniae crR6 genomic DNA was amplified by PGR using primers L409/L488 and L448/L481, respectively. Each PGR product was gel -purified and they were fused by SOEing PGR with primers L409/L481 . The resulting PGR product was transformed into competent S. pneumoniae LAM226 cells and kanamycm-resistant transformants were selected,
[00326] To generate S. pneumoniae crR6Rc, S. pneumoniae crR6M genomic DNA was amplified by PGR using primers L430/W286, and S. pneumoniae LA 226 genomic DNA was amplified by PGR using primers W288/L481. Each PGR product was gel-purified and they were fused by SOEing PGR. with primers L43Q/L481. The resulting PGR product was transformed into competent S. pneumoniae crR6M cells and chloramphenicol-resistant transformants were selected.
[00327] To generate S. pneumoniae crR6Rk, S. pneumoniae crR6M genomic DNA was amplified by PGR using primers L430/W286 and W287/L481, respectively. Each PGR product was gel-purified and they were fused by SOEing PGR with primers L430/L481. The resulting PGR product was transformed into competent S. pneumoniae crR6Re ceils and kanamyein- resistant transformants were selected.
[00328] To generate JEN37, S. pneumoniae crR6Rk genomic DNA was amplified by PGR using primers L430/W356 and W357/L481 , respectively. Each PGR product was gel-purified and they were fused by SOEing PGR with primers L430/L481. The resulting PGR. product was transformed into competent S. pneumoniae crR6Rc cells and kanamyc in-resistant transformants were selected.
[00329] To generate JEN38, R6 genomic DNA was amplified using primers L422/L461 and L459/L426, respectively. The ermAM gene (specifying erythromycin resistance) was amplified from plasmid pFW 15 43 using primers L457/L458. Each PGR product was gel-purified and ail three were fused by SOEing PGR with primers L422/L426, The resulting PGR. product was transformed into competent S. pneumoniae crR6Rc cells and erythromycin-resistant transformants were selected. [00330] S. pneumoniae JEN 53 was generated in two steps. First JE 43 was constructed as illustrated in Figure 33. JEN53 was generated by transforming genomic DNA of JEN25 into competent JEN43 cells and selecting on both chloramphenicol and erythromycin.
[00331] To generate S. pneumoniae JEN62, S, pneumoniae crR.6Rk genomic DNA was amplified by PGR using primers W256/W365 and W366/L403, respectively. Each PGR product was purified and ligated by Gibson assembly. The assembly product was transformed into competent S. pneumoniae crR6Rc cells and kanamycin-resistant transformants were selected.
[00332] Plasmid construction. pDB97 was constructed through phosphorylation and annealing of oligonucleotides B296/B297, followed by ligation in pLZ12spec digested by EcoRI/BamHI. Applicants fully sequenced pLZ12spec and deposited its sequence in genebank (accession: C1 12384).
[ 00333] pDB98 was obtained after cloning the CRJSPR leader sequence was cloned together with a repeat-spacer-repeat unit into pLZ12spec. This was achieved through amplification of crR6Rc DNA with primers B298/B320 and B299/B321 , followed by SOEing PGR of both products and cloning in pLZ12spec with restriction sites BamHI/EcoRI. In this way the spacer sequence in pDB98 was engineered to contain two Bsal restriction sites in opposite directions that allow for the scar-less cloning of new spacers.
[00334] pDB99 to pDBlQS were constructed by annealing of oligonucleotides B300/B301 (pDB99), B302/B303 (pDBlOO), B304/B305 (pDB lOl), B306/B307 (pDB102), B308/B309 (pDB103), B310/B311 (pDB104), B312/B313 (pDB105), B314/B315 (pDB106), B315/B317 (pDB107), B318/B319 (pDB108), followed by ligation in pDB98 cut by Bsal.
[00335] The pCas9 plasmid was constructed as follow. Essential CRISPR elements were amplified from Streptococcos pyogenes SF370 genomic DNA with flanking homology arms for Gibson Assembly. The tracrRNA and Cas9 were amplified with oiigos HC008 and HC010. The leader and CRISPR sequences were amplified HCOl 1/HC014 and HC015/HC009, so that two Bsal type IIS sites were introduced in between two direct repeats to facilitate easy insertion of spacers.
[00336] pCRISPR was constructed by subcloning the pCas9 CRISPR array in pZE21-MCSl through amplification with oiigos B298+B299 and restriction with EcoRI and BamHI. The rpsL targeting spacer was cloned by annealing of oiigos B352+B353 and cloning in the Bsal cut pCRISPR giving pCRISPR::rpsL. [00337] Gesieratiosi of targetlsig and editing constructs. Targeting constructs used for genome editing were made by Gibson assembly of Left PCRs and Right PCRs (Table G). Editing constructs were made by SOEing PGR fusing PGR products A (PGR A), PGR products B (PGR B) and PGR products C (PGR C) when applicable (Table G). The CRISPR::0 and CRISP R: :ermAM(stop) targeting constructs were generated by PGR amplification of JEN62 and crR6 genomic DNA respectively, with oiigos L409 and L481.
[00338] Generation of targets with randomized PAM or protospacer sequences. The 5 nucleotides following the spacer 1 target were randomized through amplification of R68'l32' > genomic DNA with primers W377/ L426. This PGR product was then assembled with the cat gene and the srtA upstream region that were amplified from the same template with primers L422/W376. 80 ng of the assembled DN A was used to transform strains R6 and crR.6. Samples for the randomized targets were prepared using the following primers: B280-B290/L426 to randomize bases I -10 of the target and B269-B278/L426 to randomize bases 10-20, Primers L422/B268 and L422/B279 were used to amplify the cat gene and srtA upstream region to be assembled with the first and last 10 PGR products respectively. The assembled constructs were pooled together and 30 ng was transformed in R6 and crR6. After transformation, cells were plated on chloramphenicol selection. For each sample more than 2x 10" cells were pooled together in I ml of THYE and genomic DNA was extracted with the Promega Wizard kit. Primers B250/B251 were used to amplify the target region. PGR products were tagged and run on one Illumina MiSeq paired-end lane using 300 cycles.
[00339] Analysis of deep sequencin data,
[00340] Randomized PAM: For the randomized PAM experiment 3,429,406 reads were obtained for crR6 and 3,253,998 for R6. It is expected that only half of them will correspond to the PAM-target while the other half will sequence the other end of the PGR product. 1,623,008 of the crR6 reads and 1,537,131 of the R6 reads carried an error-free target sequence. The occurrence of each possible PAM among these reads is shown in supplementary file. To estimate the functionality of a PAM, its relative proportion in the crR6 sample over the R6 sample was computed and is denoted rjjk!m where I,j,k,l,m are one of the 4 possible bases. The following statistical model was constructed:
[00341] log(ryklffi) = μ + b2, + b3j + b4k + b2b3y+ b3b4,k · ;,,kl!l. [00342] where ε is the residual error, b2 is the effect of the 2m base of the PAM, b3 of the third, b4 of the fourth, b2b3 is the interaction between the second and third bases, b3b4 between the third and fourth bases. An analysis of variance was performed:
[00343] Anova table
Figure imgf000122_0001
[00344] When added to this model, hi or b5 do not appear to be significant and other interactions than the ones included can also be discarded. The model choice was made through successive comparisons of more or less complete models using the anova method in R. Tukey's honest significa ce test was used to determine if pairwise differences between effects are significant.
[00345] NGGNN patterns are significantly different from ail other patterns and cany the strongest effect (see table below).
[00346] In order to show that positions 1 , 4 or 5 do not affect the NGGNN pattern Applicants looked at theses sequences only. Their effect appears to be normally distributed (see QQ plot in Figure 71), and model comparisons using the anova method in R shows that the null model is the best one, i.e. there is no significant role of b1 , b4 and b5.
[00347] Model coiTipanson usmu the anm u met hod in R for the XGGN X sequences
Figure imgf000122_0002
[00348] Partial interference of NAGNN and NNGGN patterns
[00349] NAGNN patterns are significantly different from all other patterns but cany a much smaller effect than NGGNN (see Tukey's ho est significance test below). [00350] Finally, NTGGN and NCGGN patterns are similar and show significantly more CRISPR interference than NTGHN and NCGHN patterns (where H is A,T or C), as shown by a bonferroni adjusted pairwise student-test.
[00351] P rwise„c^
pooled SD
Figure imgf000123_0001
[003521 Taken together, these results allow concluding that NNGGN patterns in general produce either a complete interference in the case of NGGGN, or a partial interference in the case of NAGGN, NTGGN or NCGGN.
[00353] Tukey multiple comparisons of means: 95% family-wise confidence level
Figure imgf000124_0001
G G -Ar A _ -:■ 7 £475 .94075 - 53375 1S -07
5 G -C ; A 7 §911 .97511 62311 1E -07
G G -T :A -2.7809 - 2.9569 .6049 1E -07
3 G -A: 81643 .9S244 64043 1E -07
S G -C : C 77903 _ .95504 60303 1E -07
G G -Gr : _ -:■ 643- 67 .62468 - 47267 1S -07
G G -Tr _ 79713 -2 .97319 - 62113 1S -07
G G -A ; G 67068 _ , 84668 49 63 1E -07
G G -C ; G 73525 _ ,91125 55925 1E -07
S G -T:G -I .7976 _ . 2159 ·- 9736 1E -07
3 G -A; 76 2^ .59127 94326 <1E -07
G G -Cr 84114 .66513 -3, 01714 1S -07
G G -G:: .■ * 76 09 .588 OS 94003 1E -07
G G -I: ; 7€7 SI _ ,5:9161 94361 <1E -07
G G -G ϊ A 13964 _ ,31565 -1 , 96364 1E -07
3 -A; A -0 , 62511 -G .80111 -c .,4491 <1E -07
:; Ά- -C ; A. -0. 6594? -0 .83547 48346 1S -07
G :; Ά- -T : A. -0. 64126 -0 ,465 -0. S ? 26 1S -07
G : A -A;C -ΰ , 67679 -0 ,50670 -6. 35279 1E -07
-r : A~ -G ; C 63939 -0 ,46339 -6. 31539 .'IE -07
G; A- -G : C -G■ 50303 -0 .33363 -0. 6S5D3 <1E -07
G; A- -I : £ -G , 65754 -0 .46154 -0. 63354 <1E -07
:; A- -A; G -0. S31Q4 -0 .35503 -6. 70704 1S -07
G:; ¾- -C't -0. 59561 - 3..4196 -ϋ. 77161 1S -07
G:; ¾- -T ; G -0. 65795 -0 . 3195 -0. S3396 1S -07
-r : -A; T -0 , 62763 -0 ,45163 -6. 30363 1E -07
G : A~ -C ; T -0 , 701 3 -0 ,52549 -0 .8775 .: IE -07
G- .; A- - : T -G , 62445 -0 .44344 -0. 60045 <1E -07
G; A- - ; T -G . 62617 -0 .45216 -0 , 60417 <1E -07
Sb3:b4
Figure imgf000124_0002
G;G-G.;A -0,33532 -0.51133 -0.15332 lE-07
G:G-G;C -0,18113 -0.35719 -0.00513 0.036087
G:G-G:: -0,31626 -0.14026 -0,49226 lE-07
[00354] Randomized target
0Θ355] For the randomized target experiment 540,726 reads were obtained for crR.6 and 753,570 for R6. As before, only half of the reads are expected to sequence the interesting end of the PGR product. After filtering for reads that cany a target that is error-free or with a single point mutation, 217,656 and 353, 141 reads remained for crR6 and R6 respectively. The relative proportion of each mutant in the crR.6 sample over the R6 sample was computed (Figure 24c). Ail mutations outside of the seed sequence (13-20 bases away from the PAM) show full interference. Those sequences were used as a reference to determine if other mutations inside the seed sequence can be said to significantly disrupt interference. A normal distribution was fitted to theses sequences using the fitdistr function of the MASS R package. The 0.99 quantile of the fitted distribution is shown as a dotted line in Figure 24c. Figure 72 shows a histogram of the data density with fitted normal distribution (black line) and .99 quantile (dotted line).
[00356] Table F. Relative abundance of PAM sequences in the crR6/R6 samples averaged over bases 1 and 5.
Figure imgf000125_0001
10357] Table G. Primers used in this study.
B21? TCCr¾5C£55ST TC SAT¾IT¾CT?iTCa G TXT¾GAS T¾IGi:TGTTTT3&
B2IS GXGACAGXAAXAT-7¾GA^TCC?GC?AGGAGTX
SSGXITCA^GICTXTGXAGCAASAG
B S GCCAATGAACGGGAACCCXXGGXC
B25S
3251 SiiSiSiTTairTS CTCArAXTT CT
B: :
3257
B25S CIXACGGT£C¾rAA¾GT A¾TITf C
B2SS TSGCT GAiTTCAGCCSXT-GC
B27S TirGA GAGGCA TG5C SSAAXCGAGCCAAS¾AAGC5;:AAG
BJ 1 CXITGAC A ^TG TGAA¾:ICGA5CCSAAS¾SSC CA¾G
B272 CTIT £CG¾GG ¾ATG CI J^T:: AGCCa¾Ji¾SAS Ck¾G sin I r C G C A G5CI5aAATC5A CC¾¾S¾¾;i-C5': ¾G
B274 CTTrG CGAGGCAG¾TQGC GAAATCGAGC AJ^ASiiCG A¾
CXirGAGGAGGCAAXGGCTGSAAXCGAGCCAAAAAAGHGCASG
CTTXGACGAGGCS¾?GGCTSAA¾^
32Ί7 CTTTGiC iS CJ^TG C GAJ^
Bin
B27S SCGCTTXXTTGSCXCGAXTTCAG
B2SS C ¾T" G:CIG? ¾¾TC5¾GCi¾ii?¾iiS.GCSC->.SGAi¾SSi¾.¾T!!
s:n
CAAr SCTSAAaTCGAGC AJ^ASGCG A¾ iiAGAAS.TC
B2S1 CS ATG GC I GAS ¾ "AGCC AS AA» SGCGC a a &K ¾ ¾TG
3284
B2S5
B iS
B2S? C&Ar SCTSAAaTCSAGC AJ^ASGCGCAa AAGAASTCfJiC
B2SS C* ATGGv T GASJ-TCGAGCC AS ¾A~ ¾GCGG a ¾Ga ¾GA~ %i?C&&CC
329* C a GCTGS¾AXCGA CCA ?¾ A CG;:AA!G&AGAAATCK¾CC¾ -C:
B « W a Si'C TCC AXC CGXACAACCCa CAACCGTG¾
ast-; cCAGS5T T TS G IG aC GATG Ag
B29S S GGAXCC T¾XTTCXTgA~aACXAAA¾ A X¾XGG
ATGAAX^CAACTiAACAAGTCX &GTGTGCTG
Βϊΰδ AA¾CAI'XTI'XTGXCCAXTXAGG¾AA¾AGi;ATGCTG
AAARCAGCAXCGXXTXXCGXAAaXGGAGSAAAAAX 3302 Jk½ Cir»iWtTC&^C&C3^TA5CaS^3U6J^X 5
B303
B304 JUkS^TrrT &TC& & SSC &iiT rG TlTSXTTS
BiOS AASACSJUir^A CaSS^T GXCGT TGaXGAASA
Β30ϊ> s.¾a xcs c aGA.aGXTsxc5 &AaaG¾sji,TCG65
BSS?
BiOS AAaCAAICrCT CaiiGGIT CCTTA&A^TCTCTG
Aa^ca aGA r xTas- GSAacc T GaGSGax
B3SS> a Aft CCS SXC S " SCTS S TTS&GTS
BJil AA&¾cac ck¾s :a:i&5 T i: TCCTsa QSXQG
Bii2 AajiC rCTC AraCTTS^TG¾AS.XXrc TTGXaxG
BiI3 a¾Aacar .cAa¾ a¾TTXc axaaGT xA5aGar
B314 S.RACTAGCrGIGS/r G CCG &aaC aG T -;
BJi5 AAA¾CQ¾¾GSCT5 TTTIG 5 ¾CI&TGSCaG:CTS
BiiS AA¾C arc GS.SAGGXC SSGC SJy--¾ATX¾TCX?XXG
B3I7
B31S
Βί··?
Βί_δ
B321 ia¾^&cc^T c^GJU¾^T ai^55T xc^xTTi^as T& i TSTrTT«
BJ52
BM3 5.<t5c &¾Aasi ¾; CGaacTCCGCscxscGTa ¾ASXA
HCSiiS SP
:SP
SP XTa¾ Aa¾raiTCTTc rcT£AAaxATacTTca5rcA:c:cTC Ta5CT5ac
HCGi 1 SP Ari arXTSA rCAGCXA'GGAGSX CXGSJiGXS^aTXTX& XGaaG
HC0L4 P XXTTXGTC
GAGACC;¾GXCXCGG¾¾GCTC:A^
HCG35 s? AG&CXXG
L 3¾ ST55 IAARICS GA SACS T C&AS SSi-S
L42.2 X cor e «ca
L 2≤ aaGc &aAs xTG a acc
GXAGCIT&XIC¾STCCX&GXG5
L44 GTiT rxGAaci axG GX5f &aa T c aa cr c~ cTQa ?
L4 5
L4 <S G&XATXSTSGASGCTaXTTXTGXGGSXTTXXASGCaX¾aajiCTATaXG c.£iaxAGXTTX¾TGCCTaa¾a^
Figure imgf000127_0001
L45?
L 5S CACCSGTGATCA TSQ C TASG L4£S
L S · rTCAA&ITrrC A TSitTI CC
hm CCaiAITT TAGXTATTAAG&AaTAAXACC&GCCATCAGXCACCTCC
S T TGSSACCATTCASAACSQ^^^
W Sf
^S r i Tr T caTC&rcsi
327
J4I
Wi54 GXTrXICafiAaXCTGCG XTGCG
&RJ:i&XXG¾i&S¾k GQTGG¾aA aC
55S ArT CG AASCG5 A CGGT X X TTAA 5X X GG5ACCa T iliAa5CA5C
irTAAaAGa^CCGAX&CCGTTX¾CS&A£XG TT £G¾GCTATGCTGTIXI5A MS
Figure imgf000128_0001
370 STTCCT ¾& CAaAACGGXaXC5 T7XC rXT¾£AT C
wm Ga&AC GAX¾CCGTTTXGGXTTSAGS&ACaGGT&A£GGGC¾:TTXAS.C
CGAXXXCaGC AXTSCCTCSTC
Figure imgf000128_0002
m IccGxacAacccacAS.ccc.GC±AGTGAGCG? > "XGGGSCCA > xcaa¾ACSGC
win CT ¾ "& a G5 XG G ?TT5 A -;GAG XT aG&GCTaXGCXG~rX'TGa
ws XXGTXSCCACTCXT XTCTTXC
CAGSSXXGTCGGTXGTTGCGSXGSaGTIAACXCC ATCXCC
GC AGi' AacTcCA CGCaacAacccacaacc ~Gcx¾GXG
¾;40;: SXG5XAX XATCGTGS GXG¾i
4S4 XXACCSA&S GGA&XXTSXCTGC
40S AA&GCTS.SAG TTCCSC&&TT5S
¾r4il GTSGGXXGX¾CGGA GAGXXAaCTCCCaXC CXTC
4¾ SBT5GGAG aS.CTCAATCC5 A a¾ CCA aACCC 5
433
4J4 STGGTCaarTGGTSCTG AAXAGSXGAaGCXAATGGTSATS
W«3 CrGATTTGX¾ira¾:TTXIGaGACSX~aXGCXTC¾.C XXC
464
46S STT TGSGACCATTCAaG^CSGCa A XC AAAGC G CA TaATaiCAG
¾r4 J GTXXT&GAGCIAXGCTGXTXXGaSXGGXCCCAa¾ACGC -C¾GX GCa GIXG
S42 Ar¾CTTXA SCaGCGCGGaGXTCGGTXXTgXAGGAGXGGX¾G~&XaX¾:CA GA5TACaX 0358] Table H. Design of targeting and editing constmcts used in this study. Targeting Constructs
Edition Template DNA Left PCR Right PCR Spacer sequence PAM bgaA R>A crR6Rk W256/W39 I W392/L403 GCTCACTAGCAGGGTTGTGGGTTGTACGGA TGG bgaA NE>AA crR6Rk W256/W39 I W392/L403 GCTCACTAGCAGGGTTGTGGGTTGTACGGA TGG
AbgaA crR6Rk W256/W39I W392/L403 GCTCACTAGCAGGGTTGTGGGTTGTACGGA TGG
AsrtA crR6Rc W256/B218 B217/L403 TCCTAGCAGGATTTCTGATATTACTGTCAC TGG ermB Stop crR6Rk W256/W356 W357/L403 TTTAAAAGAAACCGATACCGTTTACGAAAT TGG
AsrtA AbgaA JEN51 (for Left PCR) and W256/W465 W466/W403 same as the ones used for AsrtA and AbgaA TGG
JEN52 (for Right PCR)
Editing Constructs
Name of Primers used to resulting verify edited
Edition Template DNA PCR A PCR B PCR C SOEing PCR strains genotype bgaA R>A R6 W403 W397 W398/W404 N/A W403/W404 JEN56 W403/W404 bgaA NE>AA R6 W403 W43I W432/W433 W434 W404 W403/W404 JEN60 403AV404
AbgaA R6 B255/B256 B257 B258 N/A B255/B258 JEN52 W393/W405
AsrtA R6 B230/W463 W464/B229 N/A B230 B229 JEN51 W422/W426 ermB Stop JEN38 L422/W370 W371/L426 N/A L422/L426 JEN43 L457/L458
AsrtA AbgaA same as the ones used for AsrtA and AbgaA JEN64 same as the ones used for AsrtA and AbgaA
SUBSTITUTE SHEET (RULE 26) Example 6: Optimization of the guide RNA for Streptococcus pyogenes Cas9 (referred to as SpCas ).
[00359] Applicants mutated the traerRNA and direct repeat sequences, or mutated the chimeric guide RNA to enhance the RNAs in cells.
[00360] The optimization is based on the observation that there were stretches of thymines (Ts) in the traerRNA and guide RNA, which might lead to early transcription termination by the pol 3 promoter. Therefore Applicants generated the following optimized sequences. Optimized traerRNA and corresponding optimized direct repeat are presented in pairs.
[00361] Optimized traerRNA 1 (mutation underlined):
[00362] GGAACCATTCAtAACAGCATAGCAAGTTAtAATAAGGCTAGTCCGTTATCA
ACTTGAA AA AGTGG C ACCG AGTCG GTGCTTTTT
[00363 S Optimized direct repeat 1 (mutation underlined):
[00364] GTTaTAGAGCTATGCTGTTaTGAATGGTCCCAAAAC
[00365] Optimized traerRNA 2 (mutation "underlined):
[00366] GGAACCATTCAAtACAGCATAGCAAGTTAAtATAAGGCTAGTCCGTTATCA
ACTTGAAAAAGTGGCACCGAGTCGGTGCTTTTT
[00367] Optimized direct repeat 2 (mutation underlined):
[00368] GTaTTAGAGCTATGCTGTaTTGAATGGTCCCAAAAC
[00369] Applicants also optimized the chimeric guideRNA for optimal activity in eukaryotic cells.
[00370] Original guide RNA:
[00371] NmmmmmTNNNNNNNNNGTTTTAGAGCTAGAAATAGCAAGTTAAAA TAAGGCTAGl X i ATCAA(TrTGAAAAAGTGGCA( GAGTCGGTGCTTTTTTT
[00372] Optimized chimeric guide RNA sequence 1 :
[00373] NNNNNNNNNNNNNNNNNNNNGTATTAGAGCTAGAAATA.GCAAGTTAATA TAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTTTTT
[00374] Optimized chimeric guide RNA sequence 2:
[00375] NNNNNNNNNNNNNNNNNNNNGTTTTAGAGCTATGCTCTTrTGGAAACAA AACAGCATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCAC
CGAGTCGGTGCTTTTTTT
[00376] Optimized chimeric guide RNA sequence 3: [00377] NNNNNNNNNNNNNNNNNNNNGTATTAGAGCTATGCTGTATTGGAAACAA TACAGCATAGCAAGTTAATATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACC
GAGTCGGTGC I ΓΠΊ I
[00378] Applicants showed that optimized chimeric guide RNA works better as indicated in Figure 3. The experiment was conducted by co-transfecting 293FT cells with Cas9 and a U6- guide RNA DNA cassette to express one of the four RNA forms shown above. The target of the guide RNA is the same target site in the human EmxT locus: "GTCACCTCCAATGACTAGGG" Example 7: Optimization of Streptococcus thertnophiles LMD-9 CRISPR1 Cas9 (referred to as StlCas ).
[00379] Applicants designed guide chimeric RNAs as shown in Figure 4.
[00380] The St! Cas9 guide RNAs can undergo the same type of optimization as for SpCas9 guide RNAs, by breaking the stretches of poly thymines (Ts)
Example 8: Cas9 diversity and mutations
[00381] The CR ISPR-Cas system is an adaptive immune mechanism against invading exogenous DNA employed by diverse species across bacteria and archaea. The type II CRISPR- Cas9 system consists of a set of genes encoding proteins responsible for the "acquisition" of foreign DNA into the CRJSPR locus, as well as a set of genes encoding the "execution" of the DNA cleavage mechanism; these include the DNA nuclease (Cas9), a non-coding transactivating cr-RNA (tracrRNA), and an array of foreign DNA-derived spacers flanked by direct repeats (crRNAs), Upon maturation by Cas9, the tracRNA and crRNA duplex guide the Cas9 nuclease to a target DNA sequence specified by the spacer guide sequences, and mediates double-stranded breaks in the DNA ear a short sequence motif in the target DNA that is required for cleavage and specific to each CRISPR-Cas system. The type II CR ISPR-Cas systems are found throughout the bacterial kingdom and highly diverse in in Cas9 protein sequence and size, tracrRNA and crRN A direct repeat sequence, genome organization of these elements, and the motif requirement for target cleavage. One species may have multiple distinct CRISPR-Cas systems.
[00382] Applicants evaluated 207 putative Cas9s from bacterial species identified based on sequence homology to known Cas9s and structures orthologous to known subdomains, including the HNH endonuclease domain and the RuvC endonuclease domains [information from the Eugene ooniii and Kira Makarova]. Phylogenetic analysis based o the protein sequence conservation of this set revealed five families of Cas9s, including three groups of large Cas9s (- 4QQ amino acids) and two of small Cas9s (~11Q0 amino acids) (Figures 39 and 40A-F),
[003831 In this example, Applicants show that the following mutations can convert SpCas9 into a nicking enzyme: DiQA, E762A, H840A, N854A, N863A, D986A.
[00384] Applicants provide sequences showing where the mutation points are located within the SpCas9 gene (Figure 41). Applicants also show that the nickases are still able to mediate homologous recombination (Assay indicated in Figure 2). Furthermore, Applicants show that SpCas9 with these mutations (individually) do not induce double strand break (Figure 47).
Example 9: Supplement to DNA targeting specificity of the RNA-guided Cas9 nuclease
[00385] Cell culture and transfection
[00386] Human embryonic kidney (HEK) cell line 293FT (Life Technologies) was maintained in Dulbeceo's modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (HyClone), 2mM GlutaMAX (Life Technologies), lOOU/mL penicillin, and lOO^ig/mL streptomycin at 37°C with 5% C02 incubation,
[00387] 293FT cells were seeded either onto 6-well plates, 24-well plates, or 96-well plates (Corning) 24 hours prior to transfection. Cells were transfected using Lipofectamine 2000 (Life Technologies) at 80-90% confluence following the manufacturer's recommended protocol. For each well of a 6-well plate, a total of 1 ug of Cas9+sgRNA plasmid was used. For each well of a 24-well plate, a total of 500ng Cas9+sgRNA plasmid was used unless otherwise indicated. For each well of a 96-well plate, 65 ng of Cas9 plasmid was used at a 1 : 1 molar ratio to the U6- sgRNA PC I product.
[00388] Human embryonic stem ceil line HUES9 (Harvard Stem Cell Institute core) was maintained in feeder-free conditions on GelTrex (Life Technologies) in mTesR medium (Stemcell Technologies) supplemented with lOOug/ml Normocin (InvivoGen). HUES9 cells were transfected with Amaxa P3 Primary Cell 4-D Nucleofector Kit (Lonza) following the manufacturer's protocol.
[00389] SURVEYOR nuclease assay for genome modification
[00390] 293 FT cells were transfected with plasmid DNA as described above. Cells were incubated at 37°C for 72 hours post-transfection prior to genomic DNA extraction. Genomic DNA was extracted using the Qui ckEx tract DNA Extraction Solution (Epicentre) following the manufacturer's protocol. Briefly, pelleted cells were resuspended in QuickExtraet solution and incubated at 65°C for 15 minutes and 98°C for 10 minutes.
[00391 S The genomic region flanking the CRISPR target site for each gene was PGR amplified (primers listed in Tables J and ), and products were purified using QiaQuick Spin Column (Qiagen) following the manufacturer's protocol. 4()0ng total of the purified PGR products were mixed with 2μ1 10X Taq DNA Polymerase PCR buffer (Enzymatics) and ultrapure water to a final volume of 20μ1, and subjected to a re-annealing process to enable heteroduplex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute. After re-annealing, products were treated with SURVEYOR nuclease and SURVEYOR enhancer S (Transgenomics) following the manufacturer's recommended protocol, and analyzed on 4-20% Novex TBE poly-acrylamide gels (Life Technologies). Gels were stained with SYBR Gold DNA stain (Life Technologies) for 30 minutes and imaged with a Gel Doc gel imaging system (Bio-rad). Quantification was based on relative band intensities.
[00392] Northern blot analysis of tracrRNA expression in human ceils
[003931 Northern blots were performed as previously described] . Briefly, RNAs were heated to 95°C for 5 min before loading on 8% denaturing polyaeryl amide gels (ScquaGei, National Diagnostics). Afterwards, RNA was transferred to a pre -hybridized Hybond N+ membrane (GE Healthcare) and crosslinked with Stratagene UV Crosslinker (Stratagene). Probes were labeled with [gamma-32P] ATP (Perkin Elmer) with T4 polynucleotide kinase (New England Biolabs). After washing, membrane was exposed to phosphor screen for one hour and scanned with phosphorimager (Typhoon).
[00394] Bisulfite sequencing to assess DNA methylation status
[00395] HE 293FT ceils were transfected with Cas9 as described above. Genomic DNA was isolated with the DNeasy Blood & Tissue Kit (Qiagen) and bisulfite converted with EZ DNA Methylation -Lightning Kit (Zymo Research). Bisulfite PGR was conducted using KAPA2G Robust HotStart DNA Polymerase (KAPA Biosystems) with primers designed using the Bisulfite Primer Seeker (Zymo Research, Tables J and K). Resulting PCR amplicons were gel- purified, digested with EcoRI and Hindlll, and ligated into a pUC19 backbone prior to transformation. Individual clones were then Sanger sequenced to assess DNA methylation status.
[00396J In vitro transcription and cleavage assay [00397] HE 293FT cells were transfected with Cas9 as described above. Whole cell lysates were then prepared with a lysis buffer (20 mM HEPES, 100 mM KCi, 5 mM MgC12, 1 mM DTT, 5% glycerol, 0.1% Triton X-100) supplemented with Protease Inhibitor Cocktail (Roche). T7~driven sgRNA was in vitro transcribed using custom oligos (Example 10) and HiScribe T7 In Vitro Transcription Kit (NEB), following the manufacturer's recommended protocol. To prepare methylated target sites, pUC19 plasmid was methylated by M.SssI and then linearized by N el. The in vitro cleavage assay was performed as follows: for a 20 uL cleavage reaction, 10 uL of cell lysate with incubated with 2 uL cleavage buffer (100 mM HEPES, 500 mM KCi, 25 mM MgC12, 5 mM DTT, 25% glycerol), the in vitro transcribed RNA, and 300 ng pUC19 plasmid DNA.
[00398] Deep sequencing to assess targeting specificity
[003991 HEK 293 FT cells plated in 96-well plates were transfected with Cas9 plasmid DNA and single guide RNA (sgRNA) PGR cassette 72 hours prior to genomic DNA extraction (Fig. 72). The genomic region flanking the CRISPR target site for each gene was amplified (Fig. 74, Fig. 80, (Example 10) by a fusion PGR method to attach the Iilimilna P5 adapters as well as unique sample-specific barcodes to the target amplicons (schematic described in Fig. 73). PGR products were purified using EeonoSpin 96-well Filter Plates (Epoch Life Sciences) following the manufacturer's recommended protocol.
[00400] Barcoded and purified DNA samples were quantified by Quant-iT PicoGreen dsDNA Assay Kit or Q bit 2.0 Fiuorometer (Life Technologies) and pooled in an equimolar ratio. Sequencing libraries were then deep sequenced with the Π lamina MiSeq Personal Sequencer (Life Techno logics).
[00401] Sequencing data analysis and In del detection
[00402] MiSeq reads were filtered by requiring an average Piired quality (Q score) of at least 23, as well as perfect sequence matches to barcodes and amplicon forward primers. Reads from on- and off-target loci were analyzed by first performing Smith -Waterman alignments against amplico sequences that included 50 nucleotides upstream and downstream of the target site (a total of 120 bp). Alignments, meanwhile, were analyzed for indels from 5 nucleotides upstream to 5 nucleotides downstream of the target site (a total of 30 bp). Analyzed target regions were discarded if part of their alignment fell outside the MiSeq read itself, or if matched base-pairs comprised less than 85%> of their total length. [00403] Negative controls for each sample provided a gauge for the inclusion or exclusion of indels as putative cutting events. For each sample, an indel was counted only if its quality score exceeded J-4 - σ, where was the mean quality-score of the negative control corresponding to that sample and σ was the standard deviation of same. This yielded whole target-region indel rates for both negative controls and their corresponding samples. Using the negative control's per-target-region-per-read error rate, the sample's observed indel count , and its read-count a maximum-likelihood estimate for the fraction of reads having target -regions with true- indels, P, was derived by applying a binomial error model, as follows.
[00404] Letting the (unknown) number of reads in a sample having target regions incorrectly cou ted as having at least 1 indel be we can write (without making any assumptions about the number of true inde
Figure imgf000135_0001
[00405] since 80-— p} is the number of reads havi g target -regions with no true indels. Meanwhile, because the number of reads observed to have indels is , 71 = £ + in other words the number of reads having target-regions with errors but no true indels plus the number of reads whose target-regions correctly have indels. W e can then re -write the above
Figure imgf000135_0002
ProbCE
[00406] Taking all values of the frequency of target-regions with trae-indels P to be equally probable a priori, ¾ob i¾: J K ¾eb j¾)_ T e maximum-likelihood estimate (MLE) for the frequency of target regions with true-indeis was therefore set as the value of P that maximized
Pro o This was evaluated numerically.
[00407] In order to place error bounds on the trae-indel read frequencies in the sequencing libraries themselves, Wilson score intervals (2) were calculated for each sample, given the MLE- estimate for true-indel target-regions, and the number of reads Explicitly, the lower bound * and upper bound ii; were calculated as
/" ?2 \
l = { Rp + ^—∑^R (l -p) +∑z/4 + 22)
Figure imgf000136_0001
[00408] where z, the standard score for the confidence required in normal distribution of variance 1, was set to 1.96, meaning a confidence of 95%. The maximum upper bounds and minimum lower bounds for each biological replicate are listed in Figs. 80-83.
[00409] qRT-PCR a alysis of relative Cas9 and sgRNA expression
[004 J 0] 293 FT cells plated in 24-well plates were transfected as described above. 72 hours post-transfection, total RNA was harvested with miRNeasy Micro Kit (Qiagen). Reverse-strand synthesis for sgRNAs was performed with qScript Flex cDNA kit (VWR) and custom first- strand synthesis primers (Tables J and K). qPCR analysis was performed with Fast S YBR Green Master Mi (Life Technologies) and custom primers (Tables J and K), using GAPDH as an endogenous control. Relative quantification was calculated by the ΔΔίΤΤ method.
[00411] Ta.ble I i Target site sequences. Tested target sites for S. pyogenes type II CRISPR system with the requisite PAM. Cells were transfected with Cas9 and either crRNA-tracrRNA or chimeric sgRNA for each target.
Figure imgf000136_0002
20 EMX1 GGCCTCCCCAAAGCCTGGCC AGG -
4 PVALB GGGGCCGAGATTGGGTGTTC AGG +
5 PVALB GTGGCGAGAGGGGCCGAGAT TGG +
I SERPINB5 GAGTGCCGCCGAGGCGGGGC GGG + z SERPINB5 GGAGTGCCGCCGAGGCGGGG CGG +
3 SERPINB5 GGAGAGGAGTGCCGCCGAGG CGG +
2] Table J j Primer sequences
SURVEYOR assay
Figure imgf000137_0001
qRT-PC for Cas9 and sgRNA expression
Figure imgf000137_0002
Bisulfite PCR and sequencing
primer sequence (5' to 3') Bisulfite PGR F GAGGAATTCI TTTTTGTWGAATATGTTGGAGGT (SERPINB5 locus) TTTTTGGAAG
Bisulfite PGR R GAGAAGCTTAAATAAAAAACRACAATACTCAACC (SERPMB5 locus) ( ΛΛί'ΛΛί '( '
pUC!9 sequencing CAGGAAACAGCTATGAC
[00413] Table K j Sequences for primers to test sgRNA architecture. Primers hybridize to the reverse strand of the U6 promoter unless othenvise indicated. The U6 priming site is in italics, the guide sequence is indicated as a stretch of Ns, the direct repeat sequence is highlighted in bold, and the traerRNA sequence underlined. The secondary structure of each sgRNA architecture is shown in Fig. 43.
Figure imgf000138_0001
target sites for PAM specificity testing are found within the human EM 1 locus.
Figure imgf000138_0002
AACCGGAGGACAAAGTACA NTG
TTCCAGAACCGGAGGACAA NCA
GTGTGGTTCCAGAACCGGA NCT
TCCAGAACCGGAGGACAAA CC
CAGAAGCTGGAGGAGGAAG NCG
CATCAACCGGTGGCGCATT NGA
GCAGAAGCTGGAGGAGGAA NGT
CCTCCCTCCCTGGCCCAGG NGC
TCATCTGTGCCCCTCCCTC NAA
GGGAGGACATCGATGTCAC NAT
CAAACGGCAGAAGCTGGAG MAC
GGGTGGGCAACCACAAACC NAG
GGTGGGCAACCACAAACCC NTA
GGCTCCCATCACATCAACC NTT
GAAGGGCCTGAGTCCGAGC NTC
CAACCGGTGGCGCATTGCC NTG
AGGAGGAAGGGCCTGAGTC NCA
AG CTGG AG G AGG AAGG GC C NCT
GCATTGCCACGAAGCAGGC \C C
ATTGCCACGAAGCAGGCCA NCG
AGAACCGGAGGACAAAGTA NGA
TCAACCGGTGGCGCATTGC NGT
GAAGCTGGAGGAGGAAGGG NGC
Example 10: Supplementary Sequences
[004151 All sequences are in the 5' to 3' direction. For U6 transcription, the string of underlined Ts serve as the transcriptional terminator.
[004 J 6] > U6-short tracrRNA (Streptococcus pyogenes SF370)
[00417] gagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgc ttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacaccGGAACCATTCAAAACAGC
ATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGA
GTCGGTGCTTTTTTT
[00418] (tracrRNA sequence in bold) [00419] >U6-DR-guide sequence-DR (Streptococcus pyogenes SF370)
[00420] gagggcc ttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagaiattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtitgcagtittaaaatiatgtittaaaatggaciatcaiatgc ttaccgtaacttgaaagtatttcgatttct¾^
aHaaeNNNNNNNNNNNNNNNN
TTTTTT
[00421] (direct repeat sequence is highlighted in gray and the guide sequence is in bold Ns)
[00422] > sgRNA containing +48 tracrRNA (Streptococcus pyogenes SF370)
[00423] gagggcctatttcccatgattccttca ttgca acgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgc ttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtgg
NNgtt¾l¾g¾gc ¾gaaatagcaagttaaaataaggctagtccgTTTTTTT
[00424] (guide sequence is in bold Ns and the tracrRNA fragment is in bold)
[00425] > sgRNA containing +54 tracrRNA (Streptococcus pyogenes SF370)
[00426] gagggectatttcecatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatattaglacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgc ttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacaccNNNNNNNNNNNNNNNNNN
NNgn ¾g¾gcfa.gaaatagcaagttaaaataaggctagtccgttatca'l'll'l'i'l,rrT
[00427] (guide sequence is in bold Ns and the tracrRNA fragment is in bold)
[00428] > sgRNA. containing +67 tracrRNA (Streptococcus pyogenes SF370)
[00429] gagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatatogtacaaaatacgtgaegtagaaagtaataa
ttaccgtaactigaaagtatttcgatttcttggctttatatatctigtggaaaggacgaaacaccNNNNNNNNNNNNNNNNNN rWgf ¾8g¾gc agaaatagcaagttaaaataaggctagtccgttatcaacttgaaaaagtgT^
[00430] (guide sequence is in bold Ns and the tracrRNA fraginent is in bold)
[00431] > sgRNA containing +85 tracrRNA (Streptococcus pyogenes SF370)
[00432] gagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattggaattaatttgactgtaaa cacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgc ttac gtaacttgaaagtatttcgatttcttggctttatatatctt ggaaaggacgaaacac NNNNNNNNNNNNNNNNNN
Figure imgf000140_0001
T [00433] (guide sequence is in bold s and the tracrRNA fragment is in bold)
[00434] > CBh-NLS-SpCas9-NLS
[004351 CGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACC
CCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTT
'!'( C 'AT I GACGTC A ATC XX ΠΧΧ J AC JTA'I TTAC X iGTAAAi ΊΧΧ X C A( TTGC X'AG'I AC 'ATC
AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCG
( X 1 ( X ΛΤΤΛΊ GC C X 'AC Π'Α( ATGAC T 'TTATGC X sACTTTC ΤΊ AC ΊΊ ( X AGTACATC TA
CGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTC
CCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTG
TGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGCGGGGCGG
GGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCG
GCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAA
AAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCC
c x i'cc Gc i K Gca x c x 'c c x 'C c c x 'C
AGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCTGAGCAAGAGG
1 AAGC Χ. ΠΊ AAGC X iA l Gi j'f'TC Χ. Π X -GTG X Π AT! ΑΛΊ GTT l ΛΛΤΤΛ( X Ί X iG AGCAC CTGCCTGAAATCACTTTTTTTCAGGTTGGaccggtgccaccATGGACTATAAGGACCACG ACGGAGACTACAAGGATCATGATATTGATTACAAAGACGATGACGATAAGATG GCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCCGACAA GAAGTACAGCATCGGCCTGGACATCGGCACCAACTCTGTGGGCTGGGCCGTGA TCACCGACGAGTACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACC GACCGGCACAGCATCAAGAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGG C G A AAC AG C C G A GGC C AC C C GG C TG A AGAG A AC C GC C AG A AG A AG A T AC AC C A GACGGAAGAACCGGATCTGCTATCTGCAAGAGATCTTCAGCAACGAGATGGCC AAGGTGGACGACAGCTTCTTCCACAGACTGGAAGAGTCCTTCCTGGTGGAAGA GGATAAGAAGCACGAGCGGCACCCCATCTTCGGCAACATCGTGGACGAGGTGG C C T AC C AC G AG AAGT AC C C C AC C ATC T AC C AC C TG AG AAAG AAAC TGGTGGAC AGCACCGACAAGGCCGACCTGCGGCTGATCTATCTGGCCCTGGCCCACATGAT CAAGTTCCGGGGCCACTTCCTGATCGAGGGCGACCTGAACCCCGACAACAGCG ACGTGGACAAGCTGTTCATCCAGCTGGTGCAGACCTACAACCAGCTGTTCGAG GAAAACCCCATCAACGCCAGCGGCGTGGACGCCAAGGCCATCCTGTCTGCCAG ACTGAGCAAGAGCAGACGGCTGGAAAATCTGATCGCCCAGCTGCCCGGCGAGA
AGAAGAATGGCCTGTTCGGCAACCTGATTGCCCTGAGCCTGGGCCTGACCCCC
AACTTCAAGAGCAACTTCGACCTGGCCGAGGATGCCAAACTGCAGCTGAGCAA
GGACACCTACGACGACGACCTGGACAACCTGCTGGCCCAGATCGGCGACCAGT
ACGCCGACCTGTTTCTGGCCGCCAAGAACCTGTCCGACGCCATCCTGCTGAGC
G AC ATC C TG AG AGTG A AC AC C G AG ATC AC C A AGGC C C C C C TG AGC GC C TC T AT
GATCAAGAGATACGACGAGCACCACCAGGACCTGACCCTGCTGAAAGCTCTCG
TGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATTTTCTTCGACCAGAGCAAG
AACGGCTACGCCGGCTACATTGACGGCGGAGCCAGCCAGGAAGAGTTCTACAA
GTTCATCAAGCCCATCCTGGAAAAGATGGACGGCACCGAGGAACTGCTCGTGA
AGCTGAACAGAGAGGACCTGCTGCGGAAGCAGCGGACCTTCGACAACGGCAG
CATCCCCCACCAGATCCACCTGGGAGAGCTGCACGCCATTCTGCGGCGGCAGG
AAGATTTTTACCCATTCCTGAAGGACAACCGGGAAAAGATCGAGAAGATCCTG
ACCTTCCGCATCCCCTACTACGTGGGCCCTCTGGCCAGGGGAAACAGCAGATT
CGCCTGGATGACCAGAAAGAGCGAGGAAACCATCACCCCCTGGAACTTCGAGG
AAGTGGTGGACAAGGGCGCTTCCGCCCAGAGCTTCATCGAGCGGATGACCAAC
TTCGATAAGAACCTGCCCAACGAGAAGGTGCTGCCCAAGCACAGCCTGCTGTA
CGAGTACTTCACCGTGTATAACGAGCTGACCAAAGTGAAATACGTGACCGAGG
GAATGAGAAAGCCCGCCTTCCTGAGCGGCGAGCAGAAAAAGGCCATCGTGGAC
CTGCTGTTCAAGACCAACCGGAAAGTGACCGTGAAGCAGCTGAAAGAGGACTA
CTTCAAGAAAATCGAGTGCTTCGACTCCGTGGAAATCTCCGGCGTGGAAGATC
GGTTCAACGCCTCCCTGGGCACATACCACGATCTGCTGAAAATTATCAAGGAC
AAGGACTTCCTGGACAATGAGGAAAACGAGGACATTCTGGAAGATATCGTGCT
GACCCTGACACTGTTTGAGGACAGAGAGATGATCGAGGAACGGCTGAAAACCT
ATGCCCACCTGTTCGACGACAAAGTGATGAAGCAGCTGAAGCGGCGGAGATAC
ACCGGCTGGGGCAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGACAAGC
AGTCCGGCAAGACAATCCTGGATTTCCTGAAGTCCGACGGCTTCGCCAACAGA
AACTTCATGCAGCTGATCCACGACGACAGCCTGACCTTTAAAGAGGACATCCA
GAAAGCCCAGGTGTCCGGCCAGGGCGATAGCCTGCACGAGCACATTGCCAATC
TGGCCGGCAGCCCCGCCATTAAGAAGGGCATCCTGCAGACAGTGAAGGTGGTG
G AC GAGC TC GTG AA AGTG ATGGGC C GGC AC AAGC C C GAG A AC ATC GTGATC G A AATGGCCAGAGAGAACCAGACCACCCAGAAGGGACAGAAGAACAGCCGCGAG
AG AATGAAG C GG ATC GAAG AGGGC ATC AAAG AG C TGGGC AG C C AG ATC C TG AA
AGAACACCCCGTGGAAAACACCCAGCTGCAGAACGAGAAGCTGTACCTGTACT
ACCTGCAGAATGGGCGGGATATGTACGTGGACCAGGAACTGGACATCAACCGG
CTGTCCGACTACGATGTGGACCATATCGTGCCTCAGAGCTTTCTGAAGGACGA
CTCCATCGACAACAAGGTGCTGACCAGAAGCGACAAGAACCGGGGCAAGAGCG
AC A AC GTGC C C TC C GAAG AG G TC GTG A AG A A G ATG A AG A AC T AC TGGC G GC AG
CTGCTGAACGCCAAGCTGATTACCCAGAGAAAGTTCGACAATCTGACCAAGGC
CGAGAGAGGCGGCCTGAGCGAACTGGATAAGGCCGGCTTCATCAAGAGACAG
CTGGTGGAAACCCGGCAGATCACAAAGCACGTGGCACAGATCCTGGACTCCCG
GATGAACACTAAGTACGACGAGAATGACAAGCTGATCCGGGAAGTGAAAGTGA
TCACCCTGAAGTCCAAGCTGGTGTCCGATTTCCGGAAGGATTTCCAGTTTTACA
AAGTGCGCGAGATCAACAACTACCACCACGCCCACGACGCCTACCTGAACGCC
GTCGTGGGAACCGCCCTGATCAAAAAGTACCCTAAGCTGGAAAGCGAGTTCGT
GTACGGCGACTACAAGGTGTACGACGTGCGGAAGATGATCGCCAAGAGCGAGC
AGGAAATCGGCAAGGCTACCGCCAAGTACTTCTTCTACAGCAACATCATGAACT
TTTTCAAGACCGAGATTACCCTGGCCAACGGCGAGATCCGGAAGCGGCCTCTG
ATC GAG AC AAAC GGC G AA AC C GGG GAG ATC GTGTGGG AT AAGGGC C GGG ATT
TTGCCACCGTGCGGAAAGTGCTGAGCATGCCCCAAGTGAATATCGTGAAAAAG
ACCGAGGTGCAGACAGGCGGCTTCAGCAAAGAGTCTATCCTGCCCAAGAGGAA
CAGCGATAAGCTGATCGCCAGAAAGAAGGACTGGGACCCTAAGAAGTACGGCG
GCTTCGACAGCCCCACCGTGGCCTATTCTGTGCTGGTGGTGGCCAAAGTGGAA
AAGGGCAAGTCCAAGAAACTGAAGAGTGTGAAAGAGCTGCTGGGGATCACCAT
CATGGAAAGAAGCAGCTTCGAGAAGAATCCCATCGACTTTCTGGAAGCCAAGG
GCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCTAAGTACTCCCTG
TTCGAGCTGGAAAACGGCCGGAAGAGAATGCTGGCCTCTGCCGGCGAACTGCA
GAAGGGAAACGAACTGGCCCTGCCCTCCAAATATGTGAACTTCCTGTACCTGG
CCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGATAATGAGCAGAAACAG
CTGTTTGTGGAACAGCACAAGCACTACCTGGACGAGATCATCGAGCAGATCAG
CGAGTTCTCCAAGAGAGTGATCCTGGCCGACGCTAATCTGGACAAAGTGCTGT
C C GC C Ϊ AC AAC A AGC AC C GGG AT A AGC C C ATC AGA G AGC AGGC C GAGA AT ATC [00436] (NLS-hSpCas9-NLS is highlighted in bold)
[00437] > Sequencing amplicon for EMX1 guides 1.1, 1.14, 1.17
[00438] CCAATGGGGAGGACATCGATGTCACCTCCAATGACTAGGGTGGGCAACC ACAAACCCACGAGGGCAGAGTGCTGCTTGCTGCTGGCCAGGCCCCTGCGTGGGCCC
AAGCTGGACTCTGGCCAC
[00439] > Sequencing amplicon for EM XI guides 1.2, 1.16
[00440] CGAGCAGAAGAAGAAGGGCTCCCATCACATCAACCGGTGGCGCATTGCC
ACGAAGCAGGCCAATGGGGAGGACATCGATGTCACCTCCAATGACTAGGGTGGGCA
ACCACAAACCCACGAG
[00441] > Sequencing amplicon for EMX1 guides 1.3, 1.13, 1.15
[00442] GGAGGACAAAGTACAAACGGCAGAAGCTGGAGGAGGAAGGGCCTGAGTC
CGAGCAGAAGAAGAAGGGCTCCCATCACATCAACCGGTGGCGCATTGCCACGAAGC
AG GC C A ATG GG G AGG AC ATC GAT
[00443] > Sequencing amplicon for EMX1 guides 1.6
[00444] AGAAGCTGGAGGAGGAAGGGCCTGAGTCCGAGCAGAAGAAGAAGGGCTC
Figure imgf000144_0001
ATGTCACCTCCAATGACTAGGGTGG
[CI0445] > Sequencing amplicon for EMX1 guides 1.10
[00446] CCTCAGTCTTCCCATCAGGCTCTCAGCTCAGCCTGAGTGTTGAGGCCCCAG TGGCTGCTCTGGGGGCCTCCTGAGTTTCTCATCTGTGCCCCTCCCTCCCTGGCCCAGG TGAAGGTGTGGTTCCA
[00447] > Sequencing amplicon for EMX1 guides 1.1 1, 1.12
[00448] TCATCTGTGCCCCTCCCTCCCTGGCCCAGGTGAAGGTGTGGTTCCAGAACC
GGAGGACAAAGTACAAACGGCAGAAGCTGGAGGAGGAAGGGCCTGAGTCCGAGCA GAAGAAGAAGGGCTCCCATCACA
[00449] > Sequencing amplicon for EMX1 guides 1.18, 1.19 [00450] CTCCAATGACTAGGGTGGGCAACCACAAACCCACGAGGGCAGAGTGCTG CTTGCTGCTGGCCAGGCCCCTGCGTGGGCCCAAGCTGGACTCTGGCCACTCCCTGGC CAGGCTTTGGGGAGGCCTGGAGT
[00451] > Sequencing amplicon for EMXl guides 1 ,20
[00452] CTCX TTGnX XTGGC'C AGGCX rm
ACTCCCTGGCCAGGCTTTGGGGAGGCCTGGAGTCATGGCCCCACAGGGCTTGAAGC CCGGGGCCGCCATTGACAGAG
[00453] >T7 promoter F primer for annealing with target strand
[00454] GAAATTAATACGACTCACTATAGGG
[00455] >oligo containing pUC 19 target site 1 for methylation (T7 reverse)
[00456] AAAAAAGCACCGACTCGGTGCCACTTTTTCAAGTTGATAACGGACTAGCC
TTATTTTAACTTGCTATTTCTAGCTCTAAAACAACGACGAGCGTGACACCACCCTAT
AGTGAGTCGTATTAATTTC
[00457] >oligo containing pUC19 target site 2 for methylation (T7 reverse)
[00458] AAAAAAGCACCGACTCGGTGCCACTTTTTCAAGTTGATAACGGACTAGCC TTATTTTAAC^
GTGAGTCGTATTAATTTC
Example 11: Qligo-mediated Cas9-induced Homologous Recombination
[00459] The oligo homologous recombination test is a comparison of efficiency across different Cas9 variants and different. HR template (oiigo vs. piasmid).
[00460] 293FT cells were used, SpCas9 = Wildtype Cas9 and SpCas9n = nickase Cas9 (D10A). The chimeric NA target is the same EMXl Protospacer Target 1 as in Examples 5, 9 and 10 and oligos synthesized by IDT using PAGE purification.
[00461] Figure 44 depicts a design of the oligo DNA used as Homologous Recombination (HR) template in this experiment. Long oligos contain lOObp homology to the EMXl locus and a Hindlll restriction site. 293FT cells were co-transfected with: first, a plasmid containing a chimeric RNA targeting human EMXl locus and wild-type cas9 protein, and second, the oligo DNA as HR template. Samples are from 293FT cells collected 96 hours post transfection with Lipofectamine 2000. All products were amplified with an EMXl HR Primer, gel purified, followed by digestion with Hindlll to detect the efficiency of integration of HR template into the human genome.
[ΘΘ462] Figures 45 and 46 depict a comparison of HR efficiency induced by different combination, of Cas9 protein and HR template. The Cas9 construct used were either wild-type Cas9 or the nickase version of Cas9 (Cas9n). The HR template used were: antisense oiigo DNA (Antisense-Oligo in above figure), or sense oligo DNA (Sense-Oligo in above figure), or plasmid HR. template (HR template in above figure). The sense/anti -sense definition is that the actively- transcribed strand with sequence corresponding to the transcribed mRNA is defined as the sense strand of genome. HR Efficiency is shown as percentage of Hindlll digestion band as against all genomic PGR amplified product (bottom numbers).
Example 12: Autistic Mouse
[00463] Recent large-scale sequencing initiatives have produced a large number of genes associated with disease. Discovering the genes is only the beginning in understanding what the gene does and how it leads to a diseased phenotype. Current technologies and approaches to study candidate genes are slow and laborious. The gold standards, gene targeting and genetic knockouts, require a significant investment in time and resources, both monetary and in terms of research personnel. Applicants set out to utilize the hSpCas9 nuclease to target many genes and do so with higher efficiency and lower turnaround compared to any other technology. Because of the high efficiency of hSpCas9 Applicants can do RNA injection into mouse zygotes and immediately get genome-modified animals without the need to do any preliminary gene targeting in mESCs.
[00464] Chromodomain helicase DNA binding protein 8 (CHD8) is a pivotal gene in involved in early vertebrate development and morphogenesis. Mice lacking CHD8 die during embryonic development. Mutations in the CHD8 gene have been associated with autism spectrum disorder in humans. This association was made in three different papers published simultaneously in Nature. The same three studies identified a plethora of genes associated with autism spectrum disorder. Applicants' aim was to create knockout mice for the four genes that were found in all papers, Chd8, atnal2, Kctd , and Scn2a. In addition, Applicants chose two other genes associated with autism spectrum disorder, schizophrenia, and ADHD, GIT1 , CACNA1 C, and CACNB2. And finally, as a positive control Applicants decide to target MeCP2. [00465] For each gene Applicants designed three gRNAs that would likely knockout the gene. A knockout would occur after the hSpCas9 nuclease makes a double strand break and the error prone DNA repair pathway, non-homologous end joining, corrects the break, creating a mutation. The most likely result is a frameshift mutation that would, knockout the gene. The targeting strategy involved finding proto-spacers in the exons of the gene that had a PAM sequence, NGG, and was unique in the genome. Preference was given to proto-spacers in the first exon, which would be most deleterious to the gene.
[00466] Each gRNA was validated in the mouse ceil line, Neuro-N2a, by liposomal transient co-transfection with hSpCas9. 72 hours post-transfection genomic DNA. was purified using QuickExtract DNA from Epicentre. PGR was performed to amplify the locus of interest. Subsequently the SURVEYOR. Mutation Detection Kit from Transgenomics was followed. The SURVEYOR results for each gRNA and respective controls are shown in Figure Al . A positive SURVEYOR result is one large band corresponding to the genomic PGR and two smaller bands that are the product of the SURVEYOR nuclease making a double-strand break at the site of a mutation. The average cutting efficiency of each gRNA was also determined for each gRNA. The gRNA that was chosen for injection was the highest efficiency gRNA that was the most unique within the genome.
[00467] RNA (hSpCas9-'-gR.NA RNA) was injected into the pronucleus of a zygote and later transplanted into a foster mother. Mothers were allowed to go full term and pups wrere sampled by tail snip 10 days postnatal. DNA was extracted and used as a template for PGR., which was then processed by SUR EYOR. Additionally, PGR products were sent for sequencing. Animals that were detected as being positive in either the SURVEYOR assay or PGR sequencing would have their genomic PGR products cloned into a pUC19 vector and sequenced to determine putative mutations from each allele.
[00468] So far, mice pups from the Chd8 targeting experiment have been fully processed up to the point of allele sequencing. The Surveyor results for 38 live pups (lanes 1 -38) 1 dead pup (lane 39) and 1 wild-type pup for comparison (lane 40) are shown in Figure A2, Pups 1-19 were injected with gRNA Chd8.2 and pups 20-38 were injected with gRNA Chd8.3. Of the 38 live pups, 13 were positive for a mutation. The one dead pup also had a mutation. There was no mutation detected in the wild-type sample. Genomic PGR sequencing was consistent with the SURVEYOR assay findings. Example 13: CRISPR/Cas-Mediated Transcriptional Modulation
[00469] Figure 67 depicts a design of the CRISPR-TF (Transcription Factor) with transcriptional activation activity. The chimeric R A is expressed by U6 promoter, while a human-codon-optimized, double-mutant version of the Cas9 protein (hSpCas9m), operably linked to triple NLS and a VP64 functional domain is expressed by a EFl a promoter. The double mutations, DIOA and H840A, renders the eas9 protein unable to introduce any cleavage but maintained its capacity to bind to target DNA when guided by the chimeric RNA.
[00470] Figure 68 depicts transcriptional activation of the human SOX2 gene with CRISPR- TF system (Chimeric RNA and the Cas9-NLS-VP64 fusion protein). 293FT cells were transfected with piasmids bearing two components: (1) U6-driven different chimeric R As targeting 20-bp sequences within or around the human SOX2 genomic locus, and (2) EF la- driven hSpCas9m (double mutant)-NLS-VP64 fusion protein. 96 hours post transfection, 293FT ceils were harvested and the level of activatio is measured by the induction of mRNA expression using a qRT-PCR assay. All expression levels are normalized against the control group (grey bar), which represents results from cells transfected with the CRISPR-TF backbone plasmid without chimeric RNA. The qRT-PCR probes used for detecting the SOX2 mRNA is Taqman Human Gene Expression Assay (Life Technologies). Ail experiments represents data from 3 biological replicates, n:::3, error bars show s.e.m.
Example 14: NLS: Cas9 NLS
[00471] 293FT cells were transfected with plasmid containing two components: (1) EFla promoter driving the expressio of Cas9 (wild-type human-codon-optimized Sp Cas9) with different NLS designs (2) U6 promoter driving the same chimeric RNA targeting human EMX1 locus.
[00472] Cel ls were collect at 72h time point post transfection, and then extracted with 50 μΐ of the QuickExtract genomic DNA extraction solution following manufacturer's protocol. Target EMX1 genomic DNA were PCR amplified and then Gel-purify with 1% agarose gel. Genomic PGR product were re-anneal and subjected to the Surveyor assay following manufacturer's protocol. The ge omic cleavage efficiency of different constructs were measured using SDS- PAGE on a 4-12% TBE-PAGE gel (Life Technologies), analyzed and quantified with Image Lab (Bio-rad) software, all following manufacturer's protocol. [00473] Figure 69 depicts a design of different Cas9 NLS constructs. Ail Cas9 were the human-codon-optimized version of the Sp Cas9. NLS sequences are linked to the cas9 gene at either N -terminus or C-terminus. All Cas9 variants with different N LS designs were cloned into a backbone vector containing so it is driven by EFla promoter. On the same vector there is a chimeric RNA targeting human EMXl locus driven by U6 promoter, together forming a two- component system,
[00474] Table M. Cas9 NLS Design Test Results. Quantification of genomic cleavage of different cas9-nls constructs by surveyor assay.
Figure imgf000149_0001
[00475] Figure 70 depicts the efficiency of genomic cleavage induced by Cas9 variants bearing different NLS designs. The percentage indicate the portion of human EMXl genomic DNA that were cleaved by each construct. All experiments are from 3 biological replicates, n = 3, error indicates S.E.M,
Example 15: Engineering of Microalgae using Cas9
[00476] Methods of delivering Cas9 [00477] Method 1 : Applicants deliver Cas9 and guide RNA using a vector that expresses Cas9 under the control of a constitutive promoter such as Hsp70A-Rbc S2 or Beta2-tubulin.
[004781 Method 2: Applicants deliver Cas9 and T7 polymerase using vectors that expresses Cas9 and T7 polymerase under the control of a constitutive promoter such as Hsp7GA-R.bc S2 or Beta2 -tubulin. Guide RNA will be delivered using a vector containing T7 promoter driving the guide RNA,
[00479] Method 3: Applicants deliver Cas9 mR A and in vitro transcribed guide RNA to algae cells. RNA can be in vitro transcribed. Cas9 mRNA will consist of the coding region for Cas9 as well as 3'UTR from Cop ! to ensure stabilization of the Cas9 mRNA.
[00480] For Homologous recombination, Applicants provide an additional homology directed repair template.
[00481 ] Sequence for a cassette driving the expression of Cas9 under the control of beta-2 tubulin promoter, followed by the 3 ' UTR of Cop 1.
[00482] ΊΧ ΊΊΊ ΊΊ Ο( ( Ί'ΑΊΧ ΪΛ( Λ( ΊΊ (Χ 'Α( A AA AC iGl AGi iGi C iC 'l -GAGA CGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACCCCCCGAAGCTCCTTC GGGG(1'GC \\TGGGCG{ T{ C GATG( '(
GCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCAAACACCTAG
ATCACTACCACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGCTAAGGGGG CGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACATGTACCCATACGATGTTCCA GATTACGCTTCGCCGAAGAAAAAGCGCAAGGTCGAAGCGTCCGACAAGAAGTACAG
( ATC GCC 1 GGAC A1XX sG( ACCAA( Ί X ΊΧ ^^^
ACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACCGACCGGCACAGCATC
AAGAAGAACCri jATCGGAGCXXTrGCTGTTCGACAGCGGCGAAACAGCCGAGGCCAC
CCGGCTGAAGAGAACCGCCAGAAGAAGATACACCAGACGGAAGAACCGGATCTGC
TATCTGCAAGAGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGCTTCTTCCAC
AGACTGGAAGAGTCCTTCCTGGTGGAAGAGGATAAGAAGCACGAGCGGCACCCCAT
CTTCGGCAA.CATCGTGGACGAGGTGGCCTACCA.CGAGAAGTACCCCACCATCTA.ee ACCTGAGAAAGAAACTGGTGGACAGCACCGACAAGGCCGACCTGCGGCTGATCTAT CTGGCCCTGGCCCACATGATCAAGTTCCGGGGCCACTTCCTGATCGAGGGCGACCTG
Figure imgf000150_0001
CCAGCTGTTCGAGGAAAACCCCATCAACGCCAGCGGCGTGGACGCCAAGGCCATCC TGTCTGCCAGACTGAGCAAGAGCAGACGGCTGGAAAATCTGATCGCCCAGCTGCCC GGCGAGAAGAAGAATGGCCTGTTCGGCAACCTGATTGCCCTGAGCCTGGGCCTGAC CCCCAACTTCAAGAGCAACTTCGACCTGGCCGAGGATGCCAAACTGCAGCTGAGCA AGGACACCTACGACGACGACCTGGACAACCTGCTGGCCCAGATCGGCGACCAGTAC
( 'i CiA( (ΊΧΓΓΓΊΧΊΧ ΧΧΚ (\\Λ(}ΛΛί (ΊΧ;Ί(ΧΧ = Λ( ί :Χ'ΛΊΧΧΊΧ Ί'(ίΛ( Χ}Λ(·Λ·Γί CTGAGAGTGAACACCGAGATCACCAAGGCCCCCCTGAGCGCCTCTATGATCAAGAG ΛΊΑ(ΧίΛ(Χ!Λί :Α(Χ\\ί ( Λί ::Λ(ΧΊαΛ(ΧΧ Ί'ί ΊΧ:ΛΛΛ( Ί'( Ί'( ίΠΧ i;Gi Λ( TGCCTGAGAAGTACAAAGAGATTTTCTTCGACCAGAGCAAGAACGGCTACGCCGGC TACATTGACGGCGGAGCCAGCCAGGAAGAGTTCTACAAGTTCATCAAGCCCATCCT GGAAAAGATGGACGGCACCGAGGAACTGCTCGTGAAGCTGAACAGAGAGGACCTG CTGCGGAAGCAGCGGACCTTCGACAACGGCAGCATCCCCCACCAGATCCACCTGGG AGAGCTGCACGCCATTCTGCGGCGGCAGGAAGATTTTTACCCATTCCTGAAGGACAA CCGGGAAAAGATCGAGAAGATCCTGACCTTCCGCATCCCCTACTACGTGGGCCCTCT GGCX'AGGGGAAAC'AGC AGATIX XX ilXXsATGACX-AGAAAGACX GAGGAAACX ΛΤΓ ACCCCCTGGAACTTCGAGGAAGTGGTGGACAAGGGCGCTTCCGCCCAGAGCTTCAT
( ί! ί :Χ ;ΛΧί;Λί ( ΛΑ(ΊΊΧ GAlAACiAAC ίΊίΧΧΧ'ΑΑί CiACiAAGCnX •iiiCXX'AAiiC- ACAC X Ί GGTG l Αί GAG 1 ΑΓ!Ύ< Λ(Χ GTG 1 ΑΤΑΑί GAGCi GA(X AAAG I GAAA 1 AC GTGACCGAGGGAATGAGAAAGCCCGCCTTCCTGAGCGGCGAGCAGAAAAAGGCCA TCGTGGACCTGCTGTTCAAGACCAACCGGAAAGTGACCGTGAAGCAGCTGAAAGAG GACTACTTCAAGAAAATCGAGTGCTTCGACTCCGTGGAAATCTCCGGCGTGGAAGAT
( X -CiT l CAACi ·<ΧΊ (X X 1 ( ;G( ·( Ά( ΛΊ AC X \ ( GAT( 1 ( ·( TG ΑΛΑΛ'Π'ΛΤί ΑΛ( XiACA A GGACTTCCTGGACAATGAGGAAAACGAGGACATTCTGGAAGATATCGTGCTGACCC ΊΧΪΛ( Λ(Ί (ΠΊΊ(ίΛ( ;Α( \ί!Λί;Λί;ΛΊ'(!ΑΊ(Χ!Αί;(}ΛΛί CiG( ΊΧ;ΑΛΑΛ(ΧΊ ΑΊΧ Χ ( Λ(' CTGTTCGACGACAAAGTGATGAAGCAGCTGAAGCGGCGGAGATACACCGGCTGGGG CAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGACAAGCAGTCCGGCAAGACA ATCCTGGATTTCCTGAAGTCCGACGGCTTCGCCAACAGAAACTTCATGCAGCTGATC CACGACGACAGCCTGACCTTTAAAGAGGACATCCAGAAAGCCCAGGTGTCCGGCCA GGGCGATAGCCTGCACGAGCACATTGCCAATCTGGCCGGCAGCCCCGCCATTAAGA AGGGCATCCTGCAGACAGTGAAGGTGGTGGACGAGCTCGTGAAAGTGATGGGCCGG CACAAGCCCGAGAACATCGTGATCGAAATGGCCAGAGAGAACCAGACCACCCAGA AGGGACAGAAGAACAGCCGCGAGAGAATGAAGCGGATCGAAGAGGGCATCAAAGA GCTGGGCAGCCAGATCCTGAAAGAACACCCCGTGGAAAACACCCAGCTGCAGAACG AGAAGCTGTACCTGTACTACCTGCAGAATGGGCGGGATATGTACGTGGACCAGGAA
CTGGACATCAACCGGCTGTCCGACTACGATGTGGACCATATCGTGCCTCAGAGCTTT
CTGAAGGACGACTCCATCGACAACAAGGTGCTGACCAGAAGCGACAAGAACCGGG
G(LAAGAGCX5ACAACGTG(X'CTCCGAAGAGGTCGTGAAGAA.GA.TGAAGAACTACTGG
CGGCAGCTGCTGAACGCCAAGCTGATTACCCAGAGAAAGTTCGACAATCTGACCAA
Figure imgf000152_0001
CTGGTGGAAACCCGGCAGATCACAAAGCACGTGGCACAGATCCTGGACTCCCGGAT
GAACACTAAGTACGACGAGAATGACAAGCTGATCCGGGAAGTGAAAGTGATCACCC
TGAAGTCCAAGCTGGTGTCCGATTTCCGGAAGGATTTCCAGTTTTACAAAGTGCGCG
AGATCAACAACTACCACCACGCCCACGA.CGCCTACCTGAACGCCGTCGTGGGAACC
GCCCTGATCAAAAAGTACCCTAAGCTGGAAAGCGAGTTCGTGTACGGCGACTACAA
GGTGTACGACGTGCGGAAGATGATCGCCAAGAGCGAGCAGGAAATCGGCAAGGCT
A( X C ΧΧ'ΛΛί Π'Λ( ΊΊ CTTC "ΓΛ( Λ(ί( A AC \ΛΊΧ ATGAA( ΊΊΤΠΧ A AC ϊ AC ΧΧί AGAl ΤΛ( X
CTGGCCAACGGCGAGATCCGGAAGCGGCCTCTGATCGAGACAAACGGCGAAACCGG
( ;AC;A1X CrrGliXX.Al'AA( !C iGAi ril : 'AC n : ;AAAC; rGC X iACiC-A
TGCCCCAAGTGAATATCGTGAAAAAGACCGAGGTGCAGACAGGCGGCTTCAGCAAA
GAGTCTATCCTGCCCAAGAGGAACAGCGATAAGCTGATCGCCAGAAAGAAGGACTG
GGACCCTAAGAAGTACGGCGGCTTCGACAGCCCCACCGTGGCCTATTCTGTGCTGGT
GGTGGCCAAAGTGGAAAAGGGCAAGTCCAAGAAACTGAAGAGTGTGAAAGAGCTG
( Ί XSCXSCJAIX Λ( X A FC AlXX A ACjAAi 'ACX'l rCXiACsAACjAA l ( X Λ'Γ(ΧίΛ('Ί 'ΓΊΧ Ύ
GGAAGCCAAGGGCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCTAAGT
Λ( Ί X X TC ΠΊΧ 'GAGi ΊΧ -GAAAA( C XX C XX jAAGAGAA'i X -C 'TC X -i ΧΊ C I Gi C XX XXiA.A
CTGCAGAAGGGAAACGAACTGGCCCTGCCCTCCAAATATGTGAACTTCCTGTACCTG
GCCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGATAATGAGCAGAAACAGCT
GTTTGTGGAACAGCACAAGCACTACCTGGACGAGATCATCGAGCAGATCAGCGAGT
TCTCCAAGAGAGTGATCCTGGCCGACGCTAATCTGGACAAAGTGCTGTCCGCCTACA
ACAAGCACCGGGATAAGCCCATCAGAGAGCAGGCCGAGAATATCATCCACCTGTTT
ACCCTGACCAATCTGGGAGCCCCTGCCGCCTTCAAGTACTTTGACACCACCATCGAC
CGGAAGAGGTACACCAGCACCAAAGAGGTGCTGGACGCCACCCTGATCCACCAGAG
CATCACCGGCCTGTACGAGACACGGATCGACCTGTCTCAGCTGGGAGGCGACAGCC CCAAGAAGAAGAGAAAGGTGGAGGCCAGCTAAGGATCCGGCAAGACTGGCCCCGC TTGGCAACGCAACAGTGAGCCCCTCCCTAGTGTGTTTGGGGATGTGACTATGTATTC
GTGTGTTGGCCAACGGGTCAACCCGAACAGATTGATACCCGCCTTGGCATTTCCTGT
CAGAATGTAACGTCAGTTGATGGTACT
[00483] Sequence for a cassette driving the expression of T7 polymerase under the control of beta-2 tubulin promoter, followed by the 3' UTR of Co l :
ΘΘ484|
Figure imgf000153_0001
CGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACCCCCCGAAGCTCCTTC GGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTAAATAGCCAG
GCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCAAACACCTAG
ATCACTACCACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGCTAAGGGGG
CGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACatgcctaagaagaagaggaaggttaacacgatt aacatcgctaagaacgacttctctgacatcgaactggctgctatcccgttcaacactctggctgaccattacggtgagcgittagctcgcgaa cagttggcccttgagcatgagtettaegagatgggtgaagcacgcttccgcaagatgtttgagcgtcaacttaaagctggtgaggttgcggat aacgctgc gccaagcctctcatcactaccctactc ctaagatgattgcacgcatcaacgactggtttgaggaagtgaaagctaagcgcg gcaagcgcccgacagccttccagttcctgcaagaaatcaagccggaagccgtagcgtacatcaccattaagaceactetggcttgcctaae cagtgctgacaatacaaccgticaggctgtagcaagcgcaatcggtcgggccattgaggacgaggctcgcitcggtcgiatccgtgacctt gaagctaagcacttcaagaaaaacgttgaggaacaactcaacaagcgcgtagggcacgtctacaagaaagcaitt
gctgacatgctctctaagggtctactcggiggcgaggcgtggtcticgtggcataaggaagactctaticatgtaggagtacgctgcatcgag atgctcattgagtcaaccggaatggttagcttacaccgccaaaatgctggcgtagtaggtcaagactctgagactatcgaactcgcacctga atacgctgaggetatcgeaacccgtgcaggtgcgctggctggcatetctecgatgttccaaccttgegtagttectcetaagcegtggactgg cattactggtggtggctattgggctaacggtcgtcgtcctctggcgctggtgcgtactcacagtaagaaagcactgatgcgctacgaagacg tttacatgcctgaggtgtacaaagcgattaacattgegcaaaacacegeatggaaaatcaacaagaaagtcctagcggtcgccaacgtaatc accaagtggaagcattgtccggtcgaggacatccctgcgattgagcgtgaagaactcccgatgaaaccggaagacatcgacatgaatcct gaggctctcaecgcgtggaaacgtgctgcegctgctgtgtaccgcaaggacaaggetcgcaagtctcgcegtatcagccttgagtt ttgagcaagccaataagtttgciaaccataaggccatciggitcccttacaacaiggactggcgcggtcgigtttacgctgtgtcaatgitcaac ccgcaaggtaacgaiatgaecaaaggactgcttacgctggcgaaaggtaaaccaaicggtaaggaaggitactactggctgaa ggtgcaaacigtgcgggtgtcgacaaggttccgttccctgagcgcatcaagitcaitgaggaaaaccacgagaacatcatggcitgcgctaa gtctccactggagaacacttggtgggctgagcaagattctccgttctgcttccttgcgttctgctttgagtacgctggggtacag^ ctgagctataactgctccctlccgctggcgtttgacgggtcttgctctggcatccagcacttctccgcgatgctccgagatgaggtaggtggtc gcgcggttaacttgcttc tagtgaaaccgttcaggacatctacgggattgttgctaagaaagtcaacgagattctacaagcagacgcaatca atgggaccgaiaacgaagiagttaccgtgaccgatgagaacaciggigaaatctctgagaaagtcaagctgggcactaaggcactggctg gtcaatggciggcitacggtgttacicgcagtgtgactaagcgitcagicatgacgctggctiacgggtcc
aagigctggaagaiaccaiicagccagctattgattccggcaagggictgatgitcacicagccgaatcaggctgctggatacatggciaag ctgat tgggaateigtgagcgtgaeggtggtagctg^
aaagaiaagaagactggagagattcttcgcaagcgitgcgctgtgcattgggtaactcctgatggtttcccigtgtggcag
gcctattcagacgcgcttgaacctgatgttcctcggtcagttccgcttacagcctaccattaacaccaacaaagatagcgagattgatgcaca caaacaggagictggtaicgctcctaactttgiacacagccaagacggtagccaccttcgtaagactgtagigtgggcacacgagaagtac ggaatcgaatettttgcactgattcacgactc tt^^
acacataigagicttgtgatgtactggctgaiitciacgaccagttcgctgaccagitgcacgagtctc
ggctaaaggtaacttgaacctccgtgacatcttagagtcggacttcgcgttcgcgtaaGGATCCGGCAAGACTGGCCCC GCTTGGCAACGCAACAGTGAGCCCCTCCCTAGTGTGTTTGGGGATGTGACTATGTAT TCGTGTGTTGGCCAACGGGTCAACCCGAACAGATTGATACCCGCCTTGGCATTTCCT
GTCAGAATGTAACGTCAGTTGATGGTACT
[0048S] Sequence of guide RNA driven by the T7 promoter (T7 promoter, Ns represent targeting sequence):
00486J gaaatTAATAC: GACTCACTATANNNNNNNNNNNNNNNNNNNjNgttttagagctaG
AAAtagcaagttaaaataaggctagtccgttatcaacttgaaaaagtggcaccgagtcggtgcttttttt
[00487] Gene delivery:
[00488] Chlamydomonas reinhardtii strain CC-124 and CC- 125 from the Chlaniydomonas Resource Center will be used for electro oration. Electroporation protocol follows standard recommended protocol from the Gene Art Chlamydomonas Engineering kit.
[00489] Also, Applicants generate a line of Chlamydomonas reinhardtii that expresses Cas9 constitutively. This can be done by using pChlamyl (linearized using Pvul) and selecting for hygromycin resistant colonies. Sequence for pChlamyl containing Cas9 is below. In this way to achieve gene knockout one simply needs to deliver RNA for the guideRNA. For homologous recombination Applicants deliver guideRNA as well as a linearized homologous recombination template.
[00490] pChlamyl-Cas9:
[00491] TGCGGTATTTCACACCGCATCAGGTGGCACTTTTCGGGGAAATGTGCGCG GAACCXX7rATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCG(7r(LATGAGATT ATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAAT CTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGC
ACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTG
TAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCG
CGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAG
GGC XX sAGC XX AGAAGTGGTC "FGCA AC ΊΊΎΑΊΧ XX ΊΧ X \Vi ( AGT( X ATTAATTG
TTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGC
( ΑΊΊΧ Ϊ(Ί Λ( A( K 'Al X7r( :r! GX i Λί Χ Ί ΧΓΓί 'ί ΠΊΊ ί Τ! AlX iG( ll ( Λ ΓΊ ί · Γ( ·(-
GGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTT
AGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTC
ATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTT
CTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGA
GTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAA
AAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGC
TG FTGAGATC C \GTTC GATG F ArCX 'Ar rrGT ^^
TACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAA
Figure imgf000155_0001
ATTGAAGCATTTATCAGGGTTATTGTCTCATGACCAAAATCCCTTAACGTGAGTTTTC
GTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTT
TTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGT
TTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAG
AG(XiCAGATACCAAATA(TrGTT(jrT(rrAGTGTAG( GTAGTTAGG(X A(XLACTTCAA
GAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGTT
( X X AGTi XX GATAAi Π Χ.Π ( ΠΧ TTACX ;G( ·'Π X XJACTCAAGAC · Ί AC Π ΊΆ( X sGAT
AAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCG
AACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGC
TTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGG
AGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCG
GGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGA
GCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGC
( 'Ί Ί ΊΊΧ Ί ( AC 'A'l ί Π'ΊΧ Ί'Ί'Ί ( Τ( ί( Χ}'Π ΛΊ X ( Χ:"Γ(}ΛΊ"!Χ ΊΧ Π Χ = ΑΊ ΑΛ( ( ( ΠΆΊ Ί Λί X '
GCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTC AGTGAGCGAGGAAGCGGTCGCTGAGGCTTGACATGATTGGTGCGTATGTTTGTATGA AGCTACAGGACTGATTTGGCGGGCTATGAGGGCGGGGGAAGCTCTGGAAGGGCCGC GATGGGGCGCGCGGCGTCCAGAAGGCGCCATACGGCCCGCTGGCGGCACCCATCCG GTATAAAAGCCCGCGACCCCGAACGGTGACCTCCACTTTCAGCGACAAACGAGCAC
Τ ΑΤΛ('ΑΤΛ( ( Χ.ίΛ<Ί ATTCTGCXX.^
CATCAAGCTTGCATGCCGGGCGCGCCAGAAGGAGCGCAGCCAAACCAGGATGATGT
nX ATGGGGTATTTGAGCACTlXX'AAC C TTATC XXiGAAGi ΧΧΧΧΊ GG('( { AC AAG
GCTAGGCGCCAATGCAAGCAGTTCGCATGCAGCCCCTGGAGCGGTGCCCTCCTGAT
AAACCGGCCAGGGGGCCTATGTTCTTTACTTTTTTACAAGAGAAGTCACTCAACATC
TTAAAATGGCCAGGTGAGTCGACGAGCAAGCCCGGCGGATCAGGCAGCGTGCTTGC
AGATTTGACTTGCAACGCCCGCATTGTGTCGACGAAGGCTTTTGGCTCCTCTGTCGCT
GTCTCAAGCAGCATCTAACCCTGCGTCGCCGTTTCCATTTGCAGGAGATTCGAGGTA
CCATGTACCCATACGATGTTCCAGATTACGCTTCGCCGAAGAAAAAGCGCAAGGTC
(JAAC XrrC'i CiA( AAGAAiHAC nC AlXX}Ci(X'l'( ;AC\Vr('{JGi A(X ΛΛίΊίΊίΠΧ ;:
CTGGGCCGTGATCACCGACGAGTACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGG
G< \\ACACXX}A<XXXX ACAG('ATC\\AGAAGAA
AGCGGCGAAACAGCCGAGGCCACCCGGCTGAAGAGAACCGCCAGAAGAAGATACA CCAGACGGAAGAACCGGATCTGCTATCTGCAAGAGATCTTCAGCAACGAGATGGCC AAGGTGGACGACAGCTTCTTCCACAGACTGGAAGAGTCCTTCCTGGTGGAAGAGGA TAAGAAGCACGAGCGGCACCCCATCTTCGGCAACATCGTGGACGAGGTGGCCTACC ACGAGAAGTACCCCACCATCTACCACCTGAGAAAGAAACTGGTGGACAGCACCGAC AAGGCCGACCTGCGGCTGATCTATCTGGCCCTGGCCCACATGATCAAGTTCCGGGGC
C\\C TTa TGATC GAGCX XsACX'
CATCCAGCTGGTGCAGACCTACAACCAGCTGTTCGAGGAAAACCCCATCAACGCCA
GCGGCGTGGACGCCAAGGCCATCCTGTCTGCCAGACTGAGCAAGAGCAGACGGCTG
GAAAATCTGATCGCCCAGCTGCCCGGCGAGAAGAAGAATGGCCTGTTCGGCAACCT
GATTGCCCTGAGCCTGGGCCTGACCCCCAACTTCAAGAGCAACTTCGACCTGGCCGA
GGATGCCAAACTGCAGCTGAGCAAGGACACCTACGACGACGACCTGGACAACCTGC
TGGCCCAGATCGGCGACCAGTACGCCGACCTGTTTCTGGCCGCCAAGAACCTGTCCG
ACX ( ΛΊ(Χ Ί ί Ί : ( ίίΛί AICXlGAGACn iAAC-ACXX^AGA-fX'ACX-AAGiiCXX ί (
CTGAGCGCCTCTATGATCAAGAGATACGACGAGCACCACCAGGACCTGACCCTGCT GAAAGCTCTCGTGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATTTTCTTCGACC AGAGCAAGAACGGCTACGCCGGCTACATTGACGGCGGAGCCAGCCAGGAAGAGTTC TACAAGTTCATCAAGCCCATCCTGGAAAAGATGGACGGCACCGAGGAACTGCTCGT GAAGCTGAACAGAGAGGACCTGCTGCGGAAGCAGCGGACCTTCGACAACGGCAGC
ΛΊ ( X X C 'Λί X AGA1 CX'ACX' l GC XiAGAGi TC X'AC XX X ATTCTGC XX X ·( 'AC IGAAGA TTTTTACCCATTCCTGAAGGACAACCGGGAAAAGATCGAGAAGATCCTGACCTTCCG
( ΑΊ χ Ί'Α(Ί·Λ( ίπ '( i i i iGi (^ ( :Χ ::Α Λ(Α(;(Α(:ΑΊΊ ci( ( Ί'( ::ΛΊ ;Α
CCAGAAAGAGCGAGGAAACCATCACCCCCTGGAACTTCGAGGAAGTGGTGGACAA
GGGCGCTTCCGCCCAGAGCTTCATCGAGCGGATGACCAACTTCGATAAGAACCTGC
CCAACGAGAAGGTGCTGCCCAAGCACAGCCTGCTGTACGAGTACTTCACCGTGTAT
AACGAGCTGACCAAAGTGAAATACGTGACCGAGGGAATGAGAAAGCCCGCCTTCCT
GAGCGGCGAGCAGAAAAAGGCCATCGTGGACCTGCTGTTCAAGACCAACCGGAAA
GTGACCGTGAAGCAGCTGAAAGAGGACTACTTCAAGAAAATCGAGTGCTTCGACTC
CXXSGGAAATi ΊΧ (Χ :Χ ΓίΧ}ΛΛί;Λ·!( ίΧ !Ί ('ΑΑ( (;(ΧΊ ( ί (ΊΧΧ :·Α(·ΑΊ ACX'ACX;
ATCTGCTGAAAATTATCAAGGACAAGGACTTCCTGGACAATGAGGAAAACGAGGAC
ΑΊΊΧΊί ^ΑΑί^ΛΊ'ΑΊΧ G1G(XXiA( CXlX}A(A(XXnilXiACiGA(A(;AGAGA'!XiA'!iXiA
GGAACGGCTGAAAACCTATGCCCACCTGTTCGACGACAAAGTGATGAAGCAGCTGA
AGCGGCGGAGATACACCGGCTGGGGCAGGCTGAGCCGGAAGCTGATCAACGGCATC
CGGGACAAGCAGTCCGGCAAGACAATCCTGGATTTCCTGAAGTCCGACGGCTTCGC
CAACAGAAACTTCATGCAGCTGATCCACGACGACAGCCTGACCTTTAAAGAGGACA
1(X'AGAAAG(X (\\ίΧ7Γ(ΠΧ C : A(XK JAI'AGC ίΊΧΧ-ACX^AGi Λ(-Α·Γ! : -Α Ί
CTGGCCGGCAGCCCCGCCATTAAGAAGGGCATCCTGCAGACAGTGAAGGTGGTGGA
C 'GAGi Ί ( X sT AAAG'i GA l GC XX C XX X'AC AAG( X C ί AGAAi A TCGTi JAI ( X JAAAI ( -G
CCAGAGAGAACCAGACCACCCAGAAGGGACAGAAGAACAGCCGCGAGAGAATGAA
GCGGATCGAAGAGGGCATCAAAGAGCTGGGCAGCCAGATCCTGAAAGAACACCCC
GTGGAAAACACCCAGCTGCAGAACGAGAAGCTGTACCTGTACTACCTGCAGAATGG
GCGGGATATGTACGTGGACCAGGAACTGGACATCAACCGGCTGTCCGACTACGATG
TGGACCATATCGTGCCTCAGAGCTTTCTGAAGGACGACTCCATCGACAACAAGGTGC
TGACCAGAAGCGACAAGAACCGGGGCAAGAGCGACAACGTGCCCTCCGAAGAGGT
( nXiAACiAAGAlXiAAGAACXACXGCiCX ^ AG( '!Xi(-1GAA(XX ( AACiC-I CiAI-r i XX
AGAGAAAGTTCGACAATCTGACCAAGGCCGAGAGAGGCGGCCTGAGCGAACTGGAT AAGGCCGGCTTCATCAAGAGACAGCTGGTGGAAACCCGGCAGATCACAAAGCACGT GGCACAGATCCTGGACTCCCGGATGAACACTAAGTACGACGAGAATGACAAGCTGA TCCGGGAAGTGAAAGTGATCACCCTGAAGTCCAAGCTGGTGTCCGATTTCCGGAAG
GATTTCCAGTTTTACAAAGTGCGCGAGATCAACAACTACCACCACGCCCACGACGCC
lACX'l'CiAACX ( riC n iGCiAAC ί :Χ Ί'ί!ΛΊ(-ΛΛΛΛΛβΊ Λ(ΧΧΊ ΛΛαίΊΧ;αΛΛΛΟ
CGAGTTCGTGTACGGCGACTACAAGGTGTACGACGTGCGGAAGATGATCGCCAAGA
G C G A G { A. ( i C ! Λ A. ΑΊΧ C X s C ' Λ Λ C ( · ( Ύ A ( X C X X A. Λ C i ' Γ ;\ ί ' 1 'Ί X " ! 1 ( Ί ;\ ί A G C ' Λ Λ ( ' ΛΊ ( A. ' !
AACTTTTTCAAGACCGAGATTACCCTGGCCAACGGCGAGATCCGGAAGCGGCCTCT
GATCGAGACAAACGGCGAAACCGGGGAGATCGTGTGGGATAAGGGCCGGGATTTTG
CCACCGTGCGGAAAGTGCTGAGCATGCCCCAAGTGAATATCGTGAAAAAGACCGAG
GTGCAGACAGGCGGCTTCAGCAAAGAGTCTATCCTGCCCAAGAGGAACAGCGATAA
GCTGATCGCCAGAAAGAAGGACTGGGACCCTAAGAAGTACGGCGGCTTCGACAGCC
CCACCGTGGCCTATTCTGTGCTGGTGGTGGCCAAAGTGGAAAAGGGCAAGTCCAAG
A AACTGA AC Ϊ AG1 GTGAAAGAGCl GC ΊΧ XX XiATCAC C VYi (' .TC X ·ΛΛΛί · AAG( AGC ΊΎ
CGAGAAGAATCCCATCGACTTTCTGGAAGCCAAGGGCTACAAAGAAGTGAAAAAGG
Α(ΧΊΧ:ΑΊΧ \Ί('ΑΛ( :ΊΧ ΊΑΛ(Π \ίΊ(Χ Cl riX X^AGi lXiGAAAAC (Χ ΧΧ ΪΑΛΟ
AGAATGCTGGCCTCTGCCGGCGAACTGCAGAAGGGAAACGAACTGGCCCTGCCCTC
CAAATATGTGAACTTCCTGTACCTGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCC
CGAGGATAATGAGCAGAAACAGCTGTTTGTGGAACAGCACAAGCACTACCTGGACG
AGATCATCGAGCAGATCAGCGAGTTCTCCAAGAGAGTGATCCTGGCCGACGCTAAT
("I (s( ) AC 'ΛΛΛί ΠΧ X Ί X ·Τ( X XX X TAC Α( ΛΛί JCAC X XX XiATA GC X X 'ΛΊ CAGAGAGC A
GGCCGAGAATATCATCCACCTGTTTACCCTGACCAATCTGGGAGCCCCTGCCGCCTT
C 'AAGTAC "ΓΊ'Τί · A( ACX'ACX'ATC AC XXX sAAGAGC Π'Λί ACX AGC A( C AAAGAGC ΠΧΧ
TGGACGCCACCCTGATCCACCAGAGCATCACCGGCCTGTACGAGACACGGATCGAC
CTGTCTCAGCTGGGAGGCGACAGCCCCAAGAAGAAGAGAAAGGTGGAGGCCAGCT
AACATATGATTCGAATGTCTTTCTTGCGCTATGACACTTCCAGCAAAAGGTAGGGCG
GGCTGCGAGACGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACCCCCCG
AAGCTCCTTCGGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTA
AATAGCCAGGCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCA
AACACX' l AC sATC AC ! AC X 'Λί Ί'Ί CTAC 'AC AGC XX AC ! CG AGC "ΓΊΧ JTG ATC XX *Λ<Ί (XX ·
CTAAGGGGGCGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACATGACACAAGA ATCCCTGTTACTTCTCGACCGTATTGATTCGGATGATTCCTACGCGAGCCTGCGGAA CGACCAGGAATTCTGGGAGGTGAGTCGACGAGCAAGCCCGGCGGATCAGGCAGCGT GCTTGCAGATTTGACTTGCAACGCCCGCATTGTGTCGACGAAGGCTTTTGGCTCCTCT GTCGCTGTCTCAAGCAGCATCTAACCCTGCGTCGCCGTTTCCATTTGCAGCCGCTGG
C X XX XX iAGC ( l iAi iGAGi l i C iGC i(l X}C rrC ( ( '( C iGl ( :-'rG( C iGC nXX ( (■
GGCGAGAGCACCAACCCCGTACTGGTCGGCGAGCCCGGCCCGGTGATCAAGCTGTT
( '( -Gi C ! AC iC AC " IX X sTC X sG'l < X ί jGAGAGi C " f'C XX C 1 IX XX ) AC 1 !'( XX ) AC XX G'l AC (X ί iG
TCCTGGCGGACGCCCCGGTGCCGGTGCCCCGCCTCCTCGGCCGCGGCGAGCTGCGGC
CCGGCACCGGAGCCTGGCCGTGGCCCTACCTGGTGATGAGCCGGA.TGACCGGCA.ee
ACCTGGCGGTCCGCGATGGACGGCACGACCGACCGGAACGCGCTGCTCGCCCTGGC
CCGCGAACTCGGCCGGGTGCTCGGCCGGCTGCACAGGGTGCCGCTGACCGGGAACA
CCGTGCTCACCCCCCATTCCGAGGTCTTCCCGGAACTGCTGCGGGAACGCCGCGCGG
CGACCGTCGAGGACCACCGCGGGTGGGGCTACCTCTCGCCCCGGCTGCTGGACCGC
Figure imgf000159_0001
CGTCCACGGCGACCTGCACGGGACCAACATCTTCGTGGACCTGGCCGCGACCGAGG
1 ("AC CX.fi' X iATC Χ Π'ί C sAC TTC A X 'i C ITCTA Gi XX iGAGACTCCi ί iCTAC AGC "!XX ·
TGCAACTGCATCTCAACGCCTTCCGGGGCGACCGCGAGATCCTGGCCGCGCTGCTCG
ACGGGGCGCAGTGGAAGCGGACCGAGGACTTCGCCCGCGAACTGCTCGCCTTCACC
TTCCTGCACGACTTCGAGGTGTTCGAGGAGACCCCGCTGGATCTCTCCGGCTTCACC
GATCCGGAGGAACTGGCGCAGTTCCTCTGGGGGCCGCCGGACACCGCCCCCGGCGC
ΓΊ GA 1 AAGGATi C X X sC \\.AX}
CTAGTGTGTTTGGGGATGTGACTATGTATTCGTGTGTTGGCCAACGGGTCAACCCGA
Λ( 'Λ(.ίΛΊ'ΊΧΊΛ'1'Λ(ΧΧ ί ΧΧ 'Ί Γ(. Χ\\Ί"
T
[00492] For all modified Chlamydomonas remhardtii cells, Applicants used PGR, SURVEYOR nuclease assay, and DNA sequencing to verify successful modification.
Example 16: Use of Cas9 as a transcriptional repressor in bacteria
[00493] The ability to artificially control transcription is essential both to the study of gene function and to the construction of synthetic gene networks with desired properties. Applicants describe here the use of the RNA-guided Cas9 protein as a programmable transcriptional repressor.
[004941 Applicants have previously demonstrated how the Cas9 protein of Streptococcus pyogenes SF370 can be used to direct genome editing in Streptococcus pneumoniae. In this study Applicants engineered the crR6Rk strain containing a minimal CRISPR system, consisting of cas9, the tracrRNA and a repeat. The D1GA-H84G mutations were introduced into cas9 in this strain, giving strain crR6Rk**. Four spacers targeting different positions of the bgoA β- gaiactosidase gene promoter were cloned in the CRISPR array carried by the previously described pDB98 plasmid. Applicants observed a X to Y fold reduction in β-gaiactosidase activity depending on the targeted position, demonstrating the potential of Cas9 as a programmable repressor (Figure 73).
[004951 To achieve Cas9** repression in Escherichia coli a green fluorescence protein (GFP) reporter plasimd (pDB127) was constructred to express the gfpmutl gene from a constitutive promoter. The promoter was designed to carry several NPP PAMs on both strands, to measure the effect of Cas9** binding at various positions. Applicants introduced the D10A-H840 mutations into pCas9, a plasmid described carrying the tracrRNA, cas9 and a minimal CRISPR array designed for the easy cloning of new spacers. Twenty-two different spacers were designed to target different regions of the gfpmut2 promoter and open reading frame. An approximately 20-fold reduction of fluorescence of was observed upon targeting regions overlapping or adjacent to the -35 and -10 promoter elements and to the Shine-Dalgarno sequence. Targets on both strands showed similar repression levels. These results suggest that the binding of Cas9** to any position of the promoter region prevents transcription initiation, presumably through steric inhibition of RNAP binding.
[00496] To determine whether Cas9** could prevent transcription elongation, Applicants directed it to the reading frame of gpfmutl. A reduction in fluorescence was observed both when the coding and non-coding strands where targeted, suggesting that Cas9 binding is actually strong enough to represent an obstacle to the running RNAP. However, while a 40% reduction in expression was observed when the coding strand was the target, a 20-fold reduction was observed for the non-coding strand (Fig 21b, compare T9, T10 and Ti l to B9, BIO and Bl 1). To direct!)? determine the effects of Cas9** binding on transcription, Applicants extracted RNA from strains cairying either the T5, T10, B10 or a control construct that does not target pDB127 and subjected it to Northern blot analysis using either a probe binding before (B477) or after (B510) the BI O and T10 target sites. Consistent with Applicants' fluorescence methods, no gfpmutl transcription was detected when Cas9** was directed to the promoter region (T5 target) and a transcription was observed after the targeting of the T10 region. Interestingly, a smaller transcript was observed with the B477 probe. This band corresponds to the expected size of a transcript that would be interrupted by Cas9**, and is a direct indication of a transcriptional termination caused by dgRNA::Cas9** binding to the coding strand. Surprisingly, Applicants detected no transcript when the non-coding strand was targeted (BIO). Since Cas9** binding to the BIO region is unlikely to interfere with transcription initiation, this result suggests that the mRNA was degraded. DgRNA::Cas9 was shown to bind ssRNA in vitro. Applicants speculate that binding may trigger degradation of the mRNA by host nucleases. Indeed, ribosome stalling can induce cleavage on the translated mRNA in E. coli.
[00497] Some applications require a precise tuning gene expression rather than its complete repression. Applicants sought to achieve intermediate repression levels through the introduction of mismatches that will weaken the crRNA/target interactions. Applicants created a series of spacers based on the Bl, T5 and BI O constructs with increasing numbers of mutations in the 5' end of the crRNA. Up to 8 mutations in Bl and T5 did not affect the repression level, and a progressive increased in fluorescence was observed for additional mutations.
[00498] The observed repression with only an 8nt match between the crRNA and its target raises the question of off-targeting effects of the use of Cas9** as a transcriptional regulator. Since a good PAM (NGG) is also required for Cas9 binding, the number of nucleotides to match to obtain some level of respiration is 10. A lOnt match occurs randomly once every - I Mbp, and such sites are thus likely to be found even in small bacterial genomes. However, to effectively repress transcription, such site needs to be in the promoter region of gene, which makes off-targeting much less likely. Applicants also showed that gene expression can be affected if the non-coding strand of a gene is targeted. For this to happen, a random target would have to be in the right orientation, but such events relatively more likely to happen. As a matter of fact, during the course of this study Applicants were unable to construct one of the designed spacer on pCas9**. Applicants later found this spacer showed a 12bp match next to a good PAM in the essential miirC gene. Such off-targeting could easily be avoided by a systematic blast of the designed spacers. [00499] Aspects of the invention are further described in the following numbered paragraphs:
1. A vector system comprising one or more vectors, wherein the system comprises a. a first regulatory element operably linked to a traer mate sequence and one or more insertion sites for inserting a guide sequence upstream of the traer mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme complex ed with (!) the guide sequence that is hybridized to the target sequence, and (2) the traer mate sequence that is hybridized to the traer sequence; and
b. a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence;
wherein components (a) and (b) are located on the same or different vectors of the system.
2. The vector system of paragraph 1, wherein compo ent (a) further comprises the traer sequence downstream of the traer mate sequence under the control of the first regulatory element,
3. The vector system of paragraph 1, wherein component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cell.
4. The vector system of paragraph 1 , wherein the system comprises the traer sequence under the control of a third regulatory el ement.
5. The vector system of paragraph 1, wherein the traer sequence exhibits at least 50% of sequence complementarity along the length of the traer mate sequence when optimally aligned.
6. The vector system of paragraph 1, wherein the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
7. The vector system of paragraph 1, wherein the CRISPR enzyme is a type II CRISPR system enzyme.
8. The vector system of paragraph 1 , wherein the CRISPR enzyme is a Cas9 enzyme. 9. The vector system of paragraph 1, wherein the CRISPR enzyme is codon- optimized for expression in a eukaryotie ceil.
10. The vector system of paragraph 1 , wherein the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence.
11. The vector system of paragraph 1 , wherein the CRISPR enzyme lacks DNA strand cleavage activity.
12. The vector system of paragraph 1, wherem the first regulatory element is a polymerase III promoter.
13. The vector system of paragraph 1, wherein the second regulatory element is a polymerase II promoter.
14. The vector system of paragraph 4, wherein the third regulatory element is a polymerase ΪΙΙ promoter.
15. The vector system of paragraph 1, wherein the guide sequence is at least 15 nucleotides in length.
16. The vector system of paragraph 1, wherein fewer than 50% of the nucleotides of the guide sequence participate in self-complementary base-pairing when optimal ly folded.
17. A vector comprising a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising one or more nuclear localization sequences, wherein said regulatory element drives transcription of the CRISPR enzyme in a eukaryotie cell such that said CRISPR enzyme accumulates in a detectable amount in the nucleus of the eukaryotie cell.
18. The vector of paragraph 17, wherein said regulatory element is a polymerase II promoter.
19. The vector of paragraph 17, wherein said CRISPR enzyme is a type IICRISPR system enzyme.
20. The vector of paragraph 17, wherein said CRISPR enzyme is a Cas9 enzyme.
21. The vector of paragraph 17, wherem said CRISPR. enzyme lacks the ability to cleave one or more strands of a target sequence to which it binds.
22. A CRISPR enzyme comprising one or more nuclear localization sequences of sufficient strength to drive accumulation of said CR ISPR enzyme in a detectable amount in the nucleus of a eukaryotie cell. 23. The CRISPR enzyme of paragraph 22, wherein said CRISPR enzyme is a type IICRISPR system enzyme,
24. The CRISPR enzyme of paragraph 22, wherein said CRISPR enzyme is a Cas9 enzyme.
25. The CRISPR enzyme of paragraph 22, wherein said CRISPR enzyme lacks the ability to cleave one or more strands of a target sequence to which it binds.
26. A eukaryotie host ceil comprising:
a. a first regulatory element operablv linked to a traer mate sequence and one or more insertion sites for inserting a guide sequence upstream of the traer mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotie cell, wherein the CRISPR complex comprises a CRISPR enzyme complex ed with (1) the guide sequence that is hybridized to the target sequence, and (2) the traer mate sequence that is hybridized to the traer sequence; and/or
b. a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence.
27. The eukaryotie host cell of paragraph 26, wherein said host cell comprises components (a) and (b).
28. The eukaryotie host cell of paragraph 26, wherein component (a), component (b), or components (a) and (b) are stably integrated into a genome of the host eukaryotie cell.
29. The eukatyotie host cell of paragraph 26, wherein component (a) further comprises the traer sequence downstream of the traer mate sequence under the control of the first regulatory element.
30. The eukaryotie host cell of paragraph 26, wherein component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotie ceil.
31. The eukaryotie host cell of paragraph 26, further comprising a third regulator}' element operably linked to said traer sequence.
32. The eukaryotie host cell of paragraph 26, wherein the traer sequence exhibits at least 50% of sequence complementarity along the length of the traer mate sequence when optimally aligned. 33. The eukaryotie host cell of paragraph 26, wherein the CRJSPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CR!SPR enzyme in a detectable mount in the nucleus of a eukaryotie cell.
34. The eukaryotie host cell of paragraph 26, wherein the CRISPR enzyme is a type II CRISPR system enzyme.
35. The eukaryotie host cell of paragraph 26, wherein the CRISPR enzyme is a Cas9 enzyme.
36. The eukaryotie host cell of paragraph 26, wherein the CRISPR enzyme is codon- optimized for expression in a eukaryotie cell .
37. The eukaryotie host cell of paragraph 26, wherein the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence.
38. The eukaryotie host cell of paragraph 26, wherein the CRISPR enzyme lacks D A strand cleavage activity.
39. The eukaryotie host cell of paragraph 26, wherein the first regulatory element is a polymerase III promoter.
40. The eukaryotie host cell of paragraph 26, wherein the second regulatory element is a polymerase II promoter.
41. The eukaryotie host cell of paragraph 31, wherein the third regulatory el ement is a polymerase III promoter.
42. The eukaryotie host cell of paragraph 26, wherein the guide sequence is at least 15 nucleotides in length.
43. The eukaryotie host ceil of paragraph 26, wherein fewer than 50% of the nucleotides of the guide sequence participate in self-complementary base-pairing when optimally folded.
44. A non-human animal comprising a eukaryotie host cell of any one of paragraphs
26-43.
45. A kit comprising a vector system and instructions for using said kit, the vector system comprising:
a. a first regulatory element operably linked to a traer mate sequence and one or more insertion sites for inserting a guide sequence upstream of the traer mate sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme eompiexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the traer mate sequence that is hybridized to the traer sequence; and/or
b. a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence.
46. The kit of paragraph 45, wherei said kit comprises components (a) and (b) located on the same or different vectors of the system.
47. The kit of paragraph 45, wherein component (a) further comprises the traer sequence downstream of the traer mate sequence under the control of the first regulatory element.
48. The kit of paragraph 45, wherein component (a) further comprises two or more guide sequences operably linked to the first regulatory element, wherein when expressed, each of the two or more guide sequences direct sequence specific binding of a CRISPR complex to a different target sequence in a eukaryotic cel l.
49. The kit of paragraph 45, wherein the system comprises the traer sequence under the control of a third regulatory element.
50. The kit of paragraph 45, wherein the traer sequence exhibits at least 50% of sequence complementarity along the length of the traer mate sequence when optimally aligned.
51. The kit of paragraph 45, wherein the CRISPR enzyme comprises one or more nuclear localization sequences of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable mount in the nucleus of a eukaryotic cel l.
52. The kit of paragraph 45, wherein the CRISPR enzyme is a type II CRISPR system enzyme.
53. The kit of paragraph 45, wherein the CRISPR enzyme is a Cas9 enzyme.
54. The kit of paragraph 45, wherein the CRISPR enzyme is codo -optimized for expression in a eukaryotic cell.
55. The kit of paragraph 45, wherein the CRISPR enzyme directs cleavage of one or two strands at the location of the target sequence.
56. The kit of paragraph 45, wherein the CRISPR enzyme lacks DNA strand cleavage activity. 57. The kit of paragraph 45, wherein the first regulatory element is a polymerase III promoter.
58. The kit of paragraph 45, wherein the second regulatory element is a polymerase 11 promoter.
59. The kit of paragraph 49, wherein the third regulatory element is a polymerase III promoter.
60. The kit of paragraph 45, wherein the guide sequence is at least 15 nucleotides in length.
61. The kit of paragraph 45, wherem fewer than 50% of the nucleotides of the guide sequence participate in self-complementary base-pairing when optimally folded.
62. A computer system for selecting a candidate target sequence within a nucleic acid sequence in a eukaryotic cell for targeting by a CRISPR complex, the system comprising:
a. a memory unit configured to receive and/or store said nucleic acid sequence; and b. one or more processors alone or in combination programmed to (i) locate a CRISPR motif sequence within said nucleic acid sequence, and (ii) select a sequence adjacent to said located CR ISPR motif sequence as the candidate target sequence to which the CRISPR complex binds.
63. The computer system of paragraph 62, wherein said locating step comprises identifying a CRISPR motif sequence located less than about 500 nucleotides away from said target sequence.
64. The computer system of paragraph 62, wherein said candidate target sequence is at least 10 nucleotides in length.
65. The computer system of paragraph 62, wherein the nucleotide at the 3' end of the candidate target sequence is located no more than about 10 nucleotides upstream of the CRISPR motif sequence.
66. The computer system of paragraph 62, wherein the nucleic acid sequence in the eukaryotic cell is endogenous to the eukaryotic genome.
67. The computer system of clam 62, wherein the nucleic acid sequence in the eukaryotic cell is exogenous to the eukaryotic genome.
68. A computer-readable medium comprising codes that, upon execution by one or more processors, implements a method of selecting a candidate target sequence within a nucleic acid sequence in a eukaryotic ceil for targeting by a CRISPR complex, said method comprising: (a) locating a CRISPR motif sequence within said nucleic acid sequence, and (b) selecting a sequence adjacent to said located CRISPR motif sequence as the candidate target sequence to which the CRISPR complex binds.
69. The computer-readable medium of paragraph 68, wherein said locating comprises locating a CRISPR motif sequence that is less than about 500 nucleotides away from said target sequence.
70. The computer-readable of paragraph 68, wherein said candidate target sequence is at least 10 nucleotides in length.
71. The computer-readable of paragraph 68, wherein the nucleotide at the 3 ' end of the candidate target sequence is located no more than about 10 nucleotides upstream of the CRISPR motif sequence.
72. The computer-readable of paragraph 68, wherein the nucleic acid sequence in the eukaryotic cel l is endogenous the eukaryotic genome.
73. The computer-readable of paragraph 68, wherein the nucleic acid sequence in the eukaryotic cell is exogenous to the eukaryotic genome.
74. A method of modifying a target polynucleotide in a eukaryotic cell, the method comprising allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a traer mate sequence which in turn hybridizes to a traer sequence.
75. The method of paragraph 74, wherein said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme.
76. The method of paragraph 74, wherein said cleavage results in decreased transcription of a target gene.
77. The method of paragraph 74, further comprising repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. 78. The method of paragraph 77, wherein said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
79. The method of paragraph 74, further comprising delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the traer mate sequence, and the traer sequence.
80. The method of paragraph 79, wherein said vectors are delivered to the eukaryotic cell in a subject.
81. The method of paragraph 74, wherein said modifying takes place in said eukaryotic cell in a cell culture.
82. The method of paragraph 74, further comprising isolating said eukaryotic cell from a subject prior to said modifying.
83. The method of paragraph 82, further comprising returning said eukaryotic cell and/or cells derived therefrom to said subject.
84. A method of modifying expression of a polynucleotide in a eukaryotic cell, the method compnsmg: allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a traer mate sequence which in turn hybridizes to a traer sequence.
85. The method of paragraph 74, further comprising delivering one or more vectors to said eukaryotic cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the traer mate sequence, and the traer sequence.
86. A method of generating a model eukaryotic cell comprising a mutated disease gene, the method comprising:
a. introducing one or more vectors into a eukaryotic cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a traer mate sequence, and a traer sequence; and
b. allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said disease gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the traer mate sequence that is hybridized to the traer sequence, thereby generating a model eukaryotic cell comprising a mutated disease gene,
87. The method of paragraph 86, wherein said cleavage comprises cleaving one or two strands at the location of the target sequence by said CR1SPR enzyme.
88. The method of paragraph 86, wherein said cleavage results in decreased transcription of a target ge e.
89. The method of paragraph. 86, further comprising repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide.
90. The method of paragraph 89, wherein said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
91. A method of developing a biologically active agent that modulates a cell signaling event associated with a disease gene, comprising:
a. contacting a test compound with a model cell of any one of paragraphs 86-90; and b. detecting a change in a readout that is indicative of a reduction or an augmentation of a cell signaling event associated with said mutation in said disease gene, thereby developing said biologically active agent that modulates said cell signaling event associated with said disease gene.
92. A recombinant polynucleotide comprising a guide sequence upstream of a traer mate sequence, wherein the guide sequence when expressed directs sequence-specific binding of a CRISPR complex to a corresponding target sequence present in a eukaryotic cell.
93. The recombinant polynucleotide of paragraph 89, wherein the target sequence is a viral sequence present in a eukaryotic cell.
94. The recombinant polynucleotide of paragraph 89, wherein the target sequence is a proto-oncogene or an oncogene.
[00500] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
[00501] References:
1. Uroov, F.D., Rebar, E.J., Holmes, M.C., Zhang, H.S. & Gregory, P.D. Genome editing with engineered zinc finger nucleases. Nat. Rev. Genet. 11 , 636-646 (2010).
2. Bogdanove, A.J. & Voytas, D.F. TAL effectors: customizable proteins for DNA targeting. Science 333, 1843-1846 (201 1).
3. Stoddard, B.L. Homing endonuclease structure and function. O. Rev. Biophys. 38, 49- 95 (2005).
4. Bae, T. & Schneewind, O. Allelic replacement in Staphylococcus aureus with inducible counter-selection. Plasmid 55, 58-63 (2006).
5. Sung, C.K., Li, H., Claverys, J.P. & Morrison, D.A. An rpsL' cassette, janus, for gene replacement through negative selection in Streptococcus pneumoniae. Appl. Environ. Microbiol. 67, 5190-5196 (2001).
6. Siiaran, S.K., Thomason, L.C., uznetsov, S.G. & Court, D.L. Recombineering: a homologous recombination-based method of genetic engineering. Nat. Protoc. 4, 206-223 (2009).
7. Jinek, M. et al. A programmable dual -R.NA- guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012).
8. Deveau, FL, Garneau, J.E. & Moineau, S. CRISPRCas system and its role in phage- bacteria interactions. Annu. Rev. Microbiol, 64, 475-493 (2010).
9. Horvath, P. & Barrangou, R. CRISPRCas, the immune system of bacteria and archaea. Science 327, 167-170 (2010).
10. Terns, M.P. & Terns, ELM. CRISPR-based adaptive immune systems. Ciirr. Opin. Microbiol. 14, 321 -327 (2011).
11. van der Oost, J., Jorc, MM., Westra, E.R., Lundgren, M. & Brouns, S.J. CRJSPR - based adaptive and heritable immunity in prokaryotes. Trends. Biochem. Sci. 34, 401-407 (2009).
12. Brouns, S.J. et al. Small CRISPR RNAs guide antiviral defense in prokaryotes. Science 321, 960-964 (2008). 13. Carte, J., Wang, R., Li, H., Terns, R.M. & Terns, M.P. Cas6 is an endoribonuelease thai generates guide RNAs for invader defense in prokaryotes. Genes Dev. 22, 3489-3496 (2008).
14. Deitcheva, E, et al. CRISPR. RNA maturation by trans-encoded small RNA. and host factor RNase III Mature 471, 602-607 (2011).
15. Hatoum-Aslan, A., Maniv, I. &. Marraffini, L.A. Mature clustered, regularly interspaced, short, palindromic repeats RNA (crR A) length is measured by a ruler mechanism anchored at the precursor processing site. Proc. Natl, Acad. Sci, U.S.A. 108, 21218-21222
(2011) .
16. Haurwitz, R.E., Jinek, M, Wiedenheft, B., Zhou, . & Doudna, J.A. Sequence- and sm cture-specific RNA processing by a CRISPR endonuclea.se. Science 3.29, 1355-1358 (20.10).
17. Deveau, H. et al. Phage response to CRISPR-encoded resistance in Streptococcus thermophilus. J. Bacteriol. 190, 1390-1400 (2008).
18. Gasiunas, G., Barrangou, R,, Horvath, P. & Siksnys, V, Cas9-crR A ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc. Natl. Acad. Sci. U.S.A. (2012).
19. Makarova, .S., Aravind, L., Wolf, Y.I. & Koonin, E.V. Unification of Cas protein families and a simple scenario for the origin and evolution of CRI SPR -Cas systems. Biol. Direct. 6, 38 (201 1).
20. Barrangou, R. RNA -mediate programmable DNA cleavage. Nat, Biotechnol. 30, 836-838 (2012).
21. Brouns, SJ. Molecular biology. A Swiss army knife of immunity. Science 337, 808- 809 (2012).
22. Carroll, D. A CRISPR Approach to Gene Targeting. Mol. Ther, 20, 1658-1660
(2012) .
23. Bikard, D.„ Hatoum-Aslan, A., Mucida, D. & Marraffini, L.A. CRISPR interference can prevent natural transformation and virulence acquisition during in vivo bacterial infection. Ceil Host Microbe 12, 177-186 (2012).
24. Sapranauskas, R. et al. The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic Acids Res. (201.1 ). 25. Semenova, E. et al. Interference by clustered regularly interspaced short palindromic repeat (CRISPR) RNA is governed by a seed sequence. Proc. Natl. Acad. Sci. U.S.A. (201 1 ).
26. Wiedenlieft, B. et al. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proc. Natl. Acad. Sci. U.S.A. (2011).
27. Zahner, D. & Hakenbeck, R. The Streptococcus pneumoniae beta-galactosidase is a surface protein. J. Bacterial. 182, 5919-5921 (2000).
28. arraffini, L.A., Dedent, A.C. & Schneewind, (). Sortases and the art of anchoring proteins to the envelopes of gram-positive bacteria. Microbiol. Mol. Biol. Rev. 70, 192-221 (2006).
29. Motamedi, M.R., Szigety, S. . & Rosenberg, S.M. Double-strand-break repair recombination in Escherichia co r, physical evidence for a DNA replication mechanism in vivo. Genes Dev. 13, 2889-2903 (1999).
30. Hosaka, T. et al. The novel mutation K87E in ribosomai protein S12 enhances protein synthesis activity during the late growth phase in Escherichia coli. Mol. Genet. Genomics 271, 317-324 (2004).
31 . Costantino, N. & Court, D.L. Enhanced levels of lambda Red-mediated recombinants in mismatch repair mutants. Proc. Natl. Acad. Sci. U.S.A. 100, 15748- 15753 (2003).
32. Edgar, R. & Qimron, U. The Escherichia coli CRISPR system protects from lambda iysogenization, lysogens, and prophage induction. J. Bacterial. 192, 6291-6294 (2010).
33. Marraffini, L.A. & So theimer, E.J. Self versus non-self discrimination during CRISPR RNA-directed immunity. Nature 463, 568-571 (2010).
34. Fischer, S, et al. An archaeai immune system can detect multiple Protospacer Adjacent Motifs (PAMs) to target invader DNA, J. Biol. Chem. 287, 33351-33363 (2012).
35. Gudbergsdottir, S. et al. Dynamic properties of the Sulfolobus CRISPR/Cas and CRISPR/Cmr systems when challenged with vector-borne viral and plasmid genes and protospacers. Mol. Microbiol. 79, 35-49 (201 1).
36. Wang, H.H. et al. Genome-scale promoter engineering by coselection MAGE. Nat Methods 9, 591 -593 (2012).
37. Cong, L. et al. Multiplex Genome Engineering Using CRISPR/Cas Systems. Science I press (2013). 38. Mali, P. et al. RNA-Guided Human Genome Engineering via Cas9. Science In press (2013).
39. Hoskins, J. et al. Genome of the bacterium Streptococcus pneumoniae strain R6. J. Bacterial 183, 5709-5717 (2001).
40. Havarsteirs, L.S., Coomaraswamy, G. & Morrison, D.A. An unmodified lieptadeeapeptide pheromone induces competence for genetic transformation in Streptococcus pneumoniae. Proa Natl. Acad. Sci. U.S.A. 92, 11140-11144 (1995).
41. Horinoiiclii, S. & Weisblum, B. Nucleotide sequence and functional map of pC194, a plasmid that specifies inducible chloramphenicol resistance. J. Bacterial. 150, 815-825 (1982).
42. Horton, R.M. In Vitro Recombination and Mutagenesis of DNA : SOEing Together Tailor-Made Gems. Methods Mo L Biol. 15, 251-261 (1993).
43. Podbielski, A., Spellerberg, B.„ Woischnik, M., Pohl, B. & Luttieken, R. Novel series of plasmid vectors for gene inactivation and expression analysis in group A streptococci (GAS). Gene 177, 137-147 (1996).
44. Husmami, L.K., Scott, J.R., Lindalii, G. & Stenberg, L, Expression of the Arp protein, a member of the M protein family, is not sufficient to inhibit phagocytosis of Streptococcus pyogenes. Infection and immunity 63, 345-348 ( 1995).
45. Gibson, D.G. et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods 6, 343-345 (2009).

Claims

WHAT IS CLAIMED IS:
1. A non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
1. a first regulatory element operably linked, to a CRISPR-Cas system chimeric R'NA (chiRNA) polynucleotide sequence, wherein -he polynucleotide sequersce comprises
(a) a guide sequence capable of hybridizing to a larger sequence in a eukaryotic ceil,
(b) a tract mate sequence, and
(c) a tracr sequence, and
II. a second, regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences (NLSs) in the proximity of a terminus of the CRISPR enzyme,
wherein (a), (b) and (c) are arranged in a 5' to 3" orientation,
wherein components I and II are located, on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence,
wherein the CRiSPR complex comprises me CRISPR enzyme cornplcxed with ( 1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and
wherein the chimeric R A polynucleotide sequence comprises two or more hairpins.
2. The composition of claim. 1 , wherein multiple chi RNA polynucleotide sequences are used, to provide a multiplexed system.
3. A multiplexed CRISPR enzyme system, wherein the system comprises a vector system comprising one or more vectors comprising
I . a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell,
(b) a tracr mate sequence, and
(c) a tracr sequence, and II. a second regulatory element operably linked to an enzyme-coding sequence encoding a. CRISPR enzyme comprising at least one or more rmclear localization sequences (NLSs) in the proximity of a terminus of the CRISPR enzyme.
wherein ia), (b) and (c) are arranged in a. 5 ' to 3 ' orientation,
wherein components 1 and 11 are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence,
wherein the CRISPR complex comprises the CRISPR enzyme compiexed. with Π ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence mat is hybridized to the tracr sequence,
wherein the chiRNA polynucleotide sequence comprises two or more hairpins, and wherein in the multiplexed system multiple chiRNA polynucleotide sequences are used,
4. The composition or system of claim 1 , 2 or 3, wherein the first regulatory element is a polymerase III promoter.
5. The composition or system of any preceding claim, wherein the second regulatory element is a polymerase II promoter.
6. The composition or system of any preceding claim, wherein the CRISPR enzyme comprises one or more NLSs of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotie ceil.
7. The composition or system of any preceding claim, wherein the tracr sequence exhibits at least 50% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
8. The composition or system of any preceding claim, wherein the CRISPR enzyme is a type II CRISPR system enzyme.
9. The composition or system of any preceding claim, wherein the CRISPR enzyme is a Cas9 enzyme.
10. The composition or system of any preceding claim, wherein the CRISPR enzyme is codomoptimized for expression in a eukaryotie ceil.
1 1. The composition or system of any preceding claim, wherein the guide sequence is at least 15 nucleotides in length.
12. The composition or system of any preceding claim, wherein the chimeric UNA polynucleotide sequence comprises two, three, four or five hairpins.
13. A non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
L a firs regulatory element operably linked to
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and
(b) a. tracr mate seq uence,
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a. CRISPR enzyme comprising at least one or more nuclear localization sequences (NLSs) in the proximity of a terminus of the CRISPR enzyme, and
III. a third regulatory element operably linked to a tracr seq ence,
wherein components I, I I and ΙΠ are located on the same or different vectors of the system,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CRISPR complex comprises the CRISPR enzyme complexed with (!) the guide sequence that is hybridized, to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
14. The composition of claim 13, wherein multiple guide sequences and a single tracr sequence are used, to provide a multiplexed system.
15. A multiplexed CRISPR enzyme system, wherein the system comprises a vector system comprising one or more vectors comprising
I. a first regulatory element operably linked to
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and
(b) a tracr mate sequence,
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences (NLSs) in the proximity of a terminus of the CRISPR enzyme, and ΙΠ, a third regulatory element operabl linked to a tracr sequence.
wherein components L Π and I II are located on the same or different vectors of the system,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence,
wherein the CRISPR complex comprises the CRISPR enzyme eomplexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mare sequence that is hybridized to the tracr sequence, and
wherein in the multiplexed system multiple guide sequences and a single tracr sequence is used.
16. The composition or system of any of claims 13 to 15, wherein the first regulatory element is a polymerase III promoter.
17. The composition or system of any of claims 13 to 16, wherein the second regulatory element is a polymerase II promoter.
18. The compositio or system of any of claims 13 to 17, wherein the third regulatory element is a polymerase ill promoter.
39. The composition or system of any of claims 13 to 18, wherein the CRISPR enzyme comprises one or more NLSs of sufficient strength to drive accumulation of said CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
20. The composition or system of any of claims 13 to 19, wherein the tracr sequence exhibits at least 50% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
21. The composition or system of any of claims 13 to 20, wherein the CRISPR enzyme is a type II CRISPR system enzyme.
22. The composition or system of any of claims 13 to 21, wherein the CRISPR enzyme is a Cas9 enzyme.
23. The composition or system of any of claims 13 to 22, wherein the CRISPR enzyme is codon-optiniized for expression in a eukaryotic cell.
24. The composition or system of any of claims 13 to 23, wherein the guide sequence is at least 15 nucleotides in length.
25. A eukaryotic host cell comprising the composition or system of any of the preceding claims.
26. An organism comprising the eukaryotic host cel l of claim 25.
27. A non-human organism comprising the eukaryotic host cell of claim 25.
28. A kit comprising the composition of any of claims 1 to 24 and instructions for using said kit.
29. A method of altering the expression of a genomic locus of interest in a eukaryotic cell comprising
contacting the genomic locus with the composition of any of claims 1 to 24, and determining if th e expression of the genomic locus has been altered.
30. The method of claim 29 wherein the guide sequence directs sequence-specific binding of the CRISPR complex to the target sequence based on the presence of a CRJSPR motif sequence.
31. The method of claim 30, wherein the CRISPR motif sequence is NAG.
32. The method of selecting one or more prokaryotic cell(s) by introducing one or more mutations in a gene in the one or more prokaryotic cell (s), the method comprising:
introducing one or more vectors into the prokaryotic cell (s), wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and an editing template;
wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage;
allowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected;
allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein binding of the CRISPR complex to the target polynucleotide induces cell death,
thereby allowing one or more prokaryotic cell(s) in which one or more mutations have been introduced to be selected.
33. The method of claim 32, wherein the CRISPR enzyme is a type II CRISPR. system enzyme
34. The method of claim 33, wherein the CRISPR enzyme is Cas9.
PCT/US2013/074611 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation Ceased WO2014093595A1 (en)

Priority Applications (36)

Application Number Priority Date Filing Date Title
CN202111233527.5A CN114634950A (en) 2012-12-12 2013-12-12 CRISPR-CAS component systems, methods, and compositions for sequence manipulation
HK15106920.5A HK1206388B (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
EP23192260.0A EP4286402A3 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
CA2894668A CA2894668A1 (en) 2012-12-12 2013-12-12 Crispr-cas systems and methods for altering expression of gene products in eukaryotic cells
EP25158803.4A EP4570817A3 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
JP2015547530A JP2016505256A (en) 2012-12-12 2013-12-12 CRISPR-Cas component system, method and composition for sequence manipulation
BR112015013786-5A BR112015013786B1 (en) 2012-12-12 2013-12-12 crispr-cas component systems, methods and compositions for sequence manipulation
EP23161559.2A EP4234696A3 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
EP20198492.9A EP3825401A1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
EP23192949.8A EP4286403A3 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
CN201380072868.6A CN105658796B (en) 2012-12-12 2013-12-12 CRISPR-CAS component systems, methods, and compositions for sequence manipulation
BR122021008308-8A BR122021008308B1 (en) 2012-12-12 2013-12-12 CRISPR-CAS COMPONENT SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION
AU2013359262A AU2013359262C1 (en) 2012-12-12 2013-12-12 CRISPR-Cas component systems, methods and compositions for sequence manipulation
RU2015128102A RU2701662C9 (en) 2012-12-12 2013-12-12 Crispr-cas system components, methods and compositions for sequence manipulation
EP13812430.0A EP2825654B1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
DK13812430.0T DK2825654T3 (en) 2012-12-12 2013-12-12 SYSTEMS, PROCEDURES, AND COMPOSITIONS WITH CRISPR-CAS COMPONENTS FOR SEQUENCE MANIPULATION.
EP23192951.4A EP4286404A3 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
ES13812430.0T ES2635244T3 (en) 2012-12-12 2013-12-12 CRISPR-Cas systems, methods and component compositions for sequence manipulation
EP14188820.6A EP2840140B2 (en) 2012-12-12 2013-12-12 Crispr-Cas based method for mutation of prokaryotic cells
EP17162030.5A EP3252160B1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
EP14190376.5A EP2848690B1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
KR1020267010790A KR20260055511A (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
KR1020157018662A KR102955556B1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation
CN201910829026.XA CN110982844B (en) 2012-12-12 2013-12-12 CRISPR-CAS component systems, methods and compositions for sequence manipulation
US14/497,627 US20150031134A1 (en) 2012-12-12 2014-09-26 Crispr-cas component systems, methods and compositions for sequence manipulation
US14/523,799 US9840713B2 (en) 2012-12-12 2014-10-24 CRISPR-Cas component systems, methods and compositions for sequence manipulation
US14/990,444 US9822372B2 (en) 2012-12-12 2016-01-07 CRISPR-Cas component systems, methods and compositions for sequence manipulation
US14/991,083 US20160115489A1 (en) 2012-12-12 2016-01-08 Crispr-cas component systems, methods and compositions for sequence manipulation
US15/838,064 US20180305704A1 (en) 2012-12-12 2017-12-11 Crispr-cas component systems, methods and compositions for sequence manipulation
US15/887,377 US20180179547A1 (en) 2012-12-12 2018-02-02 Crispr-cas component systems, methods and compositions for sequence manipulation
US16/178,551 US20190292550A1 (en) 2012-12-12 2018-11-01 Crispr-cas component systems, methods and compositions for sequence manipulation
AU2019280394A AU2019280394B2 (en) 2012-12-12 2019-12-16 CRISPR-Cas component systems, methods and compositions for sequence manipulation
US16/906,580 US20200318123A1 (en) 2012-12-12 2020-06-19 Crispr-cas component systems, methods and compositions for sequence manipulation
US17/503,928 US20220135985A1 (en) 2012-12-12 2021-10-18 Crispr-cas component systems, methods and compositions for sequence manipulation
AU2022203763A AU2022203763B2 (en) 2012-12-12 2022-06-01 CRISPR-Cas component systems, methods and compositions for sequence manipulation
AU2025203777A AU2025203777A1 (en) 2012-12-12 2025-05-22 CRISPR-Cas component systems, methods and compositions for sequence manipulation

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201261736527P 2012-12-12 2012-12-12
US61/736,527 2012-12-12
US201361748427P 2013-01-02 2013-01-02
US61/748,427 2013-01-02
US201361768959P 2013-02-25 2013-02-25
US61/768,959 2013-02-25
US201361791409P 2013-03-15 2013-03-15
US61/791,409 2013-03-15
US201361835931P 2013-06-17 2013-06-17
US61/835,931 2013-06-17

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US14/497,627 Continuation-In-Part US20150031134A1 (en) 2012-12-12 2014-09-26 Crispr-cas component systems, methods and compositions for sequence manipulation
US14/497,627 Continuation US20150031134A1 (en) 2012-12-12 2014-09-26 Crispr-cas component systems, methods and compositions for sequence manipulation
US14/523,799 Continuation US9840713B2 (en) 2012-12-12 2014-10-24 CRISPR-Cas component systems, methods and compositions for sequence manipulation

Publications (2)

Publication Number Publication Date
WO2014093595A1 true WO2014093595A1 (en) 2014-06-19
WO2014093595A9 WO2014093595A9 (en) 2015-08-06

Family

ID=49881125

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/074611 Ceased WO2014093595A1 (en) 2012-12-12 2013-12-12 Crispr-cas component systems, methods and compositions for sequence manipulation

Country Status (10)

Country Link
US (27) US20140189896A1 (en)
EP (9) EP2825654B1 (en)
JP (5) JP2016505256A (en)
KR (2) KR102955556B1 (en)
CN (3) CN114634950A (en)
AU (4) AU2013359262C1 (en)
BR (2) BR112015013786B1 (en)
CA (1) CA2894668A1 (en)
DK (1) DK3252160T3 (en)
WO (1) WO2014093595A1 (en)

Cited By (364)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2784162B1 (en) 2012-12-12 2015-04-08 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
WO2015065964A1 (en) 2013-10-28 2015-05-07 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof
WO2015089419A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
WO2015089351A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
WO2015089277A1 (en) * 2013-12-12 2015-06-18 The Regents Of The University Of California Methods and compositions for modifying a single stranded target nucleic acid
WO2015089486A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems
WO2015089465A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
EP2764103B1 (en) 2012-12-12 2015-08-19 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products
WO2015153780A1 (en) * 2014-04-02 2015-10-08 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating primary open angle glaucoma
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
WO2015168800A1 (en) * 2014-05-09 2015-11-12 UNIVERSITé LAVAL Prevention and treatment of alzheimer's disease by genome editing using the crispr/cas system
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9228208B2 (en) 2013-12-11 2016-01-05 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
CN105296518A (en) * 2015-12-01 2016-02-03 中国农业大学 Homologous arm vector construction method used for CRISPR/Cas 9 technology
US9260723B2 (en) 2012-12-17 2016-02-16 President And Fellows Of Harvard College RNA-guided human genome engineering
US9260752B1 (en) 2013-03-14 2016-02-16 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
EP2898075B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
WO2016036754A1 (en) 2014-09-02 2016-03-10 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification
WO2016049251A1 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes
WO2016049163A2 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
GB2530831A (en) * 2014-04-17 2016-04-06 Green Biologics Ltd Targeted mutations
WO2016061073A1 (en) * 2014-10-14 2016-04-21 Memorial Sloan-Kettering Cancer Center Composition and method for in vivo engineering of chromosomal rearrangements
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
WO2016069591A2 (en) 2014-10-27 2016-05-06 The Broad Institute Inc. Compositions, methods and use of synthetic lethal screening
WO2016049024A3 (en) * 2014-09-24 2016-05-12 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
WO2016086197A1 (en) 2014-11-25 2016-06-02 The Brigham And Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086227A2 (en) 2014-11-26 2016-06-02 The Regents Of The University Of California Therapeutic compositions comprising transcription factors and methods of making and using the same
WO2016083811A1 (en) 2014-11-27 2016-06-02 Imperial Innovations Limited Genome editing methods
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
WO2016094867A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Protected guide rnas (pgrnas)
WO2016094872A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Dead guides for crispr transcription factors
WO2016094874A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Escorted and functionalized guides for crispr-cas systems
WO2016100974A1 (en) 2014-12-19 2016-06-23 The Broad Institute Inc. Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing
WO2016106236A1 (en) 2014-12-23 2016-06-30 The Broad Institute Inc. Rna-targeting system
WO2016106244A1 (en) 2014-12-24 2016-06-30 The Broad Institute Inc. Crispr having or associated with destabilization domains
WO2016108926A1 (en) 2014-12-30 2016-07-07 The Broad Institute Inc. Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis
JP2016520317A (en) * 2013-05-29 2016-07-14 セレクティスCellectis Method for producing precise DNA cleavage using CAS9 nickase activity
WO2016138488A2 (en) 2015-02-26 2016-09-01 The Broad Institute Inc. T cell balance gene expression, compositions of matters and methods of use thereof
WO2016138574A1 (en) 2015-03-02 2016-09-09 Sinai Health System Homologous recombination factors
EP2840140B1 (en) 2012-12-12 2016-11-16 The Broad Institute, Inc. Crispr-Cas component systems, methods and compositions for sequence manipulation
WO2016183438A1 (en) * 2015-05-14 2016-11-17 Massachusetts Institute Of Technology Self-targeting genome editing system
WO2016182893A1 (en) 2015-05-08 2016-11-17 Teh Broad Institute Inc. Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
WO2016200263A1 (en) * 2015-06-12 2016-12-15 Erasmus University Medical Center Rotterdam New crispr assays
WO2016198500A1 (en) * 2015-06-10 2016-12-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for rna-guided treatment of human cytomegalovirus (hcmv) infection
WO2016205745A2 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Cell sorting
WO2016205764A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
WO2016205728A1 (en) 2015-06-17 2016-12-22 Massachusetts Institute Of Technology Crispr mediated recording of cellular events
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
WO2017027910A1 (en) 2015-08-14 2017-02-23 The University Of Sydney Connexin 45 inhibition for therapy
EP3041498A4 (en) * 2013-09-05 2017-04-12 Massachusetts Institute of Technology Tuning microbial populations with programmable nucleases
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
WO2017070605A1 (en) 2015-10-22 2017-04-27 The Broad Institute Inc. Type vi-b crispr enzymes and systems
WO2017068077A1 (en) 2015-10-20 2017-04-27 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
EP3003392A4 (en) * 2013-06-04 2017-05-03 President and Fellows of Harvard College Rna-guideded transcriptional regulation
WO2017075294A1 (en) 2015-10-28 2017-05-04 The Board Institute Inc. Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction
WO2017074788A1 (en) 2015-10-27 2017-05-04 The Broad Institute Inc. Compositions and methods for targeting cancer-specific sequence variations
WO2017075451A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1
WO2017075465A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3
WO2017075478A2 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures
EP2800811B1 (en) 2012-05-25 2017-05-10 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
GB2544382A (en) * 2014-02-11 2017-05-17 The Regents Of The Univ Of Colorado A Body Corp (Existing Under The Laws Of The State Of Colorado) CRISPR enabled multiplexed genome engineering
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
WO2017064566A3 (en) * 2015-10-16 2017-05-26 Astrazeneca Ab Inducible modification of a cell genome
WO2017090761A1 (en) * 2015-11-27 2017-06-01 国立大学法人神戸大学 Method for converting monocot plant genome sequence in which nucleic acid base in targeted dna sequence is specifically converted, and molecular complex used therein
WO2017114497A1 (en) 2015-12-30 2017-07-06 Novartis Ag Immune effector cell therapies with enhanced efficacy
WO2017147196A1 (en) 2016-02-22 2017-08-31 Massachusetts Institute Of Technology Methods for identifying and modulating immune phenotypes
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
WO2017161325A1 (en) 2016-03-17 2017-09-21 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
WO2017165655A1 (en) * 2016-03-23 2017-09-28 Dana-Farber Cancer Institute, Inc. Methods for enhancing the efficiency of gene editing
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9834786B2 (en) 2012-04-25 2017-12-05 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
WO2017219027A1 (en) 2016-06-17 2017-12-21 The Broad Institute Inc. Type vi crispr orthologs and systems
WO2018013840A1 (en) 2016-07-13 2018-01-18 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
US9885026B2 (en) 2011-12-30 2018-02-06 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2018035364A1 (en) 2016-08-17 2018-02-22 The Broad Institute Inc. Product and methods useful for modulating and evaluating immune responses
WO2018035250A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
WO2018054911A1 (en) 2016-09-23 2018-03-29 Bayer Cropscience Nv Targeted genome optimization in plants
KR20180034402A (en) * 2015-06-18 2018-04-04 더 브로드 인스티튜트, 인코퍼레이티드 New CRISPR Enzymes and Systems
KR20180034404A (en) * 2015-06-18 2018-04-04 더 브로드 인스티튜트, 인코퍼레이티드 CRISPR enzyme mutations that reduce the target effect
US9938521B2 (en) 2014-03-10 2018-04-10 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10)
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
WO2018083606A1 (en) 2016-11-01 2018-05-11 Novartis Ag Methods and compositions for enhancing gene editing
US9982277B2 (en) 2013-06-11 2018-05-29 The Regents Of The University Of California Methods and compositions for target DNA modification
US9982279B1 (en) 2017-06-23 2018-05-29 Inscripta, Inc. Nucleic acid-guided nucleases
US10011849B1 (en) 2017-06-23 2018-07-03 Inscripta, Inc. Nucleic acid-guided nucleases
US10017760B2 (en) 2016-06-24 2018-07-10 Inscripta, Inc. Methods for generating barcoded combinatorial libraries
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
WO2018170515A1 (en) 2017-03-17 2018-09-20 The Broad Institute, Inc. Methods for identifying and modulating co-occurant cellular phenotypes
WO2018170333A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Novel cas13b orthologues crispr enzymes and systems
WO2018191750A2 (en) 2017-04-14 2018-10-18 The Broad Institute Inc. Novel delivery of large payloads
WO2018191520A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
WO2018191388A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Novel type vi crispr orthologs and systems
WO2018195486A1 (en) 2017-04-21 2018-10-25 The Broad Institute, Inc. Targeted delivery to beta cells
WO2018195019A1 (en) 2017-04-18 2018-10-25 The Broad Institute Inc. Compositions for detecting secretion and methods of use
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
EP3138911B1 (en) 2012-12-06 2018-12-05 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10166255B2 (en) 2015-07-31 2019-01-01 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
WO2019005884A1 (en) 2017-06-26 2019-01-03 The Broad Institute, Inc. Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing
WO2019003193A1 (en) 2017-06-30 2019-01-03 Novartis Ag Methods for the treatment of disease with gene editing systems
WO2019018440A1 (en) 2017-07-17 2019-01-24 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
WO2019060746A1 (en) 2017-09-21 2019-03-28 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2019071054A1 (en) 2017-10-04 2019-04-11 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
US10300138B2 (en) 2016-06-05 2019-05-28 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10337001B2 (en) 2014-12-03 2019-07-02 Agilent Technologies, Inc. Guide RNA with chemical modifications
EP2828386B1 (en) 2012-03-20 2019-07-10 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
EP3514246A1 (en) 2014-02-27 2019-07-24 The Broad Institute Inc. T cell balance gene expression and methods of use thereof
WO2019143675A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
WO2019143678A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
US10385359B2 (en) 2013-04-16 2019-08-20 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US10428319B2 (en) 2017-06-09 2019-10-01 Editas Medicine, Inc. Engineered Cas9 nucleases
WO2019204585A1 (en) 2018-04-19 2019-10-24 Massachusetts Institute Of Technology Single-stranded break detection in double-stranded dna
US10457960B2 (en) 2014-11-21 2019-10-29 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide RNAs
EP3560330A1 (en) 2018-04-24 2019-10-30 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
WO2019210268A2 (en) 2018-04-27 2019-10-31 The Broad Institute, Inc. Sequencing-based proteomics
US10463049B2 (en) 2015-05-06 2019-11-05 Snipr Technologies Limited Altering microbial populations and modifying microbiota
WO2019213660A2 (en) 2018-05-04 2019-11-07 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
WO2020002592A1 (en) 2018-06-29 2020-01-02 Stichting Het Nederlands Kanker Instituut - Antoni Van Leeuwenhoek Ziekenhuis Traf2 inhibitors for use in the treatment of a cancer
WO2020006036A1 (en) 2018-06-26 2020-01-02 Massachusetts Institute Of Technology Crispr effector system based amplification methods, systems, and diagnostics
WO2020006049A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr/cas and transposase based amplification compositions, systems and methods
US10544405B2 (en) 2013-01-16 2020-01-28 Emory University Cas9-nucleic acid complexes and uses related thereto
US10550396B2 (en) 2014-04-17 2020-02-04 Green Biologics Limited Deletion mutations
WO2020028555A2 (en) 2018-07-31 2020-02-06 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2020033601A1 (en) 2018-08-07 2020-02-13 The Broad Institute, Inc. Novel cas12b enzymes and systems
WO2020041380A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. Methods and compositions for optochemical control of crispr-cas9
WO2020041387A1 (en) 2018-08-20 2020-02-27 The Brigham And Women's Hospital, Inc. Degradation domain modifications for spatio-temporal control of rna-guided nucleases
US10577630B2 (en) 2013-06-17 2020-03-03 The Broad Institute, Inc. Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
WO2020051507A1 (en) 2018-09-06 2020-03-12 The Broad Institute, Inc. Nucleic acid assemblies for use in targeted delivery
AU2014274840B2 (en) * 2013-06-05 2020-03-12 Duke University RNA-guided gene editing and gene regulation
WO2020065062A1 (en) 2018-09-28 2020-04-02 Wageningen Universiteit Off-target activity inhibitors for guided endonucleases
WO2020077236A1 (en) 2018-10-12 2020-04-16 The Broad Institute, Inc. Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
US10640789B2 (en) 2013-06-04 2020-05-05 President And Fellows Of Harvard College RNA-guided transcriptional regulation
WO2020093025A1 (en) * 2018-11-01 2020-05-07 Synthego Corporation Methods for knock-out of a target sequence through introduction of a premature stop codon
US10655123B2 (en) 2014-03-05 2020-05-19 National University Corporation Kobe University Genomic sequence modification method for specifically converting nucleic acid bases of targeted DNA sequence, and molecular complex for use in same
EP3653229A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
US10676726B2 (en) 2015-02-09 2020-06-09 Duke University Compositions and methods for epigenome editing
US10676735B2 (en) 2015-07-22 2020-06-09 Duke University High-throughput screening of regulatory element function with epigenome editing technologies
WO2020131862A1 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
US10711256B2 (en) 2012-04-27 2020-07-14 Duke University Genetic correction of mutated genes
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
EP3686279A1 (en) 2014-08-17 2020-07-29 The Broad Institute, Inc. Genome editing using cas9 nickases
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
AU2015248621B2 (en) * 2014-04-14 2020-08-27 Nemesis Bioscience Ltd Therapeutic
US10760075B2 (en) 2018-04-30 2020-09-01 Snipr Biome Aps Treating and preventing microbial infections
US10767175B2 (en) 2016-06-08 2020-09-08 Agilent Technologies, Inc. High specificity genome editing using chemically modified guide RNAs
US10767173B2 (en) 2015-09-09 2020-09-08 National University Corporation Kobe University Method for converting genome sequence of gram-positive bacterium by specifically converting nucleic acid base of targeted DNA sequence, and molecular complex used in same
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
WO2020206036A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Novel nucleic acid modifier
WO2020229241A1 (en) 2019-05-10 2020-11-19 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2020229533A1 (en) 2019-05-13 2020-11-19 KWS SAAT SE & Co. KGaA Drought tolerance in corn
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020236972A2 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Non-class i multi-component nucleic acid targeting systems
US10851380B2 (en) 2012-10-23 2020-12-01 Toolgen Incorporated Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein
WO2020243661A1 (en) 2019-05-31 2020-12-03 The Broad Institute, Inc. Methods for treating metabolic disorders by targeting adcy5
WO2020239680A2 (en) 2019-05-25 2020-12-03 KWS SAAT SE & Co. KGaA Haploid induction enhancer
CN112080587A (en) * 2020-08-31 2020-12-15 上海海关动植物与食品检验检疫技术中心 RAA-CRISPR amplification primer group, kit and method for efficiently detecting novel coronavirus
WO2021001534A1 (en) 2019-07-03 2021-01-07 Wageningen Universiteit Crispr type v-u1 system from mycobacterium mucogenicum and uses thereof
WO2021003432A1 (en) 2019-07-02 2021-01-07 Fred Hutchinson Cancer Research Center Recombinant ad35 vectors and related gene therapy improvements
US10912797B2 (en) 2016-10-18 2021-02-09 Intima Bioscience, Inc. Tumor infiltrating lymphocytes and methods of therapy
EP3772542A1 (en) 2019-08-07 2021-02-10 KWS SAAT SE & Co. KGaA Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
US10946108B2 (en) 2013-06-17 2021-03-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
WO2021048316A1 (en) 2019-09-12 2021-03-18 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021055874A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Novel type vi crispr enzymes and systems
EP3636753A4 (en) * 2017-06-08 2021-03-31 Osaka University PROCESS FOR MANUFACTURING A DNA-EDITED EUKARYOTE CELL, AND KIT USED IN THE PROCESS
WO2021069387A1 (en) 2019-10-07 2021-04-15 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021074367A1 (en) 2019-10-17 2021-04-22 KWS SAAT SE & Co. KGaA Enhanced disease resistance of crops by downregulation of repressor genes
US11001829B2 (en) 2014-09-25 2021-05-11 The Broad Institute, Inc. Functional screening with optimized functional CRISPR-Cas systems
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
WO2021105191A1 (en) 2019-11-29 2021-06-03 Basf Se Increasing resistance against fungal infections in plants
US11028388B2 (en) 2014-03-05 2021-06-08 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa
WO2021111466A1 (en) * 2019-12-02 2021-06-10 Council Of Scientific & Industrial Research Method and kit for detection of polynucleotide
WO2021110582A1 (en) 2019-12-03 2021-06-10 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US11041173B2 (en) 2012-12-12 2021-06-22 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
WO2021122687A1 (en) 2019-12-19 2021-06-24 Basf Se Increasing space-time-yield, carbon-conversion-efficiency and carbon substrate flexibility in the production of fine chemicals
WO2021122528A1 (en) 2019-12-20 2021-06-24 Basf Se Decreasing toxicity of terpenes and increasing the production potential in micro-organisms
US11092607B2 (en) 2015-10-28 2021-08-17 The Board Institute, Inc. Multiplex analysis of single cell constituents
US11098325B2 (en) 2017-06-30 2021-08-24 Intima Bioscience, Inc. Adeno-associated viral vectors for gene therapy
EP3872190A1 (en) 2020-02-26 2021-09-01 Antibodies-Online GmbH A method of using cut&run or cut&tag to validate crispr-cas targeting
US11111521B2 (en) 2011-12-22 2021-09-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
WO2021202938A1 (en) 2020-04-03 2021-10-07 Creyon Bio, Inc. Oligonucleotide-based machine learning
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US11180793B2 (en) 2015-04-24 2021-11-23 Editas Medicine, Inc. Evaluation of Cas9 molecule/guide RNA molecule complexes
US11180751B2 (en) 2015-06-18 2021-11-23 The Broad Institute, Inc. CRISPR enzymes and systems
WO2021239986A1 (en) 2020-05-29 2021-12-02 KWS SAAT SE & Co. KGaA Plant haploid induction
US11214800B2 (en) 2015-08-18 2022-01-04 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
EP3036333B1 (en) 2013-08-22 2022-01-19 E. I. du Pont de Nemours and Company Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof
US11236313B2 (en) 2016-04-13 2022-02-01 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US11242525B2 (en) 2014-03-26 2022-02-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating sickle cell disease
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11299767B2 (en) 2013-03-12 2022-04-12 President And Fellows Of Harvard College Method for generating a three-dimensional nucleic acid containing matrix
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US11306309B2 (en) 2015-04-06 2022-04-19 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11332736B2 (en) 2017-12-07 2022-05-17 The Broad Institute, Inc. Methods and compositions for multiplexing single cell and single nuclei sequencing
US11339437B2 (en) 2014-03-10 2022-05-24 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
EP4001429A1 (en) 2020-11-16 2022-05-25 Antibodies-Online GmbH Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq)
US11345932B2 (en) 2018-05-16 2022-05-31 Synthego Corporation Methods and systems for guide RNA design and use
US11352647B2 (en) 2016-08-17 2022-06-07 The Broad Institute, Inc. Crispr enzymes and systems
US11384383B2 (en) 2017-08-08 2022-07-12 Depixus In vitro isolation and enrichment of nucleic acids using site-specific nucleases
US11390884B2 (en) 2015-05-11 2022-07-19 Editas Medicine, Inc. Optimized CRISPR/cas9 systems and methods for gene editing in stem cells
WO2022155265A2 (en) 2021-01-12 2022-07-21 Mitolab Inc. Context-dependent, double-stranded dna-specific deaminases and uses thereof
EP4039816A1 (en) * 2015-05-29 2022-08-10 North Carolina State University Methods for screening bacteria, archaea, algae, and yeast using crispr nucleic acids
US11414657B2 (en) 2015-06-29 2022-08-16 Ionis Pharmaceuticals, Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
US11427817B2 (en) 2015-08-25 2022-08-30 Duke University Compositions and methods of improving specificity in genomic engineering using RNA-guided endonucleases
US11447527B2 (en) 2018-09-18 2022-09-20 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
WO2022221699A1 (en) 2021-04-16 2022-10-20 Beam Therapeutics, Inc. Genetic modification of hepatocytes
US11499151B2 (en) 2017-04-28 2022-11-15 Editas Medicine, Inc. Methods and systems for analyzing guide RNA molecules
US11512311B2 (en) 2016-03-25 2022-11-29 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency
WO2022256440A2 (en) 2021-06-01 2022-12-08 Arbor Biotechnologies, Inc. Gene editing systems comprising a crispr nuclease and uses thereof
US11542554B2 (en) 2015-11-03 2023-01-03 President And Fellows Of Harvard College Method and apparatus for volumetric imaging
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11547614B2 (en) 2017-10-31 2023-01-10 The Broad Institute, Inc. Methods and compositions for studying cell evolution
US11549126B2 (en) 2015-06-03 2023-01-10 Board Of Regents Of The University Of Nebraska Treatment methods using DNA editing with single-stranded DNA
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11566263B2 (en) 2016-08-02 2023-01-31 Editas Medicine, Inc. Compositions and methods for treating CEP290 associated disease
WO2023006933A1 (en) 2021-07-30 2023-02-02 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
US11578118B2 (en) 2017-10-20 2023-02-14 Fred Hutchinson Cancer Center Systems and methods to produce B cells genetically modified to express selected antibodies
US11591601B2 (en) 2017-05-05 2023-02-28 The Broad Institute, Inc. Methods for identification and modification of lncRNA associated with target genotypes and phenotypes
US11597924B2 (en) 2016-03-25 2023-03-07 Editas Medicine, Inc. Genome editing systems comprising repair-modulating enzyme molecules and methods of their use
US11603544B2 (en) 2017-06-05 2023-03-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
WO2023093862A1 (en) 2021-11-26 2023-06-01 Epigenic Therapeutics Inc. Method of modulating pcsk9 and uses thereof
US11667911B2 (en) 2015-09-24 2023-06-06 Editas Medicine, Inc. Use of exonucleases to improve CRISPR/CAS-mediated genome editing
US11680296B2 (en) 2017-10-16 2023-06-20 Massachusetts Institute Of Technology Mycobacterium tuberculosis host-pathogen interaction
US11680268B2 (en) 2014-11-07 2023-06-20 Editas Medicine, Inc. Methods for improving CRISPR/Cas-mediated genome-editing
US11713485B2 (en) 2016-04-25 2023-08-01 President And Fellows Of Harvard College Hybridization chain reaction methods for in situ molecular detection
EP4219699A1 (en) 2013-12-12 2023-08-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
EP4268831A2 (en) 2018-09-12 2023-11-01 Fred Hutchinson Cancer Center Reducing cd33 expression to selectively protect therapeutic cells
AU2019372642B2 (en) * 2018-10-29 2023-11-23 China Agricultural University Novel CRISPR/Cas12f enzyme and system
US11851690B2 (en) 2017-03-14 2023-12-26 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
US11866697B2 (en) 2017-05-18 2024-01-09 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11866726B2 (en) 2017-07-14 2024-01-09 Editas Medicine, Inc. Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites
US11884915B2 (en) 2021-09-10 2024-01-30 Agilent Technologies, Inc. Guide RNAs with chemical modification for prime editing
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
US11911415B2 (en) 2015-06-09 2024-02-27 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for improving transplantation
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
WO2024042199A1 (en) 2022-08-26 2024-02-29 KWS SAAT SE & Co. KGaA Use of paired genes in hybrid breeding
US11920128B2 (en) 2013-09-18 2024-03-05 Kymab Limited Methods, cells and organisms
AU2022200130B2 (en) * 2018-02-15 2024-03-07 Sigma-Aldrich Co. Llc Engineered Cas9 systems for eukaryotic genome modification
WO2024064824A2 (en) 2022-09-21 2024-03-28 Yale University Compositions and methods for identification of membrane targets for enhancement of nk cell therapy
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
WO2024080067A1 (en) 2022-10-14 2024-04-18 株式会社インプランタイノベーションズ Genome editing method and composition for genome editing
US11963982B2 (en) 2017-05-10 2024-04-23 Editas Medicine, Inc. CRISPR/RNA-guided nuclease systems and methods
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
WO2024083579A1 (en) 2022-10-20 2024-04-25 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US11970710B2 (en) 2015-10-13 2024-04-30 Duke University Genome engineering with Type I CRISPR systems in eukaryotic cells
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
US12031132B2 (en) 2018-03-14 2024-07-09 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
US12058986B2 (en) 2017-04-20 2024-08-13 Egenesis, Inc. Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements
WO2024168265A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system
WO2024168253A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
WO2024173645A1 (en) 2023-02-15 2024-08-22 Arbor Biotechnologies, Inc. Gene editing method for inhibiting aberrant splicing in stathmin 2 (stmn2) transcript
US12076375B2 (en) 2022-06-29 2024-09-03 Snipr Biome Aps Treating and preventing E coli infections
US12091709B2 (en) 2015-06-18 2024-09-17 The Broad Institute, Inc. Crispr enzymes and systems
US12098425B2 (en) 2018-10-10 2024-09-24 Readcoor, Llc Three-dimensional spatial molecular indexing
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024206911A2 (en) 2023-03-30 2024-10-03 Children's Hospital Medical Center Clinical-grade organoids
US12110545B2 (en) 2017-01-06 2024-10-08 Editas Medicine, Inc. Methods of assessing nuclease cleavage
WO2024220741A1 (en) 2023-04-19 2024-10-24 Flagship Pioneering Innovations Vii, Llc Compositions and methods for the production of libraries
WO2024238977A2 (en) 2023-05-18 2024-11-21 Children's Hospital Medical Center Liver organoids with intrahepatic sympathetic nerves, and methods of use thereof
WO2024236547A1 (en) 2023-05-18 2024-11-21 Inceptor Bio, Llc Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12165743B2 (en) 2018-11-09 2024-12-10 The Broad Institute, Inc. Compressed sensing for screening and tissue imaging
US12161694B2 (en) 2017-03-24 2024-12-10 The Broad Institute, Inc. Methods and compositions for regulating innate lymphoid cell inflammatory responses
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
WO2024263961A2 (en) 2023-06-23 2024-12-26 Children's Hospital Medical Center Methods of matrix-free suspension culture
WO2025006419A1 (en) 2023-06-26 2025-01-02 Flagship Pioneering Innovations Vii, Llc Engineered plasmodia and related methods
US12201699B2 (en) 2014-10-10 2025-01-21 Editas Medicine, Inc. Compositions and methods for promoting homology directed repair
US12203136B2 (en) 2020-08-17 2025-01-21 Readcoor, Llc Methods and systems for spatial mapping of genetic variants
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
WO2025027165A1 (en) 2023-08-01 2025-02-06 Basf Plant Science Company Gmbh Increased resistance by expression of an ics protein
WO2025027166A1 (en) 2023-08-01 2025-02-06 Basf Plant Science Company Gmbh Increased resistance by expression of msbp1 protein
US12221720B2 (en) 2017-11-13 2025-02-11 The Broad Institute, Inc. Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells
US12227742B2 (en) 2017-10-23 2025-02-18 The Broad Institute, Inc. Nucleic acid modifiers
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
EP4512819A2 (en) 2015-08-12 2025-02-26 The General Hospital Corporation Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders
US12239646B2 (en) 2017-07-19 2025-03-04 Dana-Farber Cancer Institute, Inc. Cancer diagnostic and treatment
US12241090B2 (en) 2014-05-28 2025-03-04 Children's Hospital Medical Center Methods and systems for converting precursor cells into gastric tissues through directed differentiation
WO2025046513A1 (en) 2023-08-29 2025-03-06 Inceptor Bio, Llc Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof
US12258584B2 (en) 2010-05-06 2025-03-25 Children's Hospital Medical Center Methods and systems for converting precursor cells into intestinal tissues through directed differentiation
US12264323B2 (en) 2018-12-17 2025-04-01 The Broad Institute, Inc. CRISPR CPF1 direct repeat variants
WO2025072803A1 (en) 2023-09-29 2025-04-03 Children's Hospital Medical Center Ntrk2 signaling-mediated alveolar capillary injury and repair
US12269804B2 (en) 2018-01-17 2025-04-08 Vertex Pharmaceuticals Incorporated Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12281334B2 (en) 2017-04-14 2025-04-22 Children's Hospital Medical Center Multi donor stem cell compositions and methods of making same
US12286727B2 (en) 2016-12-19 2025-04-29 Editas Medicine, Inc. Assessing nuclease cleavage
US12286624B2 (en) 2018-06-08 2025-04-29 Johann Wolfgang Goethe-Universität Frankfurt am Main Method for generating a gene editing vector with fixed guide RNA pairs
US12297457B2 (en) 2017-10-10 2025-05-13 Children's Hospital Medical Center Esophageal tissue and/or organoid compositions and methods of making same
US12297436B2 (en) 2017-05-18 2025-05-13 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US12305204B2 (en) 2016-08-17 2025-05-20 The Broad Institute, Inc. CRISPR enzymes and systems
US12331347B2 (en) 2014-07-11 2025-06-17 President And Fellows Of Harvard College Methods for high-throughput labelling and detection of biological features in situ using microscopy
US12338436B2 (en) 2018-06-29 2025-06-24 Editas Medicine, Inc. Synthetic guide molecules, compositions and methods relating thereto
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
WO2025158400A1 (en) 2024-01-24 2025-07-31 Yale University Compositions and methods of natural killer cell hyperboosts for enhancement of nk cell therapy
US12379372B2 (en) 2017-12-21 2025-08-05 Children's Hospital Medical Center Digitalized human organoids and methods of using same
WO2025162985A1 (en) 2024-01-30 2025-08-07 Basf Plant Science Company Gmbh Increased plant disease resistance by expression of a glycine-rich protein
WO2025171210A1 (en) 2024-02-09 2025-08-14 Arbor Biotechnologies, Inc. Compositions and methods for gene editing via homology-mediated end joining
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12404514B2 (en) 2016-12-09 2025-09-02 The Broad Institute, Inc. CRISPR-systems for modifying a trait of interest in a plant
US12402610B2 (en) 2018-11-09 2025-09-02 The Broad Institute, Inc. Methods and compositions for modulating innate lymphoid cell pathogenic effectors
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12414967B2 (en) 2016-11-04 2025-09-16 Children's Hospital Medical Center Compositions and methods of treating liver disease
US12421500B2 (en) 2018-07-26 2025-09-23 Children's Hospital Medical Center Hepato-biliary-pancreatic tissues and methods of making same
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US12428622B2 (en) 2018-09-12 2025-09-30 Children's Hospital Medical Center Organoid compositions for the production of hematopoietic stem cells and derivatives thereof
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
WO2025212920A1 (en) 2024-04-03 2025-10-09 Children's Hospital Medical Center Multi-zonal liver organoids
WO2025217202A1 (en) 2024-04-08 2025-10-16 Children's Hospital Medical Center Bile duct organoid
EP4636083A2 (en) 2015-10-20 2025-10-22 Institut National de la Santé et de la Recherche Médicale (INSERM) Methods and products for genetic engineering
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
US12467086B2 (en) 2011-10-14 2025-11-11 President And Fellows Of Harvard College Sequencing by structure assembly
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12497597B2 (en) 2019-05-31 2025-12-16 Children's Hospital Medical Center Methods of generating and expanding hematopoietic stem cells
US12499971B2 (en) 2016-09-28 2025-12-16 The Broad Institute, Inc. Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof
US12505549B1 (en) 2020-05-22 2025-12-23 Insitro, Inc. Microscopy image analyses for disease modeling
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
WO2026006542A2 (en) 2024-06-26 2026-01-02 Yale University Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
WO2026015829A2 (en) 2024-07-12 2026-01-15 Arbor Biotechnologies, Inc. Small reverse transcriptases and gene editing systems comprising such
WO2026015832A2 (en) 2024-07-12 2026-01-15 Arbor Biotechnologies, Inc. Reverse transcriptases and gene editing systems comprising such
US12534714B2 (en) 2019-03-18 2026-01-27 The Broad Institute, Inc. Type VII CRISPR proteins and systems
US12534709B2 (en) 2019-05-31 2026-01-27 Children's Hospital Medical Center Shaped organoid compositions and methods of making same
US12534715B2 (en) 2015-04-16 2026-01-27 Wageningen Universiteit Nucleic acids for nuclease-mediated genome editing
US12559790B2 (en) 2020-01-29 2026-02-24 10X Genomics, Inc. Compositions and methods for analyte detection
US12565671B2 (en) 2016-08-31 2026-03-03 President And Fellows Of Harvard College Methods of combining the detection of biomolecules into a single assay using fluorescent in situ sequencing
WO2026047626A1 (en) 2024-08-30 2026-03-05 Inceptor Bio, Llc Compositions and methods involving immune cells engineered for binding bispecific antibodies for use in cell therapy
US12589115B2 (en) 2018-03-29 2026-03-31 The University Court Of The University Of Edinburgh Haematopoietic stem cell treatment
US12590288B2 (en) 2017-04-12 2026-03-31 The Broad Institute, Inc. Method of treating an inflammatory disease by administering an agent which binds a surface receptor on a tuft cell that induces an ILC class 2 inflammatory response
US12595478B2 (en) 2016-06-29 2026-04-07 The Broad Institute, Inc. Crispr-Cas systems having destabilization domain
US12600943B2 (en) 2019-02-01 2026-04-14 The University Of Hong Kong Innervated organoid compositions and methods of making same
US12617822B2 (en) 2018-09-18 2026-05-05 Aera Therapeutics, Inc. Arc-based capsids and uses thereof
US12629428B2 (en) 2020-04-14 2026-05-19 Duke University AAV vector-mediated deletion of large mutational hotspot for treatment of Duchenne muscular dystrophy

Families Citing this family (588)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2449112A1 (en) 2009-07-01 2012-05-09 Transposagen Biopharmaceuticals, Inc. Genetically modified rat models for severe combined immunodeficiency (scid)
US9528124B2 (en) 2013-08-27 2016-12-27 Recombinetics, Inc. Efficient non-meiotic allele introgression
US10920242B2 (en) 2011-02-25 2021-02-16 Recombinetics, Inc. Non-meiotic allele introgression
EP2689019A2 (en) 2011-03-23 2014-01-29 Pioneer Hi-Bred International Inc. Methods for producing a complex transgenic trait locus
WO2013119602A1 (en) 2012-02-06 2013-08-15 President And Fellows Of Harvard College Arrdc1-mediated microvesicles (armms) and uses thereof
US20150225734A1 (en) 2012-06-19 2015-08-13 Regents Of The University Of Minnesota Gene targeting in plants using dna viruses
US10648001B2 (en) 2012-07-11 2020-05-12 Sangamo Therapeutics, Inc. Method of treating mucopolysaccharidosis type I or II
CA2875618C (en) 2012-07-11 2021-04-27 Sangamo Biosciences, Inc. Methods and compositions for the treatment of lysosomal storage diseases
JP2015527889A (en) * 2012-07-25 2015-09-24 ザ ブロード インスティテュート, インコーポレイテッド Inducible DNA binding protein and genomic disruption tools and their applications
WO2014071182A1 (en) 2012-11-01 2014-05-08 Massachusetts Institute Of Technology Directed evolution of synthetic gene cluster
US11135273B2 (en) 2013-02-07 2021-10-05 The Rockefeller University Sequence specific antimicrobials
US10660943B2 (en) * 2013-02-07 2020-05-26 The Rockefeller University Sequence specific antimicrobials
WO2014204578A1 (en) 2013-06-21 2014-12-24 The General Hospital Corporation Using rna-guided foki nucleases (rfns) to increase specificity for rna-guided genome editing
US10378027B2 (en) 2013-03-15 2019-08-13 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US10760064B2 (en) 2013-03-15 2020-09-01 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US20140364333A1 (en) * 2013-03-15 2014-12-11 President And Fellows Of Harvard College Methods for Live Imaging of Cells
JP2016522679A (en) 2013-04-04 2016-08-04 プレジデント アンド フェローズ オブ ハーバード カレッジ Therapeutic use of genome editing with the CRISPR / Cas system
US11414695B2 (en) 2013-05-29 2022-08-16 Agilent Technologies, Inc. Nucleic acid enrichment using Cas9
JP2016528890A (en) 2013-07-09 2016-09-23 プレジデント アンド フェローズ オブ ハーバード カレッジ Therapeutic use of genome editing using the CRISPR / Cas system
WO2015054507A1 (en) 2013-10-10 2015-04-16 Pronutria, Inc. Nutritive polypeptide production systems, and methods of manufacture and use thereof
WO2015070062A1 (en) 2013-11-07 2015-05-14 Massachusetts Institute Of Technology Cell-based genomic recorded accumulative memory
CA2931684C (en) 2013-12-19 2024-02-20 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015103153A1 (en) * 2013-12-31 2015-07-09 The Regents Of The University Of California Cas9 crystals and methods of use thereof
EP3107999A4 (en) 2014-02-18 2017-10-04 Duke University Compositions for the inactivation of virus replication and methods of making and using the same
EP3971283A1 (en) 2014-02-27 2022-03-23 Monsanto Technology LLC Compositions and methods for site directed genomic modification
EP3593812A3 (en) 2014-03-15 2020-05-27 Novartis AG Treatment of cancer using chimeric antigen receptor
JP6815986B2 (en) 2014-03-26 2021-01-20 ユニバーシティ オブ メリーランド, カレッジ パーク Targeted genome editing in zygotes of large livestock
IL322264A (en) 2014-04-07 2025-09-01 Novartis Ag Treatment of cancer using anti-cd19 chimeric antigen receptor
US20160029604A1 (en) 2014-04-28 2016-02-04 Recombinetics, Inc. Multiplex gene editing
KR102149572B1 (en) 2014-05-19 2020-08-28 화이자 인코포레이티드 Substituted-6,8-dioxabicyclo[3.2.1]octane-2,3-diol compounds as targeting agents of asgpr
RU2704283C9 (en) * 2014-06-06 2020-02-07 Регенерон Фармасьютикалз, Инк. Methods and compositions for modifying target locus
EP3154694B1 (en) 2014-06-13 2025-01-29 Children's Medical Center Corporation Products and methods to isolate mitochondria
EP3919621A1 (en) 2014-06-23 2021-12-08 The General Hospital Corporation Genomewide unbiased identification of dsbs evaluated by sequencing (guide-seq)
WO2016007948A1 (en) * 2014-07-11 2016-01-14 Pioneer Hi-Bred International, Inc. Agronomic trait modification using guide rna/cas endonuclease systems and methods of use
CN106687594A (en) 2014-07-11 2017-05-17 纳幕尔杜邦公司 Compositions and methods for producing plants resistant to glyphosate herbicide
WO2016011203A1 (en) 2014-07-15 2016-01-21 Life Technologies Corporation Compositions with lipid aggregates and methods for efficient delivery of molecules to cells
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
MY181834A (en) 2014-07-21 2021-01-08 Novartis Ag Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US9777061B2 (en) 2014-07-21 2017-10-03 Novartis Ag Treatment of cancer using a CD33 chimeric antigen receptor
WO2016014530A1 (en) 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
US20170209492A1 (en) 2014-07-31 2017-07-27 Novartis Ag Subset-optimized chimeric antigen receptor-containing t-cells
US10513711B2 (en) 2014-08-13 2019-12-24 Dupont Us Holding, Llc Genetic targeting in non-conventional yeast using an RNA-guided endonuclease
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
SG11201700770PA (en) 2014-08-19 2017-03-30 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
CA2959070C (en) * 2014-08-27 2020-11-10 Caribou Biosciences, Inc. Methods for increasing cas9-mediated engineering efficiency
US10450584B2 (en) 2014-08-28 2019-10-22 North Carolina State University Cas9 proteins and guiding features for DNA targeting and genome editing
BR112017003757A2 (en) 2014-09-12 2017-12-26 Du Pont ? corn plants, parts of corn plants or corn seeds?
ES2891332T3 (en) 2014-09-17 2022-01-27 Novartis Ag Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US9616114B1 (en) 2014-09-18 2017-04-11 David Gordon Bermudes Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity
AU2015320738B2 (en) 2014-09-23 2021-12-02 Acceligen, Inc. Materials and methods for producing animals with short hair
US10040048B1 (en) 2014-09-25 2018-08-07 Synthego Corporation Automated modular system and method for production of biopolymers
CN105602935B (en) * 2014-10-20 2020-11-13 聂凌云 A novel mitochondrial genome editing tool
GB201418965D0 (en) 2014-10-24 2014-12-10 Ospedale San Raffaele And Fond Telethon
US9816080B2 (en) 2014-10-31 2017-11-14 President And Fellows Of Harvard College Delivery of CAS9 via ARRDC1-mediated microvesicles (ARMMs)
EP3215623A4 (en) 2014-11-06 2018-09-26 President and Fellows of Harvard College Cells lacking b2m surface expression and methods for allogeneic administration of such cells
JP6823593B2 (en) 2014-11-06 2021-02-03 イー・アイ・デュポン・ドウ・ヌムール・アンド・カンパニーE.I.Du Pont De Nemours And Company Peptide-mediated transport of RNA-induced endonucleases to cells
WO2016082135A1 (en) * 2014-11-27 2016-06-02 中国农业科学院北京畜牧兽医研究所 Method for porcine h11 site-specific insertion by using site-specific cleavage system
US20170327834A1 (en) 2014-12-15 2017-11-16 Syngenta Participations Ag Pesticidal microrna carriers and use thereof
DK3234150T3 (en) * 2014-12-16 2025-11-03 Danisco Us Inc SYSTEMS FOR FUNGAL GENOMODIFICATION AND METHODS FOR THEIR USE
JP6839082B2 (en) * 2014-12-17 2021-03-03 イー・アイ・デュポン・ドウ・ヌムール・アンド・カンパニーE.I.Du Pont De Nemours And Company E. using a guide RNA / CAS endonuclease system in combination with a cyclic polynucleotide modification template. Compositions and methods for efficient gene editing in E. coli
US20190054117A1 (en) 2014-12-19 2019-02-21 Novartis Ag Dimerization switches and uses thereof
US10190106B2 (en) 2014-12-22 2019-01-29 Univesity Of Massachusetts Cas9-DNA targeting unit chimeras
EP3237624B1 (en) 2014-12-23 2020-01-29 Syngenta Participations AG Methods and compositions for identifying and enriching for cells comprising site specific genomic modifications
CA2972454C (en) 2014-12-31 2024-09-10 Phykion Inc. Compositions and methods for high efficiency in vivo genome editing
EP3245232B1 (en) 2015-01-12 2021-04-21 The Regents of The University of California Heterodimeric cas9 and methods of use thereof
US11180792B2 (en) 2015-01-28 2021-11-23 The Regents Of The University Of California Methods and compositions for labeling a single-stranded target nucleic acid
SI3250691T1 (en) 2015-01-28 2023-10-30 Caribou Biosciences, Inc. Crispr hybrid dna/rna polynucleotides and methods of use
JP6817215B2 (en) 2015-03-03 2021-01-20 ザ ジェネラル ホスピタル コーポレイション Genetically engineered CRISPR-Cas9 nuclease with modified PAM specificity
CN104673816A (en) * 2015-03-05 2015-06-03 广东医学院 PCr-NHEJ (non-homologous end joining) carrier as well as construction method of pCr-NHEJ carrier and application of pCr-NHEJ carrier in site-specific knockout of bacterial genes
EP3553178A1 (en) 2015-03-27 2019-10-16 E. I. du Pont de Nemours and Company Soybean u6 small nuclear rna gene promoters and their use in constitutive expression of small rna genes in plants
WO2016168594A1 (en) * 2015-04-16 2016-10-20 President And Fellows Of Harvard College Sensor systems for target ligands and uses thereof
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
EP3289104B1 (en) 2015-04-29 2020-11-04 New York University Method for treating high-grade gliomas
CN106191040B (en) * 2015-04-30 2021-09-14 杭州菁因康生物科技有限公司 Gene targeting method
CA2988854A1 (en) 2015-05-08 2016-11-17 President And Fellows Of Harvard College Universal donor stem cells and related methods
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
EP3294878A1 (en) 2015-05-15 2018-03-21 Pioneer Hi-Bred International, Inc. Guide rna/cas endonuclease systems
WO2016187904A1 (en) * 2015-05-22 2016-12-01 深圳市第二人民医院 Method for pig cmah gene specific knockout by means of crispr-cas9 and sgrna for specially targeting cmah gene
US20180148711A1 (en) * 2015-05-28 2018-05-31 Coda Biotherapeutics, Inc. Genome editing vectors
EP3919622A1 (en) 2015-06-01 2021-12-08 Temple University - Of The Commonwealth System of Higher Education Methods and compositions for rna-guided treatment of hiv infection
EP3303634B1 (en) 2015-06-03 2023-08-30 The Regents of The University of California Cas9 variants and methods of use thereof
EP3302525A2 (en) 2015-06-05 2018-04-11 Novartis AG Methods and compositions for diagnosing, treating, and monitoring treatment of shank3 deficiency associated disorders
IL256175B2 (en) 2015-06-10 2024-10-01 Univ Texas Use of exosomes for the treatment of disease
JP7051438B2 (en) 2015-06-15 2022-04-11 ノース カロライナ ステート ユニバーシティ Methods and Compositions for Efficient Delivery of Nucleic Acid and RNA-Based Antibacterial Agents
JP2018518182A (en) 2015-06-17 2018-07-12 ザ ユーエービー リサーチ ファンデーション CRISPR / CAS9 complex for genome editing
CA2989858A1 (en) 2015-06-17 2016-12-22 The Uab Research Foundation Crispr/cas9 complex for introducing a functional polypeptide into cells of blood cell lineage
KR102197507B1 (en) 2015-07-13 2020-12-31 피벗 바이오, 인크. Methods and compositions for improving plant traits
JP7044373B2 (en) 2015-07-15 2022-03-30 ラトガース,ザ ステート ユニバーシティ オブ ニュージャージー Nuclease-independent targeted gene editing platform and its uses
US9580727B1 (en) 2015-08-07 2017-02-28 Caribou Biosciences, Inc. Compositions and methods of engineered CRISPR-Cas9 systems using split-nexus Cas9-associated polynucleotides
US11667691B2 (en) 2015-08-07 2023-06-06 Novartis Ag Treatment of cancer using chimeric CD3 receptor proteins
AU2016316845B2 (en) 2015-08-28 2022-03-10 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US9926546B2 (en) 2015-08-28 2018-03-27 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US9512446B1 (en) 2015-08-28 2016-12-06 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
IL241462A0 (en) 2015-09-10 2015-11-30 Yeda Res & Dev Heterologous engineering of betalain pigments in plants
CN108350453A (en) 2015-09-11 2018-07-31 通用医疗公司 The rough complete querying of nuclease DSB and sequencing (FIND-SEQ)
JP2018529353A (en) 2015-09-30 2018-10-11 ザ ジェネラル ホスピタル コーポレイション Comprehensive in vitro reporting of cleavage events by sequencing (CIRCLE-seq)
WO2017062412A1 (en) 2015-10-05 2017-04-13 Massachusetts Institute Of Technology Nitrogen fixation using refactored nif clusters
FI4144844T3 (en) 2015-10-12 2025-11-24 Dupont Us Holding Llc Protected dna templates for gene modification and increased homologous recombination in cells and methods of use
CN108138155A (en) 2015-10-20 2018-06-08 先锋国际良种公司 Restoring the function of a non-functional gene product via a guided CAS system and methods of use
EP3350327B1 (en) 2015-10-23 2018-09-26 Caribou Biosciences, Inc. Engineered crispr class 2 cross-type nucleic-acid targeting nucleic acids
JP2018532415A (en) * 2015-11-06 2018-11-08 ザ ジャクソン ラボラトリー Large genomic DNA knock-ins and uses thereof
WO2017083368A1 (en) * 2015-11-12 2017-05-18 Pfizer Inc. Tissue-specific genome engineering using crispr-cas9
US11306308B2 (en) 2015-11-13 2022-04-19 Massachusetts Institute Of Technology High-throughput CRISPR-based library screening
WO2017083852A1 (en) 2015-11-13 2017-05-18 MOORE, Tara Methods for the treatment of corneal dystrophies
EP3377042A4 (en) 2015-11-16 2019-05-29 The Research Institute at Nationwide Children's Hospital SUBSTANCES AND METHODS FOR THE TREATMENT OF MYOPATHIES BASED ON TITINE AND OTHER TITINOPATHIES
US11905521B2 (en) 2015-11-17 2024-02-20 The Chinese University Of Hong Kong Methods and systems for targeted gene manipulation
US12282014B2 (en) 2015-11-19 2025-04-22 Dana-Farber Cancer Institute, Inc. Methods of identifying compounds that interfere with ERG-driven misguidance of BAF complexes in TMPRSS2-ERG driven prostate cancers
EP3383411B1 (en) 2015-11-30 2025-07-09 Sana Biotechnology, Inc. Sub-mitochondrial particles for use in treating metabolic conditions
DK3371310T3 (en) 2015-12-04 2019-08-05 Caribou Biosciences Inc NUCLEIC ACID CONSTRUCTED TARGET NUCLEIC ACIDS
CA3007635A1 (en) 2015-12-07 2017-06-15 Zymergen Inc. Promoters from corynebacterium glutamicum
US11208649B2 (en) 2015-12-07 2021-12-28 Zymergen Inc. HTP genomic engineering platform
US9988624B2 (en) 2015-12-07 2018-06-05 Zymergen Inc. Microbial strain improvement by a HTP genomic engineering platform
DK3387134T3 (en) 2015-12-11 2020-12-21 Danisco Us Inc PROCEDURES AND COMPOSITIONS FOR INCREASED NUCLEASE MEDIATED GENERAL MODIFICATION AND REDUCED EFFECTS OUTSIDE THE OBJECTIVE
US12110490B2 (en) 2015-12-18 2024-10-08 The Broad Institute, Inc. CRISPR enzymes and systems
DK3390631T3 (en) 2015-12-18 2020-07-13 Danisco Us Inc METHODS AND COMPOSITIONS FOR T-RNA-BASED GUIDE RNA EXPRESSION
WO2017112620A1 (en) 2015-12-22 2017-06-29 North Carolina State University Methods and compositions for delivery of crispr based antimicrobials
IL304088A (en) 2016-01-11 2023-08-01 Univ Leland Stanford Junior Chimeric Proteins- Containing Systems and Uses Thereof in Regulating Gene Expression
MX2018008345A (en) 2016-01-11 2018-12-06 Univ Leland Stanford Junior Chimeric proteins and methods of immunotherapy.
ES3057779T3 (en) 2016-01-15 2026-03-04 Childrens Medical Ct Corp Therapeutic use of mitochondria and combined mitochondrial agents
BR112018015348A2 (en) 2016-01-26 2018-12-18 Pioneer Hi Bred Int method for obtaining a waxy maize plant, plant, seed, guide polynucleotide and method for producing a hybrid waxy maize plant
WO2017139309A1 (en) 2016-02-12 2017-08-17 Ceres, Inc. Methods and materials for high throughput testing of mutagenized allele combinations
EP3417061B1 (en) 2016-02-18 2022-10-26 The Regents of the University of California Methods and compositions for gene editing in stem cells
US10973930B2 (en) 2016-02-18 2021-04-13 The Penn State Research Foundation Generating GABAergic neurons in brains
WO2017151444A1 (en) 2016-02-29 2017-09-08 Agilent Technologies, Inc. Methods and compositions for blocking off-target nucleic acids from cleavage by crispr proteins
WO2017152023A1 (en) 2016-03-04 2017-09-08 Indoor Biotechnologies Inc. Fel d 1 knockouts and associated compositions and methods based on crispr-cas9 genomic editing
WO2017155715A1 (en) 2016-03-11 2017-09-14 Pioneer Hi-Bred International, Inc. Novel cas9 systems and methods of use
EP3426780A1 (en) 2016-03-11 2019-01-16 Pioneer Hi-Bred International, Inc. Novel cas9 systems and methods of use
CA3010628A1 (en) 2016-03-11 2017-09-14 Pioneer Hi-Bred International, Inc. Novel cas9 systems and methods of use
WO2017161043A1 (en) 2016-03-16 2017-09-21 The J. David Gladstone Institutes Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents
EP3443096B1 (en) 2016-04-15 2023-03-01 Novartis AG Compositions and methods for selective expression of chimeric antigen receptors
SG11201810179RA (en) 2016-04-19 2018-12-28 Broad Inst Inc Novel crispr enzymes and systems
AU2017253107B2 (en) 2016-04-19 2023-07-20 Massachusetts Institute Of Technology CPF1 complexes with reduced indel activity
CN105861485B (en) * 2016-04-20 2021-08-17 上海伊丽萨生物科技有限公司 Method for improving gene replacement efficiency
CN109641063B (en) 2016-04-20 2022-11-15 能源环境和技术研究中心O.A., M.P. Compositions and methods for enhancing gene expression of PKLR
WO2017201425A1 (en) * 2016-05-20 2017-11-23 The Trustees Columbia University In The City Of New York Anabolic enhancers for ameliorating neurodegeneration
EP3463371B1 (en) 2016-05-24 2022-02-23 Indiana University Research & Technology Corporation Ku inhibitors and their use
US11202840B2 (en) 2016-06-21 2021-12-21 The Curators Of The University Of Missouri Modified dystrophin proteins
WO2018005445A1 (en) 2016-06-27 2018-01-04 The Broad Institute, Inc. Compositions and methods for detecting and treating diabetes
WO2018005793A1 (en) 2016-06-30 2018-01-04 Zymergen Inc. Methods for generating a glucose permease library and uses thereof
JP2019519242A (en) 2016-06-30 2019-07-11 ザイマージェン インコーポレイテッド Method for generating a bacterial hemoglobin library and its use
US11359234B2 (en) * 2016-07-01 2022-06-14 Microsoft Technology Licensing, Llc Barcoding sequences for identification of gene expression
EP3478852B1 (en) 2016-07-01 2020-08-12 Microsoft Technology Licensing, LLC Storage through iterative dna editing
US20180004537A1 (en) 2016-07-01 2018-01-04 Microsoft Technology Licensing, Llc Molecular State Machines
SG11201900344YA (en) 2016-07-15 2019-02-27 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
US11078481B1 (en) 2016-08-03 2021-08-03 KSQ Therapeutics, Inc. Methods for screening for cancer targets
JP7215808B2 (en) * 2016-08-12 2023-01-31 ツールゲン インコーポレイテッド Engineered immunoregulatory elements and altered immunity
WO2018030874A1 (en) * 2016-08-12 2018-02-15 주식회사 툴젠 Manipulated immunoregulatory element and immunity altered thereby
EP3500677A4 (en) 2016-08-20 2020-04-01 Avellino Lab USA, Inc. UNIQUE GUIDE RNA, CRISPR / CAS9 SYSTEMS AND METHODS OF USE
WO2020225754A1 (en) 2019-05-06 2020-11-12 Mcmullen Tara Crispr gene editing for autosomal dominant diseases
US11078483B1 (en) 2016-09-02 2021-08-03 KSQ Therapeutics, Inc. Methods for measuring and improving CRISPR reagent function
JP7215994B2 (en) 2016-09-06 2023-01-31 ザ チルドレンズ メディカル センター コーポレーション Immune cells derived from induced pluripotent stem cells
WO2018049009A2 (en) 2016-09-07 2018-03-15 Sangamo Therapeutics, Inc. Modulation of liver genes
IL247752A0 (en) 2016-09-11 2016-11-30 Yeda Res & Dev Compositions and methods for regulating gene expression for targeted mutagenesis
WO2018064387A1 (en) 2016-09-28 2018-04-05 Novartis Ag Porous membrane-based macromolecule delivery system
JP2019532644A (en) 2016-09-30 2019-11-14 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア RNA-induced nucleic acid modifying enzyme and method of using the same
WO2018064352A1 (en) 2016-09-30 2018-04-05 The Regents Of The University Of California Rna-guided nucleic acid modifying enzymes and methods of use thereof
WO2018067546A1 (en) 2016-10-03 2018-04-12 President And Fellows Of Harvard College Delivery of therapeutic rnas via arrdc1-mediated microvesicles
US10669539B2 (en) 2016-10-06 2020-06-02 Pioneer Biolabs, Llc Methods and compositions for generating CRISPR guide RNA libraries
CA3037560A1 (en) 2016-10-13 2018-04-19 Pioneer Hi-Bred International, Inc. Generating northern leaf blight resistant maize
GB201617559D0 (en) 2016-10-17 2016-11-30 University Court Of The University Of Edinburgh The Swine comprising modified cd163 and associated methods
US10738338B2 (en) 2016-10-18 2020-08-11 The Research Foundation for the State University Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate
WO2018078134A1 (en) * 2016-10-28 2018-05-03 Genethon Compositions and methods for the treatment of myotonic dystrophy
WO2018081531A2 (en) 2016-10-28 2018-05-03 Ariad Pharmaceuticals, Inc. Methods for human t-cell activation
WO2018076335A1 (en) 2016-10-31 2018-05-03 Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences Compositions and methods for enhancing abiotic stress tolerance
CA3042259A1 (en) 2016-11-04 2018-05-11 Flagship Pioneering Innovations V. Inc. Novel plant cells, plants, and seeds
CN110168102A (en) 2016-11-15 2019-08-23 基因组影像公司 The method of the gene editing event of modified nucleic acid enzyme induction is monitored using molecule combing
WO2018100431A1 (en) 2016-11-29 2018-06-07 Genomic Vision Method for designing a set of polynucleotide sequences for analysis of specific events in a genetic region of interest
US9816093B1 (en) 2016-12-06 2017-11-14 Caribou Biosciences, Inc. Engineered nucleic acid-targeting nucleic acids
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
US20180179553A1 (en) 2016-12-14 2018-06-28 Ligandal, Inc. Compositions and methods for nucleic acid and/or protein payload delivery
CA3047163A1 (en) 2016-12-22 2018-06-28 Monsanto Technology Llc Genome editing-based crop engineering and production of brachytic plants
JP7219972B2 (en) 2017-01-05 2023-02-09 ラトガース,ザ ステート ユニバーシティ オブ ニュー ジャージー DNA double-strand break-independent targeted gene editing platform and its applications
EP3346001A1 (en) 2017-01-06 2018-07-11 TXCell Monospecific regulatory t cell population with cytotoxicity for b cells
WO2018127585A1 (en) 2017-01-06 2018-07-12 Txcell Monospecific regulatory t cell population with cytotoxicity for b cells
US11519009B2 (en) 2017-01-09 2022-12-06 University Of Massachusetts Complexes for gene deletion and editing
UA129256C2 (en) 2017-01-12 2025-03-05 Півот Байо, Інк. Methods and compositions for improving plant traits
EP3574005B1 (en) 2017-01-26 2021-12-15 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
SG11201906795SA (en) 2017-01-28 2019-08-27 Inari Agriculture Inc Novel plant cells, plants, and seeds
JP2020506700A (en) 2017-01-31 2020-03-05 ノバルティス アーゲー Cancer treatment using multispecific chimeric T cell receptor protein
CA3049989A1 (en) 2017-02-10 2018-08-16 Zymergen Inc. A modular universal plasmid design strategy for the assembly and editing of multiple dna constructs for multiple hosts
US10828330B2 (en) 2017-02-22 2020-11-10 IO Bioscience, Inc. Nucleic acid constructs comprising gene editing multi-sites and uses thereof
AU2018225180B2 (en) 2017-02-22 2024-09-12 Io Biosciences, Inc. Nucleic acid constructs comprising gene editing multi-sites and uses thereof
US20200048359A1 (en) 2017-02-28 2020-02-13 Novartis Ag Shp inhibitor compositions and uses for chimeric antigen receptor therapy
US20180265887A1 (en) 2017-03-16 2018-09-20 Jacobs Farm Del Cabo Basil Plants With High Tolerance to Downy Mildew
EP3601579B1 (en) 2017-03-31 2023-10-04 Pioneer Hi-Bred International, Inc. Expression modulating elements and use thereof
US11834670B2 (en) 2017-04-19 2023-12-05 Global Life Sciences Solutions Usa Llc Site-specific DNA modification using a donor DNA repair template having tandem repeat sequences
ES2992912T3 (en) 2017-04-21 2024-12-19 Massachusetts Gen Hospital Variants of cpf1 (cas12a) with altered pam specificity
US20200179511A1 (en) 2017-04-28 2020-06-11 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
US20200055948A1 (en) 2017-04-28 2020-02-20 Novartis Ag Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
CN110914431B (en) 2017-05-08 2024-04-19 株式会社图尔金 Human-manipulated immune cells
WO2019103857A1 (en) 2017-11-22 2019-05-31 Iovance Biotherapeutics, Inc. Expansion of peripheral blood lymphocytes (pbls) from peripheral blood
AU2018273986A1 (en) 2017-05-25 2019-12-12 The General Hospital Corporation Bipartite base editor (BBE) architectures and type-II-C-Cas9 zinc finger editing
EP3409104A1 (en) 2017-05-31 2018-12-05 Vilmorin et Cie Tomato plant resistant to tomato yellow leaf curl virus, powdery mildew, and nematodes
EP3409106A1 (en) 2017-06-01 2018-12-05 Vilmorin et Cie Tolerance in plants of solanum lycopersicum to the tobamovirus tomato brown rugose fruit virus (tbrfv)
WO2020249996A1 (en) 2019-06-14 2020-12-17 Vilmorin & Cie Resistance in plants of solanum lycopersicum to the tobamovirus tomato brown rugose fruit virus
AU2018280116B2 (en) 2017-06-05 2025-03-27 Research Institute At Nationwide Children's Hospital Enhanced modified viral capsid proteins
KR20200026874A (en) 2017-06-06 2020-03-11 지머젠 인코포레이티드 HTP Genome Engineering Platform for E. Coli Improvement
KR20200026878A (en) 2017-06-06 2020-03-11 지머젠 인코포레이티드 HTP Genome Engineering Platform to Improve Fungal Strains
EP3635119A4 (en) 2017-06-09 2021-04-14 Vilmorin & Cie COMPOSITIONS AND PROCEDURES FOR GENOMIC EDITING
IL271275B1 (en) 2017-06-13 2026-04-01 Flagship Pioneering Innovations V Inc Compositions comprising curons and uses thereof
SG11201912179SA (en) 2017-06-15 2020-01-30 Univ California Targeted non-viral dna insertions
US10392616B2 (en) 2017-06-30 2019-08-27 Arbor Biotechnologies, Inc. CRISPR RNA targeting enzymes and systems and uses thereof
US10510743B2 (en) * 2017-07-18 2019-12-17 Hong Kong Applied Science and Technology Research Institute Company, Limited Step fin field-effect-transistor (FinFET) with slim top of fin and thick bottom of fin for electro-static-discharge (ESD) or electrical over-stress (EOS) protection
DK3655532T3 (en) * 2017-07-18 2021-11-08 Genovie Ab TWO-COMPONENT VECTOR LIBRARY FOR QUICK COMPOSITION AND DIVERSIFICATION OF OPEN FULL-LENGTH T-CELL RECEPTOR READING FRAMES
WO2019023291A2 (en) 2017-07-25 2019-01-31 Dana-Farber Cancer Institute, Inc. Compositions and methods for making and decoding paired-guide rna libraries and uses thereof
US10476825B2 (en) 2017-08-22 2019-11-12 Salk Institue for Biological Studies RNA targeting methods and compositions
US11970720B2 (en) 2017-08-22 2024-04-30 Salk Institute For Biological Studies RNA targeting methods and compositions
CA3073448A1 (en) 2017-08-23 2019-02-28 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
MX2020001790A (en) 2017-08-25 2020-07-22 Codiak Biosciences Inc Preparation of therapeutic exosomes using membrane proteins.
CN111315889A (en) 2017-09-08 2020-06-19 生命技术公司 Methods and compositions for enhancing homologous recombination
US20190076814A1 (en) 2017-09-11 2019-03-14 Synthego Corporation Biopolymer synthesis system and method
ES3050594T3 (en) 2017-09-15 2025-12-22 Covercress Inc Low fiber pennycress meal and methods of making
WO2019056099A1 (en) 2017-09-19 2019-03-28 The University Of British Columbia Anti-hla-a2 antibodies and methods of using the same
JP7317023B2 (en) 2017-09-20 2023-07-28 ザ・ユニバーシティ・オブ・ブリティッシュ・コロンビア Novel anti-HLA-A2 antibodies and uses thereof
CN109517820B (en) 2017-09-20 2021-09-24 北京宇繁生物科技有限公司 A gRNA targeting HPK1 and an HPK1 gene editing method
US11917978B2 (en) 2017-09-21 2024-03-05 The Conard Pyle Company Miniature rose plant named ‘meibenbino’
US11252928B2 (en) 2017-09-21 2022-02-22 The Condard-Pyle Company Miniature rose plant named ‘Meibenbino’
WO2019060759A1 (en) 2017-09-21 2019-03-28 Dana-Farber Cancer Institute, Inc. Isolation, preservation, compositions and uses of extracts from justicia plants
BR112020005803A2 (en) 2017-09-25 2020-12-01 Agrospheres, Inc. compositions and methods for the modular production and administration of biological products
WO2019075197A1 (en) 2017-10-11 2019-04-18 The General Hospital Corporation Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies
SG11202002263TA (en) 2017-10-16 2020-04-29 Centro De Investigaciones Energeticas Medioambientales Y Tecnologicas Lentiviral vectors for delivery of pklr to treat pyruvate kinase deficiency
JP7420712B2 (en) 2017-10-25 2024-01-23 ピボット バイオ, インコーポレイテッド Methods and compositions for improving engineered microorganisms that fix nitrogen
US12151988B2 (en) 2017-10-25 2024-11-26 Pivot Bio, Inc. Gene targets for nitrogen fixation targeting for improving plant traits
WO2019084552A1 (en) 2017-10-27 2019-05-02 The Regents Of The University Of California Targeted replacement of endogenous t cell receptors
WO2019089798A1 (en) 2017-10-31 2019-05-09 Novartis Ag Anti-car compositions and methods
AU2018358051B2 (en) 2017-11-01 2025-01-09 The Regents Of The University Of California CasZ compositions and methods of use
US12227753B2 (en) 2017-11-01 2025-02-18 The Regents Of The University Of California CasY compositions and methods of use
WO2019090173A1 (en) 2017-11-02 2019-05-09 Arbor Biotechnologies, Inc. Novel crispr-associated transposon systems and components
WO2019084958A1 (en) 2017-11-06 2019-05-09 Shenzhen Cell Inspire Biotechnology Co., Ltd. Novel human induced pluripotent stem cell lines for modeling alzheimer's disease and usage thereof
EP3710039A4 (en) 2017-11-13 2021-08-04 The Broad Institute, Inc. METHODS AND COMPOSITIONS FOR CANCER TREATMENT BY TARGETING THE CLEC2D-KLRB1 PATH
CN111601883B (en) 2017-11-17 2024-06-21 艾欧凡斯生物治疗公司 Expansion of TILs from fine needle aspirates and small biopsies
WO2019112982A1 (en) * 2017-12-05 2019-06-13 Synthetic Genomics, Inc Improving algal lipid productivity via genetic modification of a signaling protein
CA3082956A1 (en) 2017-12-08 2019-06-13 Synthetic Genomics, Inc. Improving algal lipid productivity via genetic modification of a tpr domain containing protein
WO2019118463A1 (en) 2017-12-15 2019-06-20 Danisco Us Inc Cas9 variants and methods of use
WO2019118893A1 (en) 2017-12-15 2019-06-20 Dana-Farber Cancer Institute, Inc. Stabilized peptide-mediated targeted protein degradation
KR20200108275A (en) 2017-12-28 2020-09-17 코디악 바이오사이언시즈, 인크. Exosomes for immuno-oncology and anti-inflammatory therapy
WO2019133881A1 (en) 2017-12-29 2019-07-04 Rubius Therapeutics, Inc. Gene editing and targeted transcriptional modulation for enginerering erythroid cells
EP3740061A4 (en) 2018-01-19 2022-06-29 Covercress Inc. Low glucosinolate pennycress meal and methods of making
WO2019147743A1 (en) 2018-01-26 2019-08-01 Massachusetts Institute Of Technology Structure-guided chemical modification of guide rna and its applications
US11926835B1 (en) 2018-01-29 2024-03-12 Inari Agriculture Technology, Inc. Methods for efficient tomato genome editing
US11497752B2 (en) 2018-01-30 2022-11-15 Foghorn Therapeutics Inc. Compounds and uses thereof
KR102136132B1 (en) * 2018-01-31 2020-07-22 서울대학교 산학협력단 A method for producing avian leukosis virus(alv)-resistant avian line using crispr/cas9 system
AR114350A1 (en) 2018-01-31 2020-08-26 Res Institute At Nationwide Children’S Hospital GENETIC THERAPY FOR TYPE 2C MUSCULAR WAIST DYSTROPHY
WO2019157326A1 (en) 2018-02-08 2019-08-15 Zymergen Inc. Genome editing using crispr in corynebacterium
EP3755792A4 (en) 2018-02-23 2021-12-08 Pioneer Hi-Bred International, Inc. NEW CASE ORTHOLOGISTS9
WO2019173125A1 (en) 2018-03-09 2019-09-12 Pioneer Hi-Bred International, Inc. Compositions and methods for modification of fatty acids in soybean
AU2019236210B2 (en) 2018-03-14 2025-07-03 Arbor Biotechnologies, Inc. Novel CRISPR DNA targeting enzymes and systems
PT3765616T (en) 2018-03-14 2023-08-28 Arbor Biotechnologies Inc Novel crispr dna and rna targeting enzymes and systems
CN116536272A (en) 2018-04-06 2023-08-04 儿童医疗中心有限公司 Compositions and methods for reprogramming and adjusting imprinting of somatic cells
JP7576754B2 (en) 2018-04-11 2024-11-01 スペースクラフト セブン リミテッド ライアビリティ カンパニー Compositions and methods for stem cell transplantation
SG11202010116PA (en) 2018-04-13 2020-11-27 Sangamo Therapeutics France Chimeric antigen receptor specific for interleukin-23 receptor
EP3781585A4 (en) 2018-04-17 2022-01-26 The General Hospital Corporation SENSITIVE IN VITRO ASSAYS FOR SUBSTRATE AND SITE PREFERENCES OF NUCLEIC ACID BINDERS, MODIFIERS AND CLEAVATORS
GB2587970B (en) 2018-04-19 2023-02-08 Univ California Compositions and methods for gene editing
EP3784351A1 (en) 2018-04-27 2021-03-03 Novartis AG Car t cell therapies with enhanced efficacy
JP7568511B2 (en) 2018-04-27 2024-10-16 ジーンエディット インコーポレイテッド Cationic polymers and their use for biomolecule delivery - Patents.com
EP3784254A1 (en) 2018-04-27 2021-03-03 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
US12522812B2 (en) 2018-05-16 2026-01-13 Arbor Biotechnologies, Inc. CRISPR-associated systems and components
AU2019274597B2 (en) 2018-05-25 2025-11-13 Pioneer Hi-Bred International, Inc. Systems and methods for improved breeding by modulating recombination rates
CN108707628B (en) * 2018-05-28 2021-11-23 上海海洋大学 Preparation method of zebra fish notch2 gene mutant
US11866719B1 (en) 2018-06-04 2024-01-09 Inari Agriculture Technology, Inc. Heterologous integration of regulatory elements to alter gene expression in wheat cells and wheat plants
US20220403001A1 (en) 2018-06-12 2022-12-22 Obsidian Therapeutics, Inc. Pde5 derived regulatory constructs and methods of use in immunotherapy
AU2019284911B2 (en) 2018-06-13 2026-04-09 Novartis Ag BCMA chimeric antigen receptors and uses thereof
CA3102264A1 (en) 2018-06-19 2019-12-26 Lunella Biotech, Inc. "energetic" cancer stem cells (e-cscs): a new hyper-metabolic and proliferative tumor cell phenotype, driven by mitochondrial energy
EP3814302A4 (en) 2018-06-27 2022-06-29 Pivot Bio, Inc. Agricultural compositions comprising remodeled nitrogen fixing microbes
EP3813511A4 (en) 2018-06-27 2022-08-03 Pivot Bio, Inc. GUIDED MICROBIAL REMODELING, PLATFORM FOR THE RATIONAL IMPROVEMENT OF MICROBIAL SPECIES FOR AGRICULTURE
WO2020006458A1 (en) 2018-06-29 2020-01-02 Research Institute At Nationwide Children's Hospital Recombinant adeno-associated virus products and methods for treating limb girdle muscular dystrophy 2a
US12391624B2 (en) 2018-07-11 2025-08-19 Pivot Bio, Inc. Temporally and spatially targeted dynamic nitrogen delivery by remodeled microbes
JP2021530212A (en) 2018-07-13 2021-11-11 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニアThe Regents Of The University Of California Retrotransposon-based delivery medium and how to use it
WO2020018142A1 (en) 2018-07-16 2020-01-23 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
WO2020028729A1 (en) 2018-08-01 2020-02-06 Mammoth Biosciences, Inc. Programmable nuclease compositions and methods of use thereof
US20210292389A1 (en) 2018-08-10 2021-09-23 Sangamo Therapeutics France New car constructs comprising tnfr2 domains
EP3607819A1 (en) 2018-08-10 2020-02-12 Vilmorin et Cie Resistance to xanthomonas campestris pv. campestris (xcc) in cauliflower
EP3821020A4 (en) 2018-08-15 2022-05-04 Zymergen Inc. APPLICATIONS OF CRISPRI IN HIGH-THROUGHPUT METABOLIC ENGINEERING
EP3841205A4 (en) 2018-08-22 2022-08-17 The Regents of The University of California VARIANT TYPE V CRISPR/CAS EFFECTOR POLYPEPTIDES AND METHODS OF USE THEREOF
EP3841204A4 (en) 2018-08-23 2022-05-18 Sangamo Therapeutics, Inc. Engineered target specific base editors
KR102913044B1 (en) 2018-08-30 2026-01-16 더 유니버시티 오브 노쓰 캐롤라이나 엣 채플 힐 Feedback-enabled synthetic genes, target seed match cassettes, and uses thereof
US11459551B1 (en) 2018-08-31 2022-10-04 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
US12545910B2 (en) 2018-08-31 2026-02-10 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
US12534743B2 (en) 2018-08-31 2026-01-27 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
CN109265562B (en) * 2018-09-26 2021-03-30 北京市农林科学院 Nicking enzyme and application thereof in genome base replacement
WO2020072250A1 (en) 2018-10-01 2020-04-09 North Carolina State University Recombinant type i crispr-cas system and uses thereof for genome modification and alteration of expression
US10711267B2 (en) 2018-10-01 2020-07-14 North Carolina State University Recombinant type I CRISPR-Cas system
WO2020072253A1 (en) 2018-10-01 2020-04-09 North Carolina State University Recombinant type i crispr-cas system and uses thereof for screening for variant cells
US12264330B2 (en) 2018-10-01 2025-04-01 North Carolina State University Recombinant type I CRISPR-Cas system and uses thereof for killing target cells
US11851663B2 (en) 2018-10-14 2023-12-26 Snipr Biome Aps Single-vector type I vectors
WO2020081588A1 (en) 2018-10-17 2020-04-23 Dana-Farber Cancer Institute, Inc. Swi/snf family chromatin remodeling complexes and uses thereof
WO2020086742A1 (en) 2018-10-24 2020-04-30 Obsidian Therapeutics, Inc. Er tunable protein regulation
US12116458B2 (en) 2018-10-24 2024-10-15 Genedit Inc. Cationic polymer with alkyl side chains and use for biomolecule delivery
US11407995B1 (en) 2018-10-26 2022-08-09 Inari Agriculture Technology, Inc. RNA-guided nucleases and DNA binding proteins
SG11202104409YA (en) 2018-10-31 2021-05-28 Zymergen Inc Multiplexed deterministic assembly of dna libraries
JP2022505671A (en) 2018-10-31 2022-01-14 パイオニア ハイ-ブレッド インターナショナル, インコーポレイテッド Compositions and Methods for Ocrobactram-Mediated Gene Editing
US11434477B1 (en) 2018-11-02 2022-09-06 Inari Agriculture Technology, Inc. RNA-guided nucleases and DNA binding proteins
CR20210295A (en) 2018-11-05 2021-07-09 Iovance Biotherapeutics Inc Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
TW202039831A (en) 2018-11-05 2020-11-01 美商艾歐凡斯生物治療公司 Treatment of nsclc patients refractory for anti-pd-1 antibody
CA3118493A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Expansion of tils utilizing akt pathway inhibitors
TW202039829A (en) 2018-11-05 2020-11-01 美商艾歐凡斯生物治療公司 Selection of improved tumor reactive t-cells
EP3877517A4 (en) 2018-11-09 2022-09-07 Inari Agriculture, Inc. RNA-GUIDED NUCLEASES AND DNA-BINDING PROTEINS
WO2020102659A1 (en) 2018-11-15 2020-05-22 The Broad Institute, Inc. G-to-t base editors and uses thereof
JP7590968B2 (en) 2018-12-05 2024-11-27 アビオナ・セラピュ―ティクス・インコーポレイテッド Recombinant adeno-associated virus vectors for gene delivery
US11166996B2 (en) 2018-12-12 2021-11-09 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use
CN113166744B (en) 2018-12-14 2025-02-07 先锋国际良种公司 Novel CRISPR-Cas system for genome editing
WO2020128618A2 (en) 2018-12-18 2020-06-25 Braskem S.A. Co-production pathway for 3-hp and acetyl-coa derivatives from malonate semialdehyde
CN113396326A (en) 2018-12-19 2021-09-14 核酸有限责任公司 Apparatus and method for molecular diagnostics
WO2020131547A1 (en) 2018-12-19 2020-06-25 Iovance Biotherapeutics, Inc. Methods of expanding tumor infiltrating lymphocytes using engineered cytokine receptor pairs and uses thereof
US20220017911A1 (en) 2018-12-21 2022-01-20 Pivot Bio, Inc. Methods, compositions, and media for improving plant traits
EP3880807A2 (en) 2018-12-28 2021-09-22 Braskem S.A. Modulation of carbon flux through the meg and c3 pathways for the improved production of monoethylene glycol and c3 compounds
WO2020141199A1 (en) 2019-01-03 2020-07-09 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for enhancing cd8+ t cell-dependent immune responses in subjects suffering from cancer
EP3931313A2 (en) 2019-01-04 2022-01-05 Mammoth Biosciences, Inc. Programmable nuclease improvements and compositions and methods for nucleic acid amplification and detection
US12421519B2 (en) 2019-01-07 2025-09-23 Pivot Bio, Inc. Plant colonization assays using natural microbial barcodes
EP3911746A1 (en) 2019-01-14 2021-11-24 Institut National de la Santé et de la Recherche Médicale (INSERM) Methods and kits for generating and selecting a variant of a binding protein with increased binding affinity and/or specificity
WO2020160196A1 (en) 2019-01-29 2020-08-06 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2020160100A1 (en) 2019-01-29 2020-08-06 Foghorn Therapeutics Inc. Compounds and uses thereof
EP3921417A4 (en) 2019-02-04 2022-11-09 The General Hospital Corporation ADENINE DNA BASE EDITOR VARIANTS WITH REDUCED OFF-TARGET RNA EDITING
WO2020163528A1 (en) * 2019-02-06 2020-08-13 TearClear Corp. Systems and methods for preservative removal from ophthalmic formulations comprising complexing agents
US12180487B2 (en) 2019-02-06 2024-12-31 Fred Hutchinson Cancer Center Minicircle producing bacteria engineered to differentially methylate nucleic acid molecules therein
WO2020163856A1 (en) 2019-02-10 2020-08-13 The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone Modified mitochondrion and methods of use thereof
CA3131390A1 (en) 2019-02-26 2020-09-03 Research Institute Of Nationwide Children's Hospital Adeno-associated virus vector delivery of b-sarcoglycan and the treatment of muscular dystrophy
CN110177061B (en) * 2019-03-01 2023-04-07 致讯科技(天津)有限公司 Coordination method for signal interference in heterogeneous network
CN113748211A (en) 2019-03-01 2021-12-03 布拉斯科公司 Method for in vivo synthesis of 4-hydroxymethylfurfural and derivatives thereof
KR20210136050A (en) 2019-03-01 2021-11-16 이오반스 바이오테라퓨틱스, 인크. Expansion of tumor-infiltrating lymphocytes from liquid tumors and their therapeutic use
WO2020181193A1 (en) 2019-03-06 2020-09-10 The Broad Institute, Inc. T:a to a:t base editing through adenosine methylation
WO2020181178A1 (en) 2019-03-06 2020-09-10 The Broad Institute, Inc. T:a to a:t base editing through thymine alkylation
WO2020181195A1 (en) 2019-03-06 2020-09-10 The Broad Institute, Inc. T:a to a:t base editing through adenine excision
WO2020181180A1 (en) 2019-03-06 2020-09-10 The Broad Institute, Inc. A:t to c:g base editors and uses thereof
WO2020181202A1 (en) 2019-03-06 2020-09-10 The Broad Institute, Inc. A:t to t:a base editing through adenine deamination and oxidation
EP4219700A1 (en) 2019-03-07 2023-08-02 The Regents of the University of California Crispr-cas effector polypeptides and methods of use thereof
US11053515B2 (en) 2019-03-08 2021-07-06 Zymergen Inc. Pooled genome editing in microbes
KR20210149251A (en) 2019-03-08 2021-12-08 옵시디안 테라퓨틱스, 인크. Human carbonic anhydrase 2 compositions and methods for tunable modulation
CA3129871A1 (en) 2019-03-08 2020-09-17 Zymergen Inc. Iterative genome editing in microbes
US11845931B2 (en) 2019-03-18 2023-12-19 Regeneron Pharmaceuticals, Inc. CRISPR/Cas screening platform to identify genetic modifiers of tau seeding or aggregation
CA3127814C (en) 2019-03-18 2024-05-14 Regeneron Pharmaceuticals, Inc. Crispr/cas dropout screening platform to reveal genetic vulnerabilities associated with tau aggregation
WO2020190363A1 (en) 2019-03-19 2020-09-24 Massachusetts Institute Of Technology Control of nitrogen fixation in rhizobia that associate with cereals
RU2710731C1 (en) * 2019-04-02 2020-01-10 Общество с ограниченной ответственностью "Зеленые линии" YEAST GENOME EDITING SYSTEM DEBARYOMYCES HANSENII BASED ON CRISPR/Cas9
JP7715636B2 (en) 2019-04-04 2025-07-30 ブラスケム エス.エー. Metabolic engineering for simultaneous consumption of xylose and glucose to produce chemicals from second-generation sugars
WO2020208185A1 (en) * 2019-04-12 2020-10-15 Astrazeneca Ab Compositions and methods for improved gene editing
WO2020219776A1 (en) 2019-04-23 2020-10-29 Genedit Inc. Cationic polymer with alkyl side chains
EP3959320A1 (en) 2019-04-24 2022-03-02 Novartis AG Compositions and methods for selective protein degradation
CN114364788A (en) 2019-04-24 2022-04-15 皮沃特生物股份有限公司 Gene targets for targeting nitrogen fixation to improve plant traits
CN114008221A (en) 2019-04-25 2022-02-01 皮沃特生物股份有限公司 High throughput method for isolating and characterizing pools of ammonium secreting mutants generated by chemical mutagenesis
US11162079B2 (en) 2019-05-10 2021-11-02 The Regents Of The University Of California Blood type O Rh-hypo-immunogenic pluripotent cells
WO2020232029A1 (en) 2019-05-13 2020-11-19 Iovance Biotherapeutics, Inc. Methods and compositions for selecting tumor infiltrating lymphocytes and uses of the same in immunotherapy
US12116583B2 (en) 2019-05-14 2024-10-15 Yield10 Bioscience, Inc. Modified plants comprising a polynucleotide comprising a non-cognate promoter operably linked to a coding sequence that encodes a transcription factor
EP3973054A1 (en) 2019-05-20 2022-03-30 The Broad Institute Inc. Aav delivery of nucleobase editors
JP2022533713A (en) 2019-05-21 2022-07-25 サンガモ セラピューティクス, インコーポレイテッド Regulated transgene expression in regulatory T cells
JP7805789B2 (en) 2019-05-28 2026-01-26 ジーンエディット インコーポレイテッド Polymers containing multiple functionalized side chains for biomolecule delivery
MX2021014528A (en) 2019-05-29 2022-01-06 Monsanto Technology Llc Methods and compositions for generating dominant alleles using genome editing.
CA3142425A1 (en) * 2019-06-01 2020-12-10 Sivec Biotechnologies, Llc A bacterial platform for delivery of gene-editing systems to eukaryotic cells
WO2020244759A1 (en) 2019-06-05 2020-12-10 Klemm & Sohn Gmbh & Co. Kg New plants having a white foliage phenotype
KR20220024053A (en) 2019-06-14 2022-03-03 리제너론 파마슈티칼스 인코포레이티드 model of tauopathy
WO2020254850A1 (en) 2019-06-21 2020-12-24 Vilmorin & Cie Improvement of quality and permanence of green color of peppers at maturity and over-maturity
AU2020308448B2 (en) 2019-06-24 2026-04-30 Promega Corporation Modified polyamine polymers for delivery of biomolecules into cells
CN120665955A (en) 2019-06-25 2025-09-19 伊纳瑞农业技术有限公司 Improved homology dependent repair genome editing
JP7627255B2 (en) 2019-07-08 2025-02-05 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル ANTIBODY COMPOSITIONS FOR DISRUPTION OF BIOFILM - Patent application
CN110387405A (en) * 2019-07-17 2019-10-29 浙江善测禾骑士生物科技有限公司 A kind of (RT) RAA-CRISPR system of quick detection nucleic acid
CN110452966A (en) * 2019-07-17 2019-11-15 浙江善测禾骑士生物科技有限公司 It is a kind of to utilize RAA-CRISPR protease system rapid detection method
WO2021009299A1 (en) 2019-07-17 2021-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Bcl-xl:fkbp12 fusion proteins suitable for screening agents capable of slowing down the aging process
US11746354B2 (en) 2019-07-19 2023-09-05 Inari Agriculture Technology, Inc. Homology dependent repair genome editing
WO2021019272A1 (en) 2019-07-31 2021-02-04 Vilmorin & Cie Tolerance to tolcndv in cucumber
WO2021026294A1 (en) 2019-08-06 2021-02-11 Children's Medical Center Corporation Methods and compositions for reconstituting microglia
WO2021028359A1 (en) 2019-08-09 2021-02-18 Sangamo Therapeutics France Controlled expression of chimeric antigen receptors in t cells
WO2021030666A1 (en) 2019-08-15 2021-02-18 The Broad Institute, Inc. Base editing by transglycosylation
US20220282284A1 (en) * 2019-08-15 2022-09-08 The Rockefeller University Crispr genome editing with cell surface display to produce homozygously edited eukaryotic cells
EP4488287A3 (en) 2019-08-21 2025-03-05 Research Institute at Nationwide Children's Hospital Adeno-associated virus vector delivery of alpha-sarcoglycan and the treatment of muscular dystrophy
WO2021046451A1 (en) 2019-09-06 2021-03-11 Obsidian Therapeutics, Inc. Compositions and methods for dhfr tunable protein regulation
CA3150454A1 (en) 2019-09-09 2021-03-18 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
CN110541001A (en) * 2019-09-20 2019-12-06 福建上源生物科学技术有限公司 Gene knock-out method combining precise large-fragment gene deletion with stop codon insertion
CN114391040A (en) 2019-09-23 2022-04-22 欧米茄治疗公司 Compositions and methods for modulating apolipoprotein B (APOB) gene expression
AU2020352552A1 (en) 2019-09-23 2022-03-17 Omega Therapeutics, Inc. Compositions and methods for modulating hepatocyte nuclear factor 4-alpha (HNF4α) gene expression
JP2022550130A (en) 2019-09-26 2022-11-30 プレジデント アンド フェローズ オブ ハーバード カレッジ Minimal arrestin domain-containing protein 1 (ARRDC1) construct
EP3808766A1 (en) 2019-10-15 2021-04-21 Sangamo Therapeutics France Chimeric antigen receptor specific for interleukin-23 receptor
WO2021081378A1 (en) 2019-10-25 2021-04-29 Iovance Biotherapeutics, Inc. Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2021094805A1 (en) 2019-11-14 2021-05-20 Vilmorin & Cie Resistance to acidovorax valerianellae in corn salad
WO2021102084A1 (en) 2019-11-22 2021-05-27 President And Fellows Of Harvard College Ionic liquids for drug delivery
US20230086199A1 (en) 2019-11-26 2023-03-23 The Broad Institute, Inc. Systems and methods for evaluating cas9-independent off-target editing of nucleic acids
BR112022011372A2 (en) 2019-12-10 2022-08-23 Univ Indiana Trustees REPLICATION PROTEIN A (RPA)-DNA INTERACTION INHIBITORS
WO2021118990A1 (en) 2019-12-11 2021-06-17 Iovance Biotherapeutics, Inc. Processes for the production of tumor infiltrating lymphocytes (tils) and methods of using the same
EP4074821A4 (en) 2019-12-13 2024-01-17 Chugai Seiyaku Kabushiki Kaisha SYSTEM FOR DETECTION OF EXTRACELLULAR PURINERGICAL RECEPTOR LIGAND AND NON-HUMAN ANIMAL TO WHICH THE LATTER WAS TRANSFERRED
EP4706689A2 (en) 2019-12-19 2026-03-11 Entrada Therapeutics, Inc. Compositions for delivery of antisense compounds
CN116234906A (en) 2020-01-13 2023-06-06 萨那生物技术股份有限公司 Modification of blood group antigens
WO2021221690A1 (en) 2020-05-01 2021-11-04 Pivot Bio, Inc. Modified bacterial strains for improved fixation of nitrogen
IL294715A (en) 2020-01-23 2022-09-01 Childrens Medical Ct Corp Inducible t-cell differentiation from human pluripotent stem cells
WO2021151073A2 (en) 2020-01-24 2021-07-29 The General Hospital Corporation Unconstrained genome targeting with near-pamless engineered crispr-cas9 variants
WO2021151085A2 (en) 2020-01-24 2021-07-29 The General Hospital Corporation Crispr-cas enzymes with enhanced on-target activity
BR112022015004A2 (en) 2020-01-29 2022-09-20 Foghorn Therapeutics Inc COMPOUND, PHARMACEUTICAL COMPOSITION, METHODS TO DECREASE THE ACTIVITY OF A BAF COMPLEX, INDUCE APOPTOSIS, REDUCE TUMOR GROWTH, SUPPRESS PROGRESSION AND METASTATIC COLONIZATION OF CANCER, AND REDUCE THE LEVEL AND/OR ACTIVITY OF BRG1 AND/OR BRM IN A CANCER AND METHODS OF TREATMENT AND INHIBITION OF BRM AND BRG1
EP4100519A2 (en) 2020-02-05 2022-12-14 The Broad Institute, Inc. Adenine base editors and uses thereof
US12116580B2 (en) 2020-02-21 2024-10-15 The Board Of Trustees Of The University Of Illinois Genetic toolbox for metabolic engineering of non-conventional yeast
EP4118230A4 (en) 2020-03-09 2024-04-24 Nuclein, LLC MOLECULAR DIAGNOSIS APPARATUS AND METHODS
WO2021183720A1 (en) 2020-03-11 2021-09-16 Omega Therapeutics, Inc. Compositions and methods for modulating forkhead box p3 (foxp3) gene expression
AU2021237790A1 (en) 2020-03-20 2022-10-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Chimeric antigen receptor specific for human CD45RC and uses thereof
US20230165909A1 (en) 2020-04-21 2023-06-01 Aspen Neuroscience, Inc. Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom
US20250263752A1 (en) 2020-04-21 2025-08-21 Aspen Neuroscience, Inc. Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom
WO2021217082A1 (en) 2020-04-23 2021-10-28 Genedit Inc. Polymer with cationic and hydrophobic side chains
CA3172322A1 (en) 2020-05-01 2021-11-04 Karsten TEMME Modified bacterial strains for improved fixation of nitrogen
WO2021222643A1 (en) 2020-05-01 2021-11-04 Pivot Bio, Inc. Stable liquid formulations for nitrogen-fixing microorganisms
AU2020445067A1 (en) 2020-05-01 2022-12-01 Pivot Bio, Inc. Measurement of nitrogen fixation and incorporation
CA3176826A1 (en) 2020-05-04 2021-11-11 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
EP4146797A1 (en) 2020-05-06 2023-03-15 Orchard Therapeutics (Europe) Limited Treatment for neurodegenerative diseases
EP4149245A2 (en) 2020-05-13 2023-03-22 Pivot Bio, Inc. De-repression of nitrogen fixation in gram-positive microorganisms
US12383555B2 (en) 2020-05-20 2025-08-12 Foghorn Therapeutics Inc. Methods of treating cancers
GB202007943D0 (en) 2020-05-27 2020-07-08 Snipr Biome Aps Products & methods
WO2021245435A1 (en) 2020-06-03 2021-12-09 Vilmorin & Cie Melon plants resistant to scab disease, aphids and powdery mildew
EP4161552A1 (en) 2020-06-05 2023-04-12 The Broad Institute, Inc. Compositions and methods for treating neoplasia
BR112022024738A2 (en) 2020-06-05 2023-03-07 Vilmorin & Cie PLANT, PLANT CELL, TISSUE CULTURE OF CELLS, PLANT PART, SEED, USE OF A PLANT, METHODS FOR DETECTING AND/OR SELECTING PLANTS, CONFERRING TOBRFV RESISTANCE, IMPROVING TOMATO YIELD AND REDUCING TOMATO PRODUCTION LOSS AND USES OF A MARKER
CN116096862A (en) 2020-06-11 2023-05-09 诺华股份有限公司 ZBTB32 inhibitors and uses thereof
WO2022008935A1 (en) 2020-07-10 2022-01-13 Horizon Discovery Limited Method for producing genetically modified cells
US20230287458A1 (en) 2020-07-14 2023-09-14 Abeona Therapeutics Inc. Recombinant adeno-associated viral vectors for multipartite gene delivery
EP4189071A1 (en) 2020-08-03 2023-06-07 Institut National de la Santé et de la Recherche Médicale (INSERM) Population of treg cells functionally committed to exert a regulatory activity and their use for adoptive therapy
CN116096378A (en) 2020-08-10 2023-05-09 诺华股份有限公司 Treatment of Retinal Degenerative Diseases
US20220056470A1 (en) 2020-08-18 2022-02-24 Pioneer Hi-Bred International, Inc. Multiple disease resistance genes and genomic stacks thereof
WO2022040454A1 (en) 2020-08-20 2022-02-24 A2 Biotherapeutics, Inc. Compositions and methods for treating mesothelin positive cancers
EP4097486A4 (en) 2020-08-20 2023-09-06 A2 Biotherapeutics, Inc. COMPOSITIONS AND METHODS FOR TREATING CEACAM POSITIVE CANCER
EP4058474B1 (en) 2020-08-20 2024-05-08 A2 Biotherapeutics, Inc. Compositions and methods for treating egfr positive cancers
KR102424351B1 (en) * 2020-09-21 2022-08-05 한국과학기술원 CRISPR/Cas9 system for suppressing of parvalbumin gene expression and use thereof
US11944063B2 (en) 2020-09-30 2024-04-02 Spring Meadow Nursery, Inc. Hydrangea ‘SMNHPH’
WO2022068912A1 (en) 2020-09-30 2022-04-07 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
WO2022188039A1 (en) 2021-03-09 2022-09-15 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
JP7830442B2 (en) 2020-10-02 2026-03-16 ビルモラン エ コンパニー Melons with extended shelf life
EP4225330A1 (en) 2020-10-06 2023-08-16 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2022076606A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
EP4321015A3 (en) 2020-10-16 2024-04-17 Klemm & Sohn GmbH & Co. KG Double-flowering dwarf calibrachoa
US11155884B1 (en) 2020-10-16 2021-10-26 Klemm & Sohn Gmbh & Co. Kg Double-flowering dwarf Calibrachoa
WO2022093977A1 (en) 2020-10-30 2022-05-05 Fortiphyte, Inc. Pathogen resistance in plants
MX2023005609A (en) 2020-11-13 2023-05-29 Novartis Ag Combination therapies with chimeric antigen receptor (car)-expressing cells.
EP4255172A1 (en) 2020-12-03 2023-10-11 Vilmorin & Cie Tomato plants resistant to tobrfv, tmv, tomv and tommv and corresponding resistance genes
US20240123067A1 (en) 2020-12-17 2024-04-18 Iovance Biotherapeutics, Inc. Treatment of cancers with tumor infiltrating lymphocyte therapies
CA3202483A1 (en) 2020-12-17 2022-06-23 Maria Fardis Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors
KR20230124682A (en) 2020-12-23 2023-08-25 플래그쉽 파이어니어링 이노베이션스 브이, 인크. In vitro assembly of anellovirus capsid encapsulating RNA
CA3207144A1 (en) 2021-01-05 2022-07-14 Horizon Discovery Limited Method for producing genetically modified cells
WO2022150776A1 (en) * 2021-01-11 2022-07-14 Vedere Bio Ii, Inc. OPTOGENETIC COMPOSITIONS COMPRISING A CBh PROMOTER SEQUENCE AND METHODS FOR USE
WO2022165260A1 (en) 2021-01-29 2022-08-04 Iovance Biotherapeutics, Inc. Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy
US12171813B2 (en) 2021-02-05 2024-12-24 Christiana Care Gene Editing Institute, Inc. Methods of and compositions for reducing gene expression and/or activity
WO2022177979A1 (en) 2021-02-16 2022-08-25 A2 Biotherapeutics, Inc. Compositions and methods for treating her2 positive cancers
CN115427561B (en) 2021-03-09 2024-06-04 辉大(上海)生物科技有限公司 Engineered CRISPR/Cas13 system and uses thereof
JP2024509268A (en) 2021-03-09 2024-02-29 フォグホーン セラピューティクス インコーポレイテッド Crystal forms, compositions containing them, and methods of using them
JP2024510505A (en) 2021-03-19 2024-03-07 アイオバンス バイオセラピューティクス,インコーポレイテッド Methods for tumor-infiltrating lymphocyte (TIL) expansion and gene knockout in TILs associated with CD39/CD69 selection
WO2022204564A2 (en) 2021-03-25 2022-09-29 Iovance Biotherapeutics, Inc. Methods and compositions for t-cell coculture potency assays and use with cell therapy products
US20250243244A1 (en) 2021-03-31 2025-07-31 Entrada Therapeutics, Inc. Cyclic cell penetrating peptides
WO2022208489A1 (en) 2021-04-02 2022-10-06 Vilmorin & Cie Semi-determinate or determinate growth habit trait in cucurbita
KR20240037185A (en) 2021-04-19 2024-03-21 이오반스 바이오테라퓨틱스, 인크. Chimeric costimulatory receptors, chemokine receptors, and their uses in cellular immunotherapy
CA3217862A1 (en) 2021-05-05 2022-11-10 Radius Pharmaceuticals, Inc. Animal model having homologous recombination of mouse pth1 receptor
AU2022271873A1 (en) 2021-05-10 2024-01-04 Entrada Therapeutics, Inc. Compositions and methods for intracellular therapeutics
EP4337261A2 (en) 2021-05-10 2024-03-20 Entrada Therapeutics, Inc. Compositions and methods for modulating mrna splicing
WO2022240721A1 (en) 2021-05-10 2022-11-17 Entrada Therapeutics, Inc. Compositions and methods for modulating interferon regulatory factor-5 (irf-5) activity
US20240352456A1 (en) 2021-05-13 2024-10-24 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Compositions and methods for treating sickle cell diseases
JP2024519029A (en) 2021-05-17 2024-05-08 アイオバンス バイオセラピューティクス,インコーポレイテッド PD-1 gene-edited tumor-infiltrating lymphocytes and their use in immunotherapy
WO2022261509A1 (en) 2021-06-11 2022-12-15 The Broad Institute, Inc. Improved cytosine to guanine base editors
EP4352131A1 (en) 2021-06-11 2024-04-17 Genedit Inc. Biodegradable polymer comprising side chains with polyamine and polyalkylene oxide groups
US20240271212A1 (en) * 2021-06-14 2024-08-15 The University Of Chicago Characterization and treatment of asthma
GEAP202416440A (en) 2021-06-23 2024-04-25 Entrada Therapeutics Inc Antisense compounds and methods for targeting cug repeats
AU2022301301A1 (en) 2021-07-02 2023-12-14 Pivot Bio, Inc. Genetically-engineered bacterial strains for improved fixation of nitrogen
WO2023283359A2 (en) 2021-07-07 2023-01-12 Omega Therapeutics, Inc. Compositions and methods for modulating secreted frizzled receptor protein 1 (sfrp1) gene expression
JP2024526898A (en) 2021-07-22 2024-07-19 アイオバンス バイオセラピューティクス,インコーポレイテッド Methods for cryopreservation of solid tumor fragments
WO2023009716A1 (en) 2021-07-28 2023-02-02 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors
KR20250160365A (en) 2021-07-30 2025-11-12 헬라이나, 인크. Methods and compositions for protein synthesis and secretion
MX2024001624A (en) 2021-08-06 2024-04-30 Vilmorin & Cie RESISTANCE TO <i>LEVEILLULA TAURICA</i> IN PEPPER.
EP4396357A1 (en) 2021-09-02 2024-07-10 SESVanderHave NV Methods and compositions for ppo herbicide tolerance
EP4596697A3 (en) 2021-09-28 2025-08-27 Acrigen Biosciences Compositions and methods for nucleic acid modifications
JP2024536223A (en) 2021-09-30 2024-10-04 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム SLC13A5 GENE THERAPY VECTORS AND USES THEREOF
IL311885A (en) 2021-10-08 2024-06-01 Harvard College Ionic liquids for drug delivery
IL311570A (en) 2021-10-14 2024-05-01 Arsenal Biosciences Inc Immune cells having co-expressed shrnas and logic gate systems
US12285497B2 (en) 2021-10-15 2025-04-29 Research Institute At Nationwide Children's Hospital Self-complementary adeno-associated virus vector and its use in treatment of muscular dystrophy
CA3235824A1 (en) 2021-10-27 2023-05-04 Frederick G. Vogt Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy
WO2023077148A1 (en) 2021-11-01 2023-05-04 Tome Biosciences, Inc. Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo
EP4426832A1 (en) 2021-11-03 2024-09-11 The J. David Gladstone Institutes, A Testamentary Trust Established under The Will of J. David Gladstone Precise genome editing using retrons
WO2023081762A2 (en) * 2021-11-03 2023-05-11 The Regents Of The University Of California Serine recombinases
US20250032618A1 (en) 2021-11-10 2025-01-30 Iovance Biotherapeutics, Inc. Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes
US20250011781A1 (en) * 2021-11-22 2025-01-09 The Texas A&M University System Methods and compositions targeting nucleus accumbens-associated protein-1 for treatment of autoimmune disorders and cancers
EP4430199A2 (en) 2021-11-24 2024-09-18 Research Institute at Nationwide Children's Hospital Chimeric hsv expressing hil21 to boost anti-tumor immune activity
WO2023102406A1 (en) 2021-12-01 2023-06-08 The Board Of Regents Of The Univesity Of Texas System Vector genome design to express optimized cln7 transgene
WO2023102518A1 (en) 2021-12-03 2023-06-08 The Board Of Regents Of The University Of Texas System Gnao1 gene therapy vectors and uses thereof
GB202118058D0 (en) 2021-12-14 2022-01-26 Univ Warwick Methods to increase yields in crops
US20230279442A1 (en) 2021-12-15 2023-09-07 Versitech Limited Engineered cas9-nucleases and method of use thereof
WO2023115041A1 (en) 2021-12-17 2023-06-22 Sana Biotechnology, Inc. Modified paramyxoviridae attachment glycoproteins
US20250059239A1 (en) 2021-12-17 2025-02-20 Sana Biotechnology, Inc. Modified paramyxoviridae fusion glycoproteins
WO2023122805A1 (en) 2021-12-20 2023-06-29 Vestaron Corporation Sorbitol driven selection pressure method
EP4452335A1 (en) 2021-12-22 2024-10-30 Tome Biosciences, Inc. Co-delivery of a gene editor construct and a donor template
KR20240133725A (en) 2021-12-23 2024-09-04 유니버시티 오브 매사추세츠 Treatment of Fragile X-related disorders
WO2023133595A2 (en) 2022-01-10 2023-07-13 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023141602A2 (en) 2022-01-21 2023-07-27 Renagade Therapeutics Management Inc. Engineered retrons and methods of use
WO2023147488A1 (en) 2022-01-28 2023-08-03 Iovance Biotherapeutics, Inc. Cytokine associated tumor infiltrating lymphocytes compositions and methods
EP4469582A1 (en) 2022-01-28 2024-12-04 The Board Of Regents Of The University Of Texas System Transgene cassette designed to express the human codon-optimized gene
EP4472646A1 (en) 2022-02-01 2024-12-11 Sana Biotechnology, Inc. Cd3-targeted lentiviral vectors and uses thereof
WO2023150647A1 (en) 2022-02-02 2023-08-10 Sana Biotechnology, Inc. Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses
EP4479143A1 (en) 2022-02-18 2024-12-25 Institut National de la Santé et de la Recherche Médicale (INSERM) Use of tcr-deficient car-tregs in combination with anti-tcr complex monoclonal antibodies for inducing durable tolerance
EP4504925A1 (en) 2022-04-04 2025-02-12 The Broad Institute, Inc. Cas9 variants having non-canonical pam specificities and uses thereof
EP4256950A1 (en) 2022-04-06 2023-10-11 Vilmorin et Cie Tolerance to cgmmv in cucumber
CA3247638A1 (en) 2022-04-06 2023-10-12 Maria Fardis Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2023201369A1 (en) 2022-04-15 2023-10-19 Iovance Biotherapeutics, Inc. Til expansion processes using specific cytokine combinations and/or akti treatment
WO2023205744A1 (en) 2022-04-20 2023-10-26 Tome Biosciences, Inc. Programmable gene insertion compositions
CN120456933A (en) 2022-04-28 2025-08-08 布罗德研究所股份有限公司 AAV vectors encoding base editors and their uses
WO2023215831A1 (en) 2022-05-04 2023-11-09 Tome Biosciences, Inc. Guide rna compositions for programmable gene insertion
EP4522203A1 (en) 2022-05-09 2025-03-19 Synteny Therapeutics, Inc. Erythroparvovirus with a modified capsid for gene therapy
WO2023219933A1 (en) 2022-05-09 2023-11-16 Entrada Therapeutics, Inc. Compositions and methods for delivery of nucleic acid therapeutics
WO2023220035A1 (en) 2022-05-09 2023-11-16 Synteny Therapeutics, Inc. Erythroparvovirus compositions and methods for gene therapy
EP4522210A1 (en) 2022-05-09 2025-03-19 Synteny Therapeutics, Inc. Erythroparvovirus with a modified genome for gene therapy
US20250281537A1 (en) 2022-05-10 2025-09-11 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with an il-15r agonist
WO2023225670A2 (en) 2022-05-20 2023-11-23 Tome Biosciences, Inc. Ex vivo programmable gene insertion
EP4532768A2 (en) 2022-05-25 2025-04-09 Flagship Pioneering Innovations VII, LLC Compositions and methods for modulating circulating factors
CN119563038A (en) 2022-05-25 2025-03-04 旗舰创业创新七公司 Compositions and methods for modulating immune responses
CA3254044A1 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulation of tumor suppressors and oncogenes
WO2023230570A2 (en) 2022-05-25 2023-11-30 Flagship Pioneering Innovations Vii, Llc Compositions and methods for modulating genetic drivers
JP2025517967A (en) 2022-05-25 2025-06-12 フラッグシップ パイオニアリング イノベーションズ セブン,エルエルシー Compositions and methods for modulating cytokines
WO2024005863A1 (en) 2022-06-30 2024-01-04 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
EP4299733A1 (en) 2022-06-30 2024-01-03 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
GB2621813A (en) 2022-06-30 2024-02-28 Univ Newcastle Preventing disease recurrence in Mitochondrial replacement therapy
EP4299739A1 (en) 2022-06-30 2024-01-03 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
WO2024005864A1 (en) 2022-06-30 2024-01-04 Inari Agriculture Technology, Inc. Compositions, systems, and methods for genome editing
EP4548351A1 (en) 2022-06-30 2025-05-07 Pioneer Hi-Bred International, Inc. Artificial intelligence-mediated methods and systems for genome editing
CN120344660A (en) 2022-07-18 2025-07-18 雷纳嘉德医疗管理公司 Gene editing components, systems and methods of use
WO2024020587A2 (en) 2022-07-22 2024-01-25 Tome Biosciences, Inc. Pleiopluripotent stem cell programmable gene insertion
WO2024023578A1 (en) 2022-07-28 2024-02-01 Institut Pasteur Hsc70-4 in host-induced and spray-induced gene silencing
WO2024026406A2 (en) 2022-07-29 2024-02-01 Vestaron Corporation Next Generation ACTX Peptides
WO2024036190A2 (en) 2022-08-09 2024-02-15 Pioneer Hi-Bred International, Inc. Guide polynucleotide multiplexing
EP4573191A1 (en) 2022-08-16 2025-06-25 The Broad Institute, Inc. Evolved cytosine deaminases and methods of editing dna using same
US20260055426A1 (en) 2022-08-19 2026-02-26 Generation Bio Co. CLEAVABLE CLOSED-ENDED DNA (ceDNA) AND METHODS OF USE THEREOF
US20260055146A1 (en) 2022-08-24 2026-02-26 Sana Biotechnology, Inc. Delivery of heterologous proteins
WO2024044723A1 (en) 2022-08-25 2024-02-29 Renagade Therapeutics Management Inc. Engineered retrons and methods of use
CA3265262A1 (en) 2022-09-01 2024-03-07 SESVanderHave NV Methods and compositions for ppo herbicide tolerance
WO2024050544A2 (en) 2022-09-01 2024-03-07 J.R. Simplot Company Enhanced targeted knock-in frequency in host genomes through crispr exonuclease processing
EP4583905A1 (en) 2022-09-06 2025-07-16 Institut National de la Santé et de la Recherche Médicale Novel dual split car-t cells for the treatment of cd38-positive hematological malignancies
WO2024064838A1 (en) 2022-09-21 2024-03-28 Sana Biotechnology, Inc. Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof
WO2024081820A1 (en) 2022-10-13 2024-04-18 Sana Biotechnology, Inc. Viral particles targeting hematopoietic stem cells
WO2024098024A1 (en) 2022-11-04 2024-05-10 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes from liquid tumors and therapeutic uses thereof
EP4612277A1 (en) 2022-11-04 2025-09-10 Iovance Biotherapeutics, Inc. Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection
WO2024102434A1 (en) 2022-11-10 2024-05-16 Senda Biosciences, Inc. Rna compositions comprising lipid nanoparticles or lipid reconstructed natural messenger packs
KR20250122544A (en) 2022-11-21 2025-08-13 이오반스 바이오테라퓨틱스, 인크. A two-dimensional process for the expansion of tumor-infiltrating lymphocytes and therapies using the same
WO2024118836A1 (en) 2022-11-30 2024-06-06 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes with shortened rep step
WO2024119157A1 (en) 2022-12-02 2024-06-06 Sana Biotechnology, Inc. Lipid particles with cofusogens and methods of producing and using the same
WO2024123786A1 (en) 2022-12-06 2024-06-13 Pioneer Hi-Bred International, Inc. Methods and compositions for co-delivery of t-dnas expressing multiple guide polynucleotides into plants
WO2024138194A1 (en) 2022-12-22 2024-06-27 Tome Biosciences, Inc. Platforms, compositions, and methods for in vivo programmable gene insertion
WO2024137259A1 (en) 2022-12-23 2024-06-27 Pivot Bio, Inc. Combination of various nitrogen fixing bacteria with various biological products to achieve synergistic effects
WO2024141599A1 (en) 2022-12-29 2024-07-04 Vilmorin & Cie Tomato plants resistant to resistance-breaking tswv strains and corresponding resistance genes
EP4652271A1 (en) 2023-01-18 2025-11-26 The Broad Institute, Inc. Base editing-mediated readthrough of premature termination codons (bert)
EP4658061A1 (en) 2023-02-01 2025-12-10 United Beet Seeds Beet yellows virus resistance
JP2026510998A (en) 2023-03-20 2026-04-10 パイオニア ハイ-ブレッド インターナショナル, インコーポレイテッド Cas polypeptide with modified PAM recognition
US12383615B2 (en) 2023-03-23 2025-08-12 Carbon Biosciences, Inc. Protoparvovirus compositions comprising a protoparvovirus variant VP1 capsid polypeptide and related methods
US12225874B2 (en) 2023-03-27 2025-02-18 Redsea Science And Technology Inc. Tomato plant designated ‘X22-31’
WO2024206687A1 (en) * 2023-03-29 2024-10-03 William Marsh Rice University Methods and compostions for engineered mitochondrial biogenesis
WO2024211287A1 (en) 2023-04-03 2024-10-10 Seagen Inc. Production cell lines with targeted integration sites
WO2024220560A1 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Engineered protein g fusogens and related lipid particles and methods thereof
WO2024220598A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Lentiviral vectors with two or more genomes
WO2024220719A1 (en) 2023-04-18 2024-10-24 Crystal Ronald G Modified aav capsids for gene delivery
WO2024220574A1 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Universal protein g fusogens and adapter systems thereof and related lipid particles and uses
CN121443140A (en) 2023-04-21 2026-01-30 非营利性组织佛兰芒综合大学生物技术研究所 Allele combinations for crop yield enhancement
WO2024226499A1 (en) 2023-04-24 2024-10-31 The Broad Institute, Inc. Compositions and methods for modifying fertility
WO2024223900A1 (en) 2023-04-28 2024-10-31 Vilmorin & Cie Genetic determinants conferring improved tobrfv resistance
WO2024234006A1 (en) 2023-05-11 2024-11-14 Tome Biosciences, Inc. Systems, compositions, and methods for targeting liver sinusodial endothelial cells (lsecs)
WO2024243438A2 (en) 2023-05-23 2024-11-28 Omega Therapeutics, Inc. Compositions and methods for reducing cxcl9, cxcl10, and cxcl11 gene expression
AU2024274792A1 (en) 2023-05-23 2025-10-23 Sana Biotechnology, Inc. Tandem fusogens and related lipid particles
EP4734755A1 (en) 2023-06-28 2026-05-06 Vilmorin & Cie Pepper resistance to meloidogyne enterolobii
CN121548346A (en) 2023-07-24 2026-02-17 维尔莫林公司 Melon resistance to CYSDV
WO2025030048A2 (en) 2023-08-03 2025-02-06 J.R. Simplot Company Fusarium wilt resistance genes
US20250059551A1 (en) 2023-08-14 2025-02-20 The Texas A&M University System Corn endotype-derived polypeptides capable of metabolizing fumonisin
WO2025050069A1 (en) 2023-09-01 2025-03-06 Tome Biosciences, Inc. Programmable gene insertion using engineered integration enzymes
WO2025049959A2 (en) 2023-09-01 2025-03-06 Renagade Therapeutics Management Inc. Gene editing systems, compositions, and methods for treatment of vexas syndrome
WO2025054202A1 (en) 2023-09-05 2025-03-13 Sana Biotechnology, Inc. Method of screening a sample comprising a transgene with a unique barcode
WO2025054540A1 (en) 2023-09-08 2025-03-13 Iovance Biotherapeutics, Inc. Methods of gene-editing using programmable nucleases
WO2025064408A1 (en) 2023-09-18 2025-03-27 The Broad Institute, Inc. Compositions and methods for treating cardiovascular disease
GB202314578D0 (en) 2023-09-22 2023-11-08 Univ Manchester Methods of producing homoplasmic modified plants or parts thereof
EP4554371A4 (en) 2023-10-03 2026-04-22 Inari Agriculture Tech Inc VIRAL RELEASE OF GRNA TO THE SCINE
AU2024357861A1 (en) 2023-10-12 2026-04-23 Renagade Therapeutics Management Inc. Nickase-retron template-based precision editing system and methods of use
WO2025101484A1 (en) 2023-11-06 2025-05-15 Iovance Biotherapeutics, Inc. Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies
TW202523695A (en) 2023-11-22 2025-06-16 美商旗艦先鋒創新有限責任(Vii)公司 Methods and compositions for treating non-alcoholic fatty liver disease
WO2025151838A1 (en) 2024-01-12 2025-07-17 Sana Biotechnology, Inc. Safety switches to control in vitro and in vivo proliferation of cell therapy products
WO2025155753A2 (en) 2024-01-17 2025-07-24 Renagade Therapeutics Management Inc. Improved gene editing system, guides, and methods
WO2025155521A1 (en) 2024-01-18 2025-07-24 Pivot Bio, Inc. Host cells for enhanced plant growth
WO2025155518A1 (en) 2024-01-18 2025-07-24 Pivot Bio, Inc. Host cells for enhanced plant growth
WO2025168705A1 (en) 2024-02-08 2025-08-14 Vib Vzw Means and methods for the production of saponins with endosomal escape-enhancing properties
WO2025174765A1 (en) 2024-02-12 2025-08-21 Renagade Therapeutics Management Inc. Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents
WO2025184529A1 (en) 2024-03-01 2025-09-04 Sana Biotechnology, Inc. Viral particles with fusogen display and related compositions and methods
WO2025184759A1 (en) 2024-03-04 2025-09-12 Pioneer Hi-Bred International, Inc. Maize plants comprising resistance to gray leaf spot and compositions and methods for selecting and producing the same
WO2025186284A1 (en) 2024-03-05 2025-09-12 Vilmorin & Cie Increased yield in cucumber
WO2025194019A1 (en) 2024-03-14 2025-09-18 Flagship Pioneering Innovations Vii, Llc Methods for treating liver fibrosis and non-alcoholic fatty liver disease
WO2025202473A1 (en) 2024-03-28 2025-10-02 Revvity Discovery Limited A nucleic acid deaminase, a base editor and uses thereof
EP4677108A1 (en) 2024-04-22 2026-01-14 Basecamp Research Ltd Method and compositions for detecting off-target editing
WO2025224182A2 (en) 2024-04-23 2025-10-30 Basecamp Research Ltd Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo
WO2025232898A1 (en) 2024-05-10 2025-11-13 Yoltech Therapeutics Co., Ltd Lipid compounds and lipid nanoparticle compositions
WO2025240947A1 (en) 2024-05-17 2025-11-20 University Of Massachusetts Therapeutic treatment for fragile x-associated disorder
WO2025245188A2 (en) 2024-05-21 2025-11-27 Flagship Pioneering Innovations Vii, Llc Methods of treating liver steatosis and non-alcoholic fatty liver disease
WO2025259554A1 (en) 2024-06-13 2025-12-18 J.R. Simplot Company Engineering remontant flowering in rosaceae
WO2026015523A1 (en) 2024-07-09 2026-01-15 Pioneer Hi-Bred International, Inc. Methods and systems for use in plant breeding
WO2026017833A1 (en) 2024-07-17 2026-01-22 Vilmorin & Cie Tswv-resistant pepper
WO2026036000A1 (en) 2024-08-08 2026-02-12 Invaio Sciences, Inc. Nature-derived lipid particles for use in agriculture
WO2026072421A2 (en) 2024-09-27 2026-04-02 The Broad Institute, Inc. Base editing methods and compositions for editing prnp in the treatment of prion disease
WO2026096383A1 (en) 2024-10-28 2026-05-07 The Broad Institute, Inc. Compositions and methods for inducing phagocytosis
CN119601083A (en) * 2024-11-16 2025-03-11 大连易康生物科技有限公司 A gene sequencing data processing method and system
CN119874861B (en) * 2025-01-10 2025-11-25 中国科学院遗传与发育生物学研究所 Application of the SlABCG45 gene in improving broomrape resistance and yield in tomatoes

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4186183A (en) 1978-03-29 1980-01-29 The United States Of America As Represented By The Secretary Of The Army Liposome carriers in chemotherapy of leishmaniasis
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4261975A (en) 1979-09-19 1981-04-14 Merck & Co., Inc. Viral liposome particle
US4485054A (en) 1982-10-04 1984-11-27 Lipoderm Pharmaceuticals Limited Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV)
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
EP0264166A1 (en) 1986-04-09 1988-04-20 Genzyme Corporation Transgenic animals secreting desired proteins into milk
US4774085A (en) 1985-07-09 1988-09-27 501 Board of Regents, Univ. of Texas Pharmaceutical administration systems containing a mixture of immunomodulators
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
US4897355A (en) 1985-01-07 1990-01-30 Syntex (U.S.A.) Inc. N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4946787A (en) 1985-01-07 1990-08-07 Syntex (U.S.A.) Inc. N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US5049386A (en) 1985-01-07 1991-09-17 Syntex (U.S.A.) Inc. N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor
WO1991016024A1 (en) 1990-04-19 1991-10-31 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
WO1991017424A1 (en) 1990-05-03 1991-11-14 Vical, Inc. Intracellular delivery of biologically active substances by means of self-assembling lipid complexes
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US20030087817A1 (en) 1999-01-12 2003-05-08 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6603061B1 (en) 1999-07-29 2003-08-05 Monsanto Company Agrobacterium-mediated plant transformation method
US20090100536A1 (en) 2001-12-04 2009-04-16 Monsanto Company Transgenic plants with enhanced agronomic traits
US7868149B2 (en) 1999-07-20 2011-01-11 Monsanto Technology Llc Plant genome sequence and uses thereof
US20110059502A1 (en) 2009-09-07 2011-03-10 Chalasani Sreekanth H Multiple domain proteins
US9405700B2 (en) 2010-11-04 2016-08-02 Sonics, Inc. Methods and apparatus for virtualization in an integrated circuit

Family Cites Families (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US44790A (en) 1864-10-25 Improvement in force-pumps
US2011A (en) 1841-03-18 Appabatxts for piling saws
US2011008A (en) 1929-04-15 1935-08-13 Rca Corp Electric discharge tube
US7150982B2 (en) 1991-09-09 2006-12-19 Third Wave Technologies, Inc. RNA detection assays
AU2003224897A1 (en) 2002-04-09 2003-10-27 Kenneth L. Beattie Oligonucleotide probes for genosensor chips
WO2005070948A1 (en) 2004-01-23 2005-08-04 Intronn, Inc. Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated rna trans splicing
US20050220796A1 (en) 2004-03-31 2005-10-06 Dynan William S Compositions and methods for modulating DNA repair
CA2606002A1 (en) 2005-04-28 2006-11-02 Benitec Limited Multiple-rnai expression cassettes for simultaneous delivery of rnai agents related to heterozygotic expression patterns
US7892224B2 (en) 2005-06-01 2011-02-22 Brainlab Ag Inverse catheter planning
WO2007014275A2 (en) 2005-07-26 2007-02-01 Sangamo Biosciences, Inc. Targeted integration and expression of exogenous nucleic acid sequences
US9677123B2 (en) 2006-03-15 2017-06-13 Siemens Healthcare Diagnostics Inc. Degenerate nucleobase analogs
WO2008093152A1 (en) * 2007-02-01 2008-08-07 Cellectis Obligate heterodimer meganucleases and uses thereof
PT2126130E (en) 2007-03-02 2015-08-03 Dupont Nutrition Biosci Aps Cultures with improved phage resistance
WO2009041832A2 (en) * 2007-09-25 2009-04-02 Pastoral Greenhouse Gas Research Ltd Vaccines and vaccine components for inhibition of microbial cells
WO2010011961A2 (en) 2008-07-25 2010-01-28 University Of Georgia Research Foundation, Inc. Prokaryotic rnai-like system and methods of use
US20100076057A1 (en) * 2008-09-23 2010-03-25 Northwestern University TARGET DNA INTERFERENCE WITH crRNA
US9404098B2 (en) 2008-11-06 2016-08-02 University Of Georgia Research Foundation, Inc. Method for cleaving a target RNA using a Cas6 polypeptide
US20110016540A1 (en) 2008-12-04 2011-01-20 Sigma-Aldrich Co. Genome editing of genes associated with trinucleotide repeat expansion disorders in animals
AU2009322964B2 (en) 2008-12-04 2014-10-09 Sangamo Therapeutics, Inc. Genome editing in rats using zinc-finger nucleases
WO2010075424A2 (en) * 2008-12-22 2010-07-01 The Regents Of University Of California Compositions and methods for downregulating prokaryotic genes
US20110239315A1 (en) 2009-01-12 2011-09-29 Ulla Bonas Modular dna-binding domains and methods of use
DE112010004582T5 (en) 2009-11-27 2012-11-29 Basf Plant Science Company Gmbh Optimized endonucleases and applications thereof
US10087431B2 (en) 2010-03-10 2018-10-02 The Regents Of The University Of California Methods of generating nucleic acid fragments
EA024121B9 (en) 2010-05-10 2017-01-30 Дзе Реджентс Ов Дзе Юниверсити Ов Калифорния COMPOSITIONS OF ENDORIBONUCLEAS AND METHODS OF THEIR USE
EP3156062A1 (en) 2010-05-17 2017-04-19 Sangamo BioSciences, Inc. Novel dna-binding proteins and uses thereof
WO2012014988A1 (en) 2010-07-29 2012-02-02 タカラバイオ株式会社 Method for manufacturing a probe containing rna for detecting a target base
US9081737B2 (en) 2010-08-02 2015-07-14 Integrated Dna Technologies, Inc. Methods for predicting stability and melting temperatures of nucleic acid duplexes
WO2012149470A1 (en) * 2011-04-27 2012-11-01 Amyris, Inc. Methods for genomic modification
WO2012164565A1 (en) 2011-06-01 2012-12-06 Yeda Research And Development Co. Ltd. Compositions and methods for downregulating prokaryotic genes
US8555733B2 (en) 2011-09-23 2013-10-15 Airgas, Inc. System and method for analyzing a refrigerant sample
EP2591770B1 (en) 2011-11-14 2016-03-16 Silenseed Ltd Compositions for siRNA delivery and methods of manufacturing and using same
US8450107B1 (en) 2011-11-30 2013-05-28 The Broad Institute Inc. Nucleotide-specific recognition sequences for designer TAL effectors
GB201122458D0 (en) 2011-12-30 2012-02-08 Univ Wageningen Modified cascade ribonucleoproteins and uses thereof
NZ629427A (en) 2012-02-29 2016-04-29 Sangamo Biosciences Inc Methods and compositions for treating huntington’s disease
US9637739B2 (en) * 2012-03-20 2017-05-02 Vilnius University RNA-directed DNA cleavage by the Cas9-crRNA complex
WO2013141680A1 (en) * 2012-03-20 2013-09-26 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
LT3401400T (en) * 2012-05-25 2019-06-10 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
PL4397760T3 (en) 2012-10-23 2026-03-30 Toolgen Incorporated A COMPOSITION FOR CLEFULNING A TARGET DNA COMPRISING A GUIDE RNA SPECIFIC FOR A TARGET DNA AND A NUCLEIC ACID ENCODING A CAS PROTEIN OR A CAS PROTEIN, AND USE THEREOF
EP3135765A1 (en) 2012-12-06 2017-03-01 Sigma-Aldrich Co. LLC Crispr-based genome modification and regulation
WO2014093479A1 (en) 2012-12-11 2014-06-19 Montana State University Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation
CN114634950A (en) 2012-12-12 2022-06-17 布罗德研究所有限公司 CRISPR-CAS component systems, methods, and compositions for sequence manipulation
EP3434776A1 (en) 2012-12-12 2019-01-30 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
JP2016504026A (en) 2012-12-12 2016-02-12 ザ・ブロード・インスティテュート・インコーポレイテッド Engineering systems, methods and optimization guide compositions for sequence manipulation
WO2014093701A1 (en) 2012-12-12 2014-06-19 The Broad Institute, Inc. Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof
US20140310830A1 (en) 2012-12-12 2014-10-16 Feng Zhang CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
IL239317B (en) 2012-12-12 2022-07-01 Broad Inst Inc Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
ES2576126T3 (en) 2012-12-12 2016-07-05 The Broad Institute, Inc. Modification by genetic technology and optimization of improved enzyme systems, methods and compositions for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
EP2896697B1 (en) 2012-12-12 2015-09-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
SG10201912991WA (en) 2012-12-17 2020-03-30 Harvard College Rna-guided human genome engineering
US11135273B2 (en) * 2013-02-07 2021-10-05 The Rockefeller University Sequence specific antimicrobials
US10660943B2 (en) * 2013-02-07 2020-05-26 The Rockefeller University Sequence specific antimicrobials
JP2016522679A (en) * 2013-04-04 2016-08-04 プレジデント アンド フェローズ オブ ハーバード カレッジ Therapeutic use of genome editing with the CRISPR / Cas system
JP6665088B2 (en) 2013-06-17 2020-03-13 ザ・ブロード・インスティテュート・インコーポレイテッド Optimized CRISPR-Cas double nickase system, method and composition for sequence manipulation
WO2014204724A1 (en) 2013-06-17 2014-12-24 The Broad Institute Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
CN105793425B (en) 2013-06-17 2021-10-26 布罗德研究所有限公司 Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions for targeting disorders and diseases using viral components
BR112016013213A2 (en) 2013-12-12 2017-12-05 Massachusetts Inst Technology administration, use and therapeutic applications of crisper systems and compositions for targeting disorders and diseases using particle delivery components
EP3215623A4 (en) * 2014-11-06 2018-09-26 President and Fellows of Harvard College Cells lacking b2m surface expression and methods for allogeneic administration of such cells

Patent Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4186183A (en) 1978-03-29 1980-01-29 The United States Of America As Represented By The Secretary Of The Army Liposome carriers in chemotherapy of leishmaniasis
US4261975A (en) 1979-09-19 1981-04-14 Merck & Co., Inc. Viral liposome particle
US4485054A (en) 1982-10-04 1984-11-27 Lipoderm Pharmaceuticals Limited Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV)
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4897355A (en) 1985-01-07 1990-01-30 Syntex (U.S.A.) Inc. N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US5049386A (en) 1985-01-07 1991-09-17 Syntex (U.S.A.) Inc. N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4946787A (en) 1985-01-07 1990-08-07 Syntex (U.S.A.) Inc. N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4774085A (en) 1985-07-09 1988-09-27 501 Board of Regents, Univ. of Texas Pharmaceutical administration systems containing a mixture of immunomodulators
EP0264166A1 (en) 1986-04-09 1988-04-20 Genzyme Corporation Transgenic animals secreting desired proteins into milk
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
WO1991016024A1 (en) 1990-04-19 1991-10-31 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
WO1991017424A1 (en) 1990-05-03 1991-11-14 Vical, Inc. Intracellular delivery of biologically active substances by means of self-assembling lipid complexes
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US20030087817A1 (en) 1999-01-12 2003-05-08 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7868149B2 (en) 1999-07-20 2011-01-11 Monsanto Technology Llc Plant genome sequence and uses thereof
US6603061B1 (en) 1999-07-29 2003-08-05 Monsanto Company Agrobacterium-mediated plant transformation method
US20090100536A1 (en) 2001-12-04 2009-04-16 Monsanto Company Transgenic plants with enhanced agronomic traits
US20110059502A1 (en) 2009-09-07 2011-03-10 Chalasani Sreekanth H Multiple domain proteins
US9405700B2 (en) 2010-11-04 2016-08-02 Sonics, Inc. Methods and apparatus for virtualization in an integrated circuit

Non-Patent Citations (142)

* Cited by examiner, † Cited by third party
Title
"METHODS IN ENZYMOLOGY", ACADEMIC PRESS, INC.
A.R. GRUBER ET AL., CELL, vol. 106, no. 1, 2008, pages 23 - 24
ALMAD ET AL., CANCER RES, vol. 52, 1992, pages 4817 - 4820
AMRANN ET AL., GENE, vol. 69, 1988, pages 301 - 315
ANDERSON, SCIENCE, vol. 256, 1992, pages 808 - 813
BAE, T.; SCHNEEWIND, O.: "Allelic replacement in Staphylococcus aureus with inducible counter-selection", PLASMID, vol. 55, 2006, pages 58 - 63, XP024939950, DOI: doi:10.1016/j.plasmid.2005.05.005
BALDARI ET AL., EMBO J., vol. 6, 1987, pages 229 - 234
BANEIJI ET AL., CELL, vol. 33, 1981, pages 729 - 740
BARRANGOU, R.: "RNA-mediated programmable DNA cleavage", NAT. BIOTECHNOL., vol. 30, 2012, pages 836 - 838, XP055118675, DOI: doi:10.1038/nbt.2357
BEHR ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 382 - 389
BIKARD, D.; HATOUM-ASLAN, A.; MUCIDA, D; MARRAFFINI, LA: "CRISPR interference can prevent natural transformation and virulence acquisition during in vivo bacterial infection", CELL HOST MICROBE, vol. 12, 2012, pages 177 - 186, XP028934538, DOI: doi:10.1016/j.chom.2012.06.003
BLAESE ET AL., CANCER GENE THEI, vol. 2, 1995, pages 291 - 297
BLAKE WIEDENHEFT ET AL: "RNA-guided genetic silencing systems in bacteria and archaea", NATURE, vol. 482, no. 7385, 15 February 2012 (2012-02-15), pages 331 - 338, XP055116249, ISSN: 0028-0836, DOI: 10.1038/nature10886 *
BOGDANOVE, A.J.; VOYTAS, D.F.: "TAL effectors: customizable proteins for DNA targeting", SCIENCE, vol. 333, 2011, pages 1843 - 1846, XP055093385, DOI: doi:10.1126/science.1204094
BOSHART, CELL, vol. 41, 1985, pages 521 - 530
BROUNS, S.J. ET AL.: "Small CRISPR RNAs guide antiviral defense in prokaryotes", SCIENCE, vol. 321, 2008, pages 960 - 964, XP002559962, DOI: doi:10.1126/science.1159689
BROUNS. S: "A Swiss army knife of immunity Science", J MOLECULAR BIOLOGY, vol. 337, 2012, pages 808 - 809, XP055113718, DOI: doi:10.1126/science.1227253
BUCHSCHER ET AL., J VIROL, vol. 66, 1992, pages 2731 - 2739
BYRNE; RUDDLE, PROC NATL ACAD SCI. USA, vol. 86, 1989, pages 5473 - 5477
CALAME; FATON, ADV. IMMUNOL, vol. 43, 1988, pages 235 - 275
CAMPES; TILGHMAN, GENES DEV, vol. 3, 1989, pages 537 - 546
CARROLL. D.: "A CRISPR Approach to Gene Targeting", MOL. THER., vol. 20, 2012, pages 1658 - 1660, XP055106489, DOI: doi:10.1038/mt.2012.171
CARTE, J; WANG, R; LI, H.; TERNS, R.M; TERNS. M.P.: "Cas6 is an endoribonuclease that generates guide RNAs for invader defense in prokaryotes", GENES DEV, vol. 22, 2008, pages 3489 - 3496, XP055054069, DOI: doi:10.1101/gad.1742908
CONG, L. ET AL.: "Multiplex Genome Engineering Using CRISPR/Cas Systems", SCIENCE, 2013
COSTANTINO, N; COURT, D.L.: "Enhanced levels of lambda Red-mediated recombinants in mismatch repan mutants", PROC NATL. ACAD. SCI U.S.A., vol. 100, 2003, pages 15748 - 15753
CRYSTAL, SCIENCE, vol. 270, 1995, pages 404 - 410
DELTCHEVA, E. ET AL.: "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III", MATURE, vol. 471, 2011, pages 602 - 607, XP055308803, DOI: doi:10.1038/nature09886
DEVEAU, H ET AL.: "Phage response to CRISPR-encoded resistance in Streptococcus thermophilus", J BACTERIOL., vol. 190, 2008, pages 1390 - 1400, XP002679468, DOI: doi:10.1128/JB.01412-07
DEVEAU, H.; GARNEAU, J.E.; MOINEAU, S.: "CRISPR/Cas system and its role in phage- bacteria interactions", ANNU. REV. MICROBIOL., vol. 64, 2010, pages 475 - 493, XP055067789, DOI: doi:10.1146/annurev.micro.112408.134123
DILLON, TIBTECH, vol. 11, 1993, pages 167 - 175
EDGAR, R.; QIMRON, U.: "The Escherichia coli CRISPR system protects from lambda lysogenization. lysogens, and prophage induction", J BACTERIOL, vol. 192, 2010, pages 6291 - 6294
EDLUND, SCIENCE, vol. 230, 1985, pages 912 - 916
ELIAS I TRABOULSI,: "Genetic Diseases of the Fye, Second Edition,", 2012, OXFORD UNIVERSITY PRESS
ELITZA DELTCHEVA ET AL: "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III", NATURE, vol. 471, no. 7340, 31 March 2011 (2011-03-31), pages 602 - 607, XP055068535, ISSN: 0028-0836, DOI: 10.1038/nature09886 *
F. M. AUSUBEL, ET AL: "CURRENT PROTOCOLS IN MOLECULAR BIOI OGY", 1987
FISCHER, S ET AL.: "An archaeal immune system can detect multiple Protospacer Adjacent Motifs (PAMs) to target invader DNA", J. BIOL. CHEM., vol. 287, 2012, pages 33351 - 33363
G. GASIUNAS ET AL: "PNAS Plus: Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 39, 25 September 2012 (2012-09-25), pages E2579 - E2586, XP055068588, ISSN: 0027-8424, DOI: 10.1073/pnas.1208507109 *
GAJ THOMAS ET AL: "ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering", TRENDS IN BIOTECHNOLOGY, vol. 31, no. 7, 1 July 2013 (2013-07-01), pages 397 - 405, XP028571313, ISSN: 0167-7799, DOI: 10.1016/J.TIBTECH.2013.04.004 *
GAO ET AL., GENE THERAPY, vol. 2, 1995, pages 710 - 722
GASIUNAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 109, 2012, pages E2579
GASIUNAS, G.; BARRANGOU, R; HORVATH, P.; SIKSNYS, V: "Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bactena", PROC NATL. ACAD. SCI U.S.A., 2012
GIBSON, D.G.: "Enzymatic assembly of DNA molecules up to several hundred kilobases", NAT METHODS, vol. 6, 2009, pages 343 - 345, XP055224105, DOI: doi:10.1038/nmeth.1318
GIULIANO AVANZINI, JEFFREY L. NOEBELS,: "Genetics of Epilepsy and Genetic Epilepsies", vol. 20, 2009, MARIANI FOUNDATION PAEDIATRIC NEUROLOGY
GOEDDEL: "GENE EXPRESSION TECHNOLOGY METHODS IN ENZYMOLOGY", vol. 185, 1990, ACADEMIC PRESS
GROENEN, MOL MICROBIOL., vol. 10, 1993, pages 1057 - 1065
GRUBER ET AL., NUCLEIC ACIDS RESEARCH, vol. 36, 2008, pages W70
GUDBERGSDOTTIR, S ET AL.: "Dynamic properties of the Sulfolobus CRISPR/Cas and CRISPR/Cmr systems when challenged with vector-borne viral and plasmid genes and protospacers", MOL. MICROBIOL., vol. 79, 2011, pages 35 - 49
GUSCHIN ET AL., METHODS MOL BIOL, vol. 649, 2010, pages 247
HADDADA ET AL.: "m Current Topics in Microbiology and Immunology", 1995
HARLOW AND LANE EDS: "ANTIBODIES, A LABORATORY MANUAL,", 1988
HATOUM-ASLAN, A; MANIV, I.; MARRAFTIM, L A: "Mature clustered, regularly interspaced, short palindromic repeats RNA (crRNA) length is measured by a ruler mechanism anchored at the precursor processing site", PROC NATL. ACAD SCI U.S.A., vol. 108, 2011, pages 21218 - 21222, XP055250498, DOI: doi:10.1073/pnas.1112832108
HAURWITZ, R E.; JINEK, M.; WIEDENHEFT, B.; ZHOU, K.; DOUDNA, J A: "Sequence- and structure-specific RNA processing by a CRISPR endonuclease", SCIENCE, vol. 329, 2010, pages 1355 - 1358, XP055244668, DOI: doi:10.1126/science.1192272
HAVARSTEIN, L.S.: "Coomaraswamy, G. & Morrison, D.A. An unmodified heptadecapeptide pheromone induces competence for genetic transformation in Streptococcus pneumoniae", PROC. NATL. ACAD. SCI. U.S.A., vol. 92, 1995, pages 11140 - 11144
HERMONAT; MUZYCZKA, PNAS, vol. 81, 1984, pages 6466 - 6470
HOE ET AL., EMEIG INFECT DIS., vol. 5, 1999, pages 254 - 263
HORINOUCHI, S.; WEISBLUM, B.: "Nucleotide sequence and functional map ofpC194, a plasmid that specifies inducible chloramphenicol resistance", J. BACTERIOL., vol. 150, 1982, pages 815 - 825
HORTON, R.M.: "Vitro Recombination and Mutagenesis of DNA : SOEing Together Tailor-Made Genes", METHODS MOL. BIOL., vol. 15, 1993, pages 251 - 261
HORVATH, P.; BARRANGOU, R.: "CRISPR/Cas, the immune system of bacteria and archaea", SCIENCE, vol. 327, 2010, pages 167 - 170, XP055016971, DOI: doi:10.1126/science.1179555
HOSAKA, T ET AL.: "The novel mutation K87E m nbosomal protein S12 enhances protein synthesis activity during the late growth phase in Escherichia coli", MOL GENET. GENOMICS, vol. 271, 2004, pages 317 - 324
HOSKINS, J. ET AL.: "Genome of the bacterium Streptococcus pneumoniae strain R6", J. BACTERIOL., vol. 183, 2001, pages 5709 - 5717, XP002231307, DOI: doi:10.1128/JB.183.19.5709-5717.2001
HUSMANN, L.K.; SCOTT, J.R.; LINDAHL, G.; STENBERG. L.: "Expression of the Arp protein, a member of the M protein family, is not sufficient to inhibit phagocytosis of Streptococcus pyogenes", INFECTION AND IMMUNITY, vol. 63, 1995, pages 345 - 348
ISHINO ET AL., J BACTENOL., vol. 169, 1987, pages 5429 - 5433
JANSEN ET AL., MOL. MICROBIOL., vol. 43, 2002, pages 1565 - 1575
JANSSEN ET AL., OMICS J INTEG. BIOL, vol. 6, 2002, pages 23 - 33
JIANG WENYAN ET AL: "RNA-guided editing of bacterial genomes using CRISPR-Cas systems", NATURE BIOTECHNOLOGY,, vol. 31, no. 3, 29 January 2013 (2013-01-29), pages 233 - 239, XP002699849 *
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816
JINEK, M. ET AL.: "A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity", SCIENCE, vol. 337, 2012, pages 816 - 821, XP055299674, DOI: doi:10.1126/science.1225829
JOHANN ET AL., J. VIROL, vol. 66, 1992, pages 1635 - 1640
KAUFMAN ET AL., EMBO, vol. 1 6, 1987, pages 187 - 195
KESSEL; GRUSS, SCIENCE, vol. 249, 1990, pages 374 - 379
KOTM, HUMAN GENE THERAPY, vol. 5, 1994, pages 793 - 801
KREMER; PERRICAUDET, BRITISH MEDICAL BULLETIN, vol. 51, no. 1, 1995, pages 31 - 44
KRZYSZTOF CHYLINSKI ET AL: "The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems", RNA BIOLOGY, vol. 10, no. 5, 1 May 2013 (2013-05-01), pages 726 - 737, XP055116068, ISSN: 1547-6286, DOI: 10.4161/rna.24321 *
KUIJAN; HERSKOWITZ, CELL, vol. 30, 1982, pages 933 - 943
L. CONG ET AL: "Multiplex Genome Engineering Using CRISPR/Cas Systems", SCIENCE, vol. 339, no. 6121, 15 February 2013 (2013-02-15), pages 819 - 823, XP055102030, ISSN: 0036-8075, DOI: 10.1126/science.1231143 *
L. CONG ET AL: "Supplementary Material to : Multiplex Genome Engineering Using CRISPR/Cas Systems", SCIENCE, vol. 339, no. 6121, 3 January 2013 (2013-01-03), pages 819 - 823, XP055067744, ISSN: 0036-8075, DOI: 10.1126/science.1231143 *
LUCKLOW; SUMMERS, VIROLOGY, vol. 170, 1989, pages 31 - 39
LUKE A. GILBERT ET AL: "CRISPR-Mediated Modular RNA-Guided Regulation of Transcription in Eukaryotes", CELL, vol. 154, no. 2, 1 July 2013 (2013-07-01), pages 442 - 451, XP055115843, ISSN: 0092-8674, DOI: 10.1016/j.cell.2013.06.044 *
M. JINEK ET AL: "A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity (Supplementary Material)", SCIENCE, vol. 337, no. 6096, 28 June 2012 (2012-06-28), pages 816 - 821, XP055067747, ISSN: 0036-8075, DOI: 10.1126/science.1225829 *
M. JINEK ET AL: "A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity", SCIENCE, vol. 337, no. 6096, 17 August 2012 (2012-08-17), pages 816 - 821, XP055067740, ISSN: 0036-8075, DOI: 10.1126/science.1225829 *
M.J MACPHERSON, B D. HAMES AND G.R TAYLOR: "PCR 2. A PRACTICAL APPROACH", 1995
MAKAROVA ET AL., NAT REV MICROBIOL, vol. 9, 2011, pages 467
MAKAZOVA, K.S; ARAVIND, L.; WOLF, Y 1.; KOONIN, E.V.: "Unification of Cas protein families and a simple scenario for the origin and evolution of CRISPR-Cas systems", BIOL. DIRECT, vol. 6, 2011, pages 38
MALI, P. ET AL.: "RNA-Guided Human Genome Engineering via Cas9", SCIENCE, 2013
MARRAFFINI, L.A.; SONTHEIMER, E.J: "Self versus non-self discrimination dunng CRISPR RNA-directed immunity", NATURE, vol. 463, 2010, pages 568 - 571, XP055118462, DOI: doi:10.1038/nature08703
MARRAFFINI, LA.; DEDENT, A C; SCHNEEWMD, O.: "Sortases and the art of anchoring proteins to the envelopes of gram-positive bactena", MICROBIOL. MOL. BIOL. REV., vol. 70, 2006, pages 192 - 221, XP002459580, DOI: doi:10.1128/MMBR.70.1.192-221.2006
MASEPOHL ET AL., BIOCHIM BIOPHYS ACTA, vol. 1307, 1996, pages 26 - 30
MCLVOR EI; POLAK U; NAPIERALA M: "New insights into repeat instability: role of RNA-DNA hybrids", RNA BIOL., vol. 7, no. 5, September 2010 (2010-09-01), pages 551 - 8
MICHAEL P TERNS ET AL: "CRISPR-based adaptive immune systems", CURRENT OPINION IN MICROBIOLOGY, vol. 14, no. 3, 1 June 2011 (2011-06-01), pages 321 - 327, XP055097823, ISSN: 1369-5274, DOI: 10.1016/j.mib.2011.03.005 *
MILLER ET AL., J VIROL., vol. 65, 1991, pages 2220 - 2224
MILLER, NATURE, vol. 357, 1992, pages 455 - 460
MITANI; CASKEY, IIB'IECH, vol. 11, 1993, pages 162 - 166
MOJICA ET AL., MOL MICROBIOL, vol. 17, 1995, pages 85 - 9
MOJICA ET AL., MOL. MICROBIOL., vol. 36, 2000, pages 244 - 246
MOL, CELL BIOL., vol. 8, no. 1, 1988, pages 466 - 472
MORRELL ET AL.: "Crop genomics:advances and applications", NAT REV GENET., vol. 13, no. 2, 29 December 2011 (2011-12-29), pages 85 - 96
MOTAMEDI, M R; SZIGETY, S K; ROSENBERG, S M: "Double-stiand-break repair recombination in Eschcr?chia coli. physical evidence for a DNA replication mechanism in vivo", GENES DEV., vol. 13, 1999, pages 2889 - 2903
MUZYCZKA, J CLIN. INVEST., vol. 94, 1994, pages 1351
NABEL; FELGNER, TIBTECH, vol. 12, 1993, pages 211 - 217
NAKAMURA Y ET AL.: "Codon usage tabulated fiom the international DNA sequence databases status for the year 2000", NUCL. ACIDS RES, vol. 28, 2000, pages 292, XP002941557, DOI: doi:10.1093/nar/28.1.292
NAKATA ET AL., T. BACTERIOL, vol. 171, 1989, pages 3553 - 3556
PA CARR; GM CHURCH, NATURE BIOTECHNOLOGY, vol. 27, no. 12, 2009, pages 1151 - 62
PINKERT, GENES DEV, vol. 1, 1987, pages 268 - 277
PODBIELSKI, A.; SPELLERBERG, B.; WOISCHNIK, M.; POHL, B.; LUTTICKEN, R.: "Novel series of plasmid vectors for gene inactivation and expression analysis in group A streptococci (GAS", GENE, vol. 177, 1996, pages 137 - 147, XP004043388, DOI: doi:10.1016/0378-1119(96)84178-3
PROC NATL ACAD SCI USA, vol. 78, no. 3, 1981, pages 1527 - 31
QUEEN; BALTIMORE, CELL, vol. 33, 1983, pages 741 - 748
R.I FRESHNEY: "ANIMAL CELL CULTURE", 1987
REMY ET AL., BIOCONJUGATE CHEM, vol. 5, 1994, pages 647 - 654
ROBERT D. WELLS; TETSUO ASHIZAWA: "Genetic Instabilities and Neurological Diseases, Second Edition,", 13 October 2011, ACADEMIC PRESS
SAMBROOK ET AL.: "MOLECULAR CLONING A LABORATORY MANUAL 2nd ed.,", 1989, COLD SPRING HARBOR LABORATORY PI ESS
SAMBROOK; FRITSCH; MAMATIS: "MOLECULAR CLONING A LABORATORY MANUAL, 2nd edition", 1989
SAMULSKI ET AL., J. VIROL., vol. 63, 1989, pages 03822 - 3828
SAPRANAUSKAS ET AL., NUCLEIC ACIDS RESEARCH, vol. 39, 2011, pages 9275
SAPRANAUSKAS, R ET AL.: "The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coil", NUCLEIC ACIDS RES., 2011
SCHULTZ ET AL., GENE, vol. 54, 1987, pages 113 - 121
SEED, NATURE, vol. 329, 1987, pages 840
SEMENOVA, E. ET AL.: "Interference by clustered iegularly mteispaced short palindromic repeat (CRISPR) RNA is governed by a seed sequence", PROC. NATL ACAD. SCI. U.S.A., 2011
SHARAN, S.K.; THOMASON, L.C.; KUZNETSOV, S.G.; COURT, D.L.: "Recombineering: a homologous recombination-based method of genetic engineering", NAT. PROTOC., vol. 4, 2009, pages 206 - 223, XP001525689, DOI: doi:10.1038/nprot.2008.227
SMITH ET AL., MOL. CELL. BIOL., vol. 3, 1983, pages 2156 - 2165
SMITH; JOHNSON: "Gene", vol. 67, 1988, PHARMACIA BIOTECH INC, pages: 31 - 40
SOMMNERFELT ET AL., VIROL., vol. 176, 1990, pages 58 - 59
STODDARD, B.L.: "Homing endonuclease structure and function", Q. REV. BIOPHYS, vol. 38, 2005, pages 49 - 95, XP008065807, DOI: doi:10.1017/S0033583505004063
STUDIER ET AL.: "GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY", vol. 185, 1990, ACADEMIC PRESS, pages: 60 - 89
SUNG, C.K.; LI, H.; CLAVERYS, J.P.; MORRISON, D.A.: "An rpsL cassette, janus, for gene replacement through negative selection in Streptococcus pneumoniae", APPL. ENVIRON. MICROBIOL., vol. 67, 2001, pages 5190 - 5196
TERNS, M.P.; TERNS, R.M.: "CRISPR-based adaptive immune systems", CURR. OPIN. MICROBIOL, vol. 14, 2011, pages 321 - 327, XP055097823, DOI: doi:10.1016/j.mib.2011.03.005
TIJSSEN: "Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes", 1993, ELSEVIER, article "Overview of principles of hybridization and the strategy of nucleic acid probe assay"
TRATSCHIN ET AL., MOL. CELL BIOL., vol. 5, 1985, pages 3251 - 3260
TRATSCHM ET AL., MOL. CELL. BIOL, vol. 4, 1984, pages 2072 - 2081
URNOV, F.D.; REBAR, E.J.; HOLMES. M.C.; ZHANG, H.S.; GREGORY, P.D.: "Genome editing with engineered zinc finger nucleases", NAT. REV. GENET., vol. 11, 2010, pages 636 - 646, XP008150557, DOI: doi:10.1038/nrg2842
VAN BRUNT, BIOTECHNOLOGY, vol. 6, no. 10, 1988, pages 1149 - 1154
VAN DER OOST, J.; JORE, M.M.; WESTRA, E.R.; LUNDGREN, M.; BROUNS, S.J.: "CRISPR-based adaptive and heritable immunity in prokaiyotes", TRENDS. BIOCHEM. SCI., vol. 34, 2009, pages 401 - 407, XP002559963, DOI: doi:10.1016/j.tibs.2009.05.002
VAN EMBDEN ET AL., J BACTERIOL., vol. 182, 2000, pages 2393 - 2401
VIGNE, RESTORATIVE NEUROLOGY AND NEUROSCIENCE, vol. 8, 1995, pages 35 - 36
WANG HAOYI ET AL: "One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated Genome Engineering", CELL, vol. 153, no. 4, 9 May 2013 (2013-05-09), pages 910 - 918, XP028538358, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2013.04.025 *
WANG, H.H. ET AL.: "Genome-scale promoter engineering by coselection MAGE", NAT METHODS, vol. 9, 2012, pages 591 - 593
WEST ET AL., VIROLOGY, vol. 160, 1987, pages 38 - 47
WIEDENLIEFT, B ET AL.: "RNA-guided complex from a bactenal immune system enhances target recognition through seed sequence interactions", PROC NATL. ACAD SCI U.S.A., 2011
WILSON ET AL., J. VIROL, vol. 63, 1989, pages 2374 - 2378
WINOTO; BALTIMORE, EMBO J., vol. 8, 1989, pages 729 - 733
YU ET AL., GENE THERAPY, vol. 1, 1994, pages 13 - 26
ZAHNER, D; HAKENBECK, R: "The Streptococcus pneunioniae beta-galactosidase is a surface protein", J. BACTERIOL., vol. 182, 2000, pages 5919 - 5921, XP002529681, DOI: doi:10.1128/JB.182.20.5919-5921.2000
ZUKER; STIEGLER, NUCLEIC ACIDS RES., vol. 9, 1981, pages 133 - 148

Cited By (765)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12258584B2 (en) 2010-05-06 2025-03-25 Children's Hospital Medical Center Methods and systems for converting precursor cells into intestinal tissues through directed differentiation
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10323236B2 (en) 2011-07-22 2019-06-18 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US12467086B2 (en) 2011-10-14 2025-11-11 President And Fellows Of Harvard College Sequencing by structure assembly
US12618099B2 (en) 2011-12-22 2026-05-05 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11566277B2 (en) 2011-12-22 2023-01-31 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11111521B2 (en) 2011-12-22 2021-09-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11976318B2 (en) 2011-12-22 2024-05-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11293051B2 (en) 2011-12-22 2022-04-05 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11639518B2 (en) 2011-12-22 2023-05-02 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11566276B2 (en) 2011-12-22 2023-01-31 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11549136B2 (en) 2011-12-22 2023-01-10 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11293052B2 (en) 2011-12-22 2022-04-05 President And Fellows Of Harvard College Compositions and methods for analyte detection
US9885026B2 (en) 2011-12-30 2018-02-06 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10435678B2 (en) 2011-12-30 2019-10-08 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10954498B2 (en) 2011-12-30 2021-03-23 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10711257B2 (en) 2011-12-30 2020-07-14 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US11939604B2 (en) 2011-12-30 2024-03-26 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
EP2828386B1 (en) 2012-03-20 2019-07-10 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
US9834786B2 (en) 2012-04-25 2017-12-05 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
US10301646B2 (en) 2012-04-25 2019-05-28 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
US11976307B2 (en) 2012-04-27 2024-05-07 Duke University Genetic correction of mutated genes
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US10711256B2 (en) 2012-04-27 2020-07-14 Duke University Genetic correction of mutated genes
US11473108B2 (en) 2012-05-25 2022-10-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12180504B2 (en) 2012-05-25 2024-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10227611B2 (en) 2012-05-25 2019-03-12 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11186849B2 (en) 2012-05-25 2021-11-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11814645B2 (en) 2012-05-25 2023-11-14 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP3401400B1 (en) 2012-05-25 2019-04-03 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US10113167B2 (en) 2012-05-25 2018-10-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10774344B1 (en) 2012-05-25 2020-09-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10793878B1 (en) 2012-05-25 2020-10-06 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10676759B2 (en) 2012-05-25 2020-06-09 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10266850B2 (en) 2012-05-25 2019-04-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10669560B2 (en) 2012-05-25 2020-06-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10640791B2 (en) 2012-05-25 2020-05-05 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11242543B2 (en) 2012-05-25 2022-02-08 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10626419B2 (en) 2012-05-25 2020-04-21 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11274318B2 (en) 2012-05-25 2022-03-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10982231B2 (en) 2012-05-25 2021-04-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10612045B2 (en) 2012-05-25 2020-04-07 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11970711B2 (en) 2012-05-25 2024-04-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11293034B2 (en) 2012-05-25 2022-04-05 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10597680B2 (en) 2012-05-25 2020-03-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10982230B2 (en) 2012-05-25 2021-04-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10577631B2 (en) 2012-05-25 2020-03-03 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10988780B2 (en) 2012-05-25 2021-04-27 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11674159B2 (en) 2012-05-25 2023-06-13 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10988782B2 (en) 2012-05-25 2021-04-27 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11001863B2 (en) 2012-05-25 2021-05-11 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10301651B2 (en) 2012-05-25 2019-05-28 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11634730B2 (en) 2012-05-25 2023-04-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10000772B2 (en) 2012-05-25 2018-06-19 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10570419B2 (en) 2012-05-25 2020-02-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10563227B2 (en) 2012-05-25 2020-02-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11332761B2 (en) 2012-05-25 2022-05-17 The Regenis of Wie University of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10550407B2 (en) 2012-05-25 2020-02-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10308961B2 (en) 2012-05-25 2019-06-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11008590B2 (en) 2012-05-25 2021-05-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10337029B2 (en) 2012-05-25 2019-07-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10533190B2 (en) 2012-05-25 2020-01-14 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10526619B2 (en) 2012-05-25 2020-01-07 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12123015B2 (en) 2012-05-25 2024-10-22 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10752920B2 (en) 2012-05-25 2020-08-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10519467B2 (en) 2012-05-25 2019-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12180503B2 (en) 2012-05-25 2024-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10513712B2 (en) 2012-05-25 2019-12-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10351878B2 (en) 2012-05-25 2019-07-16 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11401532B2 (en) 2012-05-25 2022-08-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10358659B2 (en) 2012-05-25 2019-07-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10487341B2 (en) 2012-05-25 2019-11-26 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP3597749B1 (en) 2012-05-25 2023-07-26 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US11479794B2 (en) 2012-05-25 2022-10-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10358658B2 (en) 2012-05-25 2019-07-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10385360B2 (en) 2012-05-25 2019-08-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP2800811B1 (en) 2012-05-25 2017-05-10 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US12215343B2 (en) 2012-05-25 2025-02-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10400253B2 (en) 2012-05-25 2019-09-03 The Regents Of The University Of California Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10443076B2 (en) 2012-05-25 2019-10-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP3241902B1 (en) 2012-05-25 2018-02-28 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US10407697B2 (en) 2012-05-25 2019-09-10 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10415061B2 (en) 2012-05-25 2019-09-17 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11008589B2 (en) 2012-05-25 2021-05-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11549127B2 (en) 2012-05-25 2023-01-10 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP4289948B1 (en) 2012-05-25 2025-02-26 The Regents of the University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US10421980B2 (en) 2012-05-25 2019-09-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10900054B2 (en) 2012-05-25 2021-01-26 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10428352B2 (en) 2012-05-25 2019-10-01 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11028412B2 (en) 2012-05-25 2021-06-08 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP4357457B1 (en) 2012-10-23 2024-10-16 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US12473559B2 (en) 2012-10-23 2025-11-18 Toolgen Incorporated Cas9/RNA complexes for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells
US10851380B2 (en) 2012-10-23 2020-12-01 Toolgen Incorporated Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein
US10731181B2 (en) 2012-12-06 2020-08-04 Sigma, Aldrich Co. LLC CRISPR-based genome modification and regulation
US10745716B2 (en) 2012-12-06 2020-08-18 Sigma-Aldrich Co. Llc CRISPR-based genome modification and regulation
EP3360964B1 (en) 2012-12-06 2019-10-02 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
EP3363902B1 (en) 2012-12-06 2019-11-27 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
EP2928496B1 (en) 2012-12-06 2019-10-09 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
EP3138911B1 (en) 2012-12-06 2018-12-05 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
US11041173B2 (en) 2012-12-12 2021-06-22 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP2840140B1 (en) 2012-12-12 2016-11-16 The Broad Institute, Inc. Crispr-Cas component systems, methods and compositions for sequence manipulation
EP2896697B1 (en) 2012-12-12 2015-09-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US9840713B2 (en) 2012-12-12 2017-12-12 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
EP2898075B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
EP2921557B1 (en) 2012-12-12 2016-07-13 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
EP2784162B1 (en) 2012-12-12 2015-04-08 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
EP2764103B1 (en) 2012-12-12 2015-08-19 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products
US12252707B2 (en) 2012-12-12 2025-03-18 The Broad Institute, Inc. Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
EP2825654B1 (en) 2012-12-12 2017-04-26 The Broad Institute, Inc. Crispr-cas component systems, methods and compositions for sequence manipulation
US9822372B2 (en) 2012-12-12 2017-11-21 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
EP2931891A4 (en) * 2012-12-17 2016-07-13 Harvard College MANIPULATION OF THE HUMAN GENOME GUIDED BY RNA
EP4282970A3 (en) * 2012-12-17 2024-01-17 President and Fellows of Harvard College Rna-guided human genome engineering
US11359211B2 (en) 2012-12-17 2022-06-14 President And Fellows Of Harvard College RNA-guided human genome engineering
EP4481048A3 (en) * 2012-12-17 2025-02-26 President and Fellows of Harvard College Rna-guided human genome engineering
US11365429B2 (en) 2012-12-17 2022-06-21 President And Fellows Of Harvard College RNA-guided human genome engineering
US11512325B2 (en) 2012-12-17 2022-11-29 President And Fellows Of Harvard College RNA-guided human genome engineering
US10435708B2 (en) 2012-12-17 2019-10-08 President And Fellows Of Harvard College RNA-guided human genome engineering
US11535863B2 (en) 2012-12-17 2022-12-27 President And Fellows Of Harvard College RNA-guided human genome engineering
US9260723B2 (en) 2012-12-17 2016-02-16 President And Fellows Of Harvard College RNA-guided human genome engineering
US10717990B2 (en) 2012-12-17 2020-07-21 President And Fellows Of Harvard College RNA-guided human genome engineering
US12612643B2 (en) 2012-12-17 2026-04-28 President And Fellows Of Harvard College RNA-guided human genome engineering
AU2021204024B2 (en) * 2012-12-17 2023-12-14 President And Fellows Of Harvard College RNA-guided human genome engineering
US12018272B2 (en) 2012-12-17 2024-06-25 President And Fellows Of Harvard College RNA-guided human genome engineering
AU2013363194B2 (en) * 2012-12-17 2019-05-16 President And Fellows Of Harvard College RNA-guided human genome engineering
US9970024B2 (en) 2012-12-17 2018-05-15 President And Fellows Of Harvard College RNA-guided human genome engineering
US11236359B2 (en) 2012-12-17 2022-02-01 President And Fellows Of Harvard College RNA-guided human genome engineering
EP3553174A1 (en) * 2012-12-17 2019-10-16 President and Fellows of Harvard College Rna-guided human genome engineering
US10273501B2 (en) 2012-12-17 2019-04-30 President And Fellows Of Harvard College RNA-guided human genome engineering
US11312945B2 (en) 2013-01-16 2022-04-26 Emory University CAS9-nucleic acid complexes and uses related thereto
US10544405B2 (en) 2013-01-16 2020-01-28 Emory University Cas9-nucleic acid complexes and uses related thereto
US12264358B2 (en) 2013-03-12 2025-04-01 President And Fellows Of Harvard College Method of selectively sequencing amplicons in a biological sample
US11299767B2 (en) 2013-03-12 2022-04-12 President And Fellows Of Harvard College Method for generating a three-dimensional nucleic acid containing matrix
US9909122B2 (en) 2013-03-14 2018-03-06 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9803194B2 (en) 2013-03-14 2017-10-31 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9410198B2 (en) 2013-03-14 2016-08-09 Caribou Biosciences, Inc. Compostions and methods of nucleic acid-targeting nucleic acids
US11312953B2 (en) 2013-03-14 2022-04-26 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US10125361B2 (en) 2013-03-14 2018-11-13 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9725714B2 (en) 2013-03-14 2017-08-08 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9260752B1 (en) 2013-03-14 2016-02-16 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9809814B1 (en) 2013-03-14 2017-11-07 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9738908B2 (en) 2013-03-15 2017-08-22 System Biosciences, Llc CRISPR/Cas systems for genomic modification and gene modulation
US10202619B2 (en) 2013-03-15 2019-02-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US10975390B2 (en) 2013-04-16 2021-04-13 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US10385359B2 (en) 2013-04-16 2019-08-20 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US12037596B2 (en) 2013-04-16 2024-07-16 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
JP2016520317A (en) * 2013-05-29 2016-07-14 セレクティスCellectis Method for producing precise DNA cleavage using CAS9 nickase activity
JP7065564B2 (en) 2013-05-29 2022-05-12 セレクティス Methods for Providing Accurate DNA Cleavage Using CAS9 Nickase Activity
EP3603679A1 (en) * 2013-06-04 2020-02-05 President and Fellows of Harvard College Rna-guideded transcriptional regulation
US10767194B2 (en) 2013-06-04 2020-09-08 President And Fellows Of Harvard College RNA-guided transcriptional regulation
US10640789B2 (en) 2013-06-04 2020-05-05 President And Fellows Of Harvard College RNA-guided transcriptional regulation
US11981917B2 (en) 2013-06-04 2024-05-14 President And Fellows Of Harvard College RNA-guided transcriptional regulation
EP3003392A4 (en) * 2013-06-04 2017-05-03 President and Fellows of Harvard College Rna-guideded transcriptional regulation
EP4596565A3 (en) * 2013-06-04 2025-11-05 President And Fellows Of Harvard College Rna-guided transcriptional regulation
AU2014274840B2 (en) * 2013-06-05 2020-03-12 Duke University RNA-guided gene editing and gene regulation
US10704060B2 (en) 2013-06-05 2020-07-07 Duke University RNA-guided gene editing and gene regulation
US10745714B2 (en) 2013-06-05 2020-08-18 Duke University RNA-guided gene editing and gene regulation
US9982277B2 (en) 2013-06-11 2018-05-29 The Regents Of The University Of California Methods and compositions for target DNA modification
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
US10577630B2 (en) 2013-06-17 2020-03-03 The Broad Institute, Inc. Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
US11597949B2 (en) 2013-06-17 2023-03-07 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US12553065B2 (en) 2013-06-17 2026-02-17 The Broad Institute, Inc. Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation
US12018275B2 (en) 2013-06-17 2024-06-25 The Broad Institute, Inc. Delivery and use of the CRISPR-CAS systems, vectors and compositions for hepatic targeting and therapy
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US10946108B2 (en) 2013-06-17 2021-03-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
US12441995B2 (en) 2013-06-17 2025-10-14 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
EP3036333B1 (en) 2013-08-22 2022-01-19 E. I. du Pont de Nemours and Company Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US12378566B2 (en) 2013-08-22 2025-08-05 Pioneer Hi-Bred International, Inc. Plant genome modification using guide RNA/Cas endonuclease systems and methods of use
US12428645B2 (en) 2013-08-22 2025-09-30 Pioneer Hi-Bred International, Inc. Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof
EP3036333B2 (en) † 2013-08-22 2025-03-12 E. I. du Pont de Nemours and Company Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof
US10227581B2 (en) 2013-08-22 2019-03-12 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
EP4074330A1 (en) * 2013-09-05 2022-10-19 Massachusetts Institute of Technology Tuning microbial populations with programmable nucleases
EP3041498A4 (en) * 2013-09-05 2017-04-12 Massachusetts Institute of Technology Tuning microbial populations with programmable nucleases
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9340800B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College Extended DNA-sensing GRNAS
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US9340799B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College MRNA-sensing switchable gRNAs
US12559737B2 (en) 2013-09-06 2026-02-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US9999671B2 (en) 2013-09-06 2018-06-19 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US12584118B2 (en) 2013-09-06 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9737604B2 (en) 2013-09-06 2017-08-22 President And Fellows Of Harvard College Use of cationic lipids to deliver CAS9
US11920128B2 (en) 2013-09-18 2024-03-05 Kymab Limited Methods, cells and organisms
WO2015065964A1 (en) 2013-10-28 2015-05-07 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof
US11149267B2 (en) 2013-10-28 2021-10-19 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US11390887B2 (en) 2013-11-07 2022-07-19 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10640788B2 (en) 2013-11-07 2020-05-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAs
US10190137B2 (en) 2013-11-07 2019-01-29 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9228208B2 (en) 2013-12-11 2016-01-05 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US10711280B2 (en) 2013-12-11 2020-07-14 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a mouse ES cell genome
US10208317B2 (en) 2013-12-11 2019-02-19 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a mouse embryonic stem cell genome
US9546384B2 (en) 2013-12-11 2017-01-17 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a mouse genome
US11820997B2 (en) 2013-12-11 2023-11-21 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US12410435B2 (en) 2013-12-12 2025-09-09 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
WO2015089354A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
US12421506B2 (en) 2013-12-12 2025-09-23 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
EP3653704A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
EP3653229A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
US10494620B2 (en) 2013-12-12 2019-12-03 The Regents Of The University Of California Methods and compositions for modifying a single stranded target nucleic acid
US11407985B2 (en) 2013-12-12 2022-08-09 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing
EP3653703A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
WO2015089419A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
US12258595B2 (en) 2013-12-12 2025-03-25 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US10851357B2 (en) 2013-12-12 2020-12-01 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
EP3470089A1 (en) 2013-12-12 2019-04-17 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US12251450B2 (en) 2013-12-12 2025-03-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders
US9840699B2 (en) 2013-12-12 2017-12-12 President And Fellows Of Harvard College Methods for nucleic acid editing
EP3540051A1 (en) 2013-12-12 2019-09-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
EP4219699A1 (en) 2013-12-12 2023-08-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
EP4183876A1 (en) 2013-12-12 2023-05-24 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
US10550372B2 (en) 2013-12-12 2020-02-04 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
WO2015089351A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
US11155795B2 (en) 2013-12-12 2021-10-26 The Broad Institute, Inc. CRISPR-Cas systems, crystal structure and uses thereof
WO2015089277A1 (en) * 2013-12-12 2015-06-18 The Regents Of The University Of California Methods and compositions for modifying a single stranded target nucleic acid
US9994831B2 (en) 2013-12-12 2018-06-12 The Regents Of The University Of California Methods and compositions for modifying a single stranded target nucleic acid
US11597919B2 (en) 2013-12-12 2023-03-07 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
WO2015089486A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
WO2015089465A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
GB2544382A (en) * 2014-02-11 2017-05-17 The Regents Of The Univ Of Colorado A Body Corp (Existing Under The Laws Of The State Of Colorado) CRISPR enabled multiplexed genome engineering
US10266849B2 (en) 2014-02-11 2019-04-23 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10351877B2 (en) 2014-02-11 2019-07-16 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US9982278B2 (en) 2014-02-11 2018-05-29 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11795479B2 (en) 2014-02-11 2023-10-24 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10240167B2 (en) 2014-02-11 2019-03-26 Inscripta, Inc. CRISPR enabled multiplexed genome engineering
GB2544382B (en) * 2014-02-11 2018-05-30 The Regents Of The Univ Of Colorado A Body Corporate Existing Under The Laws Of The State Of Colorad CRISPR enabled multiplexed genome engineering
JP7232540B2 (en) 2014-02-11 2023-03-03 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイト Multiple genome engineering enabled by CRISPR
US11345933B2 (en) 2014-02-11 2022-05-31 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US11639511B2 (en) 2014-02-11 2023-05-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10364442B2 (en) 2014-02-11 2019-07-30 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11078498B2 (en) 2014-02-11 2021-08-03 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11702677B2 (en) 2014-02-11 2023-07-18 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10731180B2 (en) 2014-02-11 2020-08-04 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10669559B2 (en) 2014-02-11 2020-06-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10711284B2 (en) 2014-02-11 2020-07-14 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
JP2021087454A (en) * 2014-02-11 2021-06-10 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate Crispr enabled multiplexed genome engineering
US10465207B2 (en) 2014-02-11 2019-11-05 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10435715B2 (en) 2014-02-11 2019-10-08 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
JP2019205478A (en) * 2014-02-11 2019-12-05 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate Crispr enabled multiplexed genome engineering
EP3514246A1 (en) 2014-02-27 2019-07-24 The Broad Institute Inc. T cell balance gene expression and methods of use thereof
US11209440B2 (en) 2014-02-27 2021-12-28 The Broad Institute, Inc. T cell balance gene expression, compositions of matters and methods of use thereof
US10655123B2 (en) 2014-03-05 2020-05-19 National University Corporation Kobe University Genomic sequence modification method for specifically converting nucleic acid bases of targeted DNA sequence, and molecular complex for use in same
US11028388B2 (en) 2014-03-05 2021-06-08 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa
US11718846B2 (en) 2014-03-05 2023-08-08 National University Corporation Kobe University Genomic sequence modification method for specifically converting nucleic acid bases of targeted DNA sequence, and molecular complex for use in same
US10253312B2 (en) 2014-03-10 2019-04-09 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating Leber's Congenital Amaurosis 10 (LCA10)
US11268086B2 (en) 2014-03-10 2022-03-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating Leber's Congenital Amaurosis 10 (LCA10)
US11339437B2 (en) 2014-03-10 2022-05-24 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US9938521B2 (en) 2014-03-10 2018-04-10 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10)
US12234449B2 (en) 2014-03-10 2025-02-25 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Leber's congenital amaurosis 10 (LCA10)
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US11242525B2 (en) 2014-03-26 2022-02-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating sickle cell disease
EP3540061A1 (en) * 2014-04-02 2019-09-18 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating primary open angle glaucoma
US12460231B2 (en) 2014-04-02 2025-11-04 Editas Medicine, Inc. Crispr/CAS-related methods and compositions for treating primary open angle glaucoma
WO2015153780A1 (en) * 2014-04-02 2015-10-08 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating primary open angle glaucoma
AU2015248621B2 (en) * 2014-04-14 2020-08-27 Nemesis Bioscience Ltd Therapeutic
US10508271B2 (en) 2014-04-17 2019-12-17 Green Biologics Limited Targeted mutations
GB2530831A (en) * 2014-04-17 2016-04-06 Green Biologics Ltd Targeted mutations
GB2530831B (en) * 2014-04-17 2016-11-30 Green Biologics Ltd Targeted mutations
US10550396B2 (en) 2014-04-17 2020-02-04 Green Biologics Limited Deletion mutations
US10280419B2 (en) 2014-05-09 2019-05-07 UNIVERSITé LAVAL Reduction of amyloid beta peptide production via modification of the APP gene using the CRISPR/Cas system
WO2015168800A1 (en) * 2014-05-09 2015-11-12 UNIVERSITé LAVAL Prevention and treatment of alzheimer's disease by genome editing using the crispr/cas system
US12241090B2 (en) 2014-05-28 2025-03-04 Children's Hospital Medical Center Methods and systems for converting precursor cells into gastric tissues through directed differentiation
US12331347B2 (en) 2014-07-11 2025-06-17 President And Fellows Of Harvard College Methods for high-throughput labelling and detection of biological features in situ using microscopy
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
EP3686279A1 (en) 2014-08-17 2020-07-29 The Broad Institute, Inc. Genome editing using cas9 nickases
EP3188763A4 (en) * 2014-09-02 2018-03-14 The Regents of The University of California Methods and compositions for rna-directed target dna modification
WO2016036754A1 (en) 2014-09-02 2016-03-10 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification
US11124796B2 (en) 2014-09-24 2021-09-21 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo
WO2016049163A2 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
US11197467B2 (en) 2014-09-24 2021-12-14 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-cas systems and compositions for modeling mutations in leukocytes
WO2016049251A1 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes
WO2016049163A3 (en) * 2014-09-24 2016-05-12 The Broad Institute Inc. Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
WO2016049024A3 (en) * 2014-09-24 2016-05-12 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
US11459557B2 (en) 2014-09-24 2022-10-04 The Broad Institute, Inc. Use and production of CHD8+/− transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
US11001829B2 (en) 2014-09-25 2021-05-11 The Broad Institute, Inc. Functional screening with optimized functional CRISPR-Cas systems
US12201699B2 (en) 2014-10-10 2025-01-21 Editas Medicine, Inc. Compositions and methods for promoting homology directed repair
WO2016061073A1 (en) * 2014-10-14 2016-04-21 Memorial Sloan-Kettering Cancer Center Composition and method for in vivo engineering of chromosomal rearrangements
WO2016069591A2 (en) 2014-10-27 2016-05-06 The Broad Institute Inc. Compositions, methods and use of synthetic lethal screening
US11680268B2 (en) 2014-11-07 2023-06-20 Editas Medicine, Inc. Methods for improving CRISPR/Cas-mediated genome-editing
US10457960B2 (en) 2014-11-21 2019-10-29 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide RNAs
US11697828B2 (en) 2014-11-21 2023-07-11 Regeneran Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide RNAs
EP3626832A2 (en) 2014-11-25 2020-03-25 The Brigham and Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086197A1 (en) 2014-11-25 2016-06-02 The Brigham And Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086227A2 (en) 2014-11-26 2016-06-02 The Regents Of The University Of California Therapeutic compositions comprising transcription factors and methods of making and using the same
WO2016083811A1 (en) 2014-11-27 2016-06-02 Imperial Innovations Limited Genome editing methods
US10337001B2 (en) 2014-12-03 2019-07-02 Agilent Technologies, Inc. Guide RNA with chemical modifications
US10900034B2 (en) 2014-12-03 2021-01-26 Agilent Technologies, Inc. Guide RNA with chemical modifications
US12465029B2 (en) 2014-12-10 2025-11-11 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10278372B2 (en) 2014-12-10 2019-05-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10993419B2 (en) 2014-12-10 2021-05-04 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US11234418B2 (en) 2014-12-10 2022-02-01 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
EP3889260A1 (en) 2014-12-12 2021-10-06 The Broad Institute, Inc. Protected guide rnas (pgrnas)
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
EP3985115A1 (en) 2014-12-12 2022-04-20 The Broad Institute, Inc. Protected guide rnas (pgrnas)
WO2016094867A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Protected guide rnas (pgrnas)
WO2016094874A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Escorted and functionalized guides for crispr-cas systems
US12571005B2 (en) 2014-12-12 2026-03-10 The Broad Institute, Inc. Protected guide RNAs (pgRNAs)
WO2016094872A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Dead guides for crispr transcription factors
US10696986B2 (en) 2014-12-12 2020-06-30 The Board Institute, Inc. Protected guide RNAS (PGRNAS)
US11624078B2 (en) 2014-12-12 2023-04-11 The Broad Institute, Inc. Protected guide RNAS (pgRNAS)
WO2016100974A1 (en) 2014-12-19 2016-06-23 The Broad Institute Inc. Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing
US12215326B2 (en) 2014-12-23 2025-02-04 The Broad Institute, Inc. RNA-targeting system
WO2016106236A1 (en) 2014-12-23 2016-06-30 The Broad Institute Inc. Rna-targeting system
US12435320B2 (en) 2014-12-24 2025-10-07 The Broad Institute, Inc. CRISPR having or associated with destabilization domains
WO2016106244A1 (en) 2014-12-24 2016-06-30 The Broad Institute Inc. Crispr having or associated with destabilization domains
EP3702456A1 (en) 2014-12-24 2020-09-02 The Broad Institute, Inc. Crispr having or associated with destabilization domains
US12116619B2 (en) 2014-12-30 2024-10-15 The Broad Institute, Inc. CRISPR mediated in vivo modeling and genetic screening of tumor growth and metastasis
WO2016108926A1 (en) 2014-12-30 2016-07-07 The Broad Institute Inc. Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis
US11155796B2 (en) 2015-02-09 2021-10-26 Duke University Compositions and methods for epigenome editing
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US10676726B2 (en) 2015-02-09 2020-06-09 Duke University Compositions and methods for epigenome editing
US11427869B2 (en) 2015-02-26 2022-08-30 The Broad Institute, Inc. T cell balance gene expression, compositions of matters and methods of use thereof
WO2016138488A2 (en) 2015-02-26 2016-09-01 The Broad Institute Inc. T cell balance gene expression, compositions of matters and methods of use thereof
WO2016138574A1 (en) 2015-03-02 2016-09-09 Sinai Health System Homologous recombination factors
US11851652B2 (en) 2015-04-06 2023-12-26 The Board Of Trustees Of The Leland Stanford Junior Compositions comprising chemically modified guide RNAs for CRISPR/Cas-mediated editing of HBB
US11535846B2 (en) 2015-04-06 2022-12-27 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAS for CRISPR/Cas-mediated gene regulation
US11306309B2 (en) 2015-04-06 2022-04-19 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation
US12534715B2 (en) 2015-04-16 2026-01-27 Wageningen Universiteit Nucleic acids for nuclease-mediated genome editing
US11180793B2 (en) 2015-04-24 2021-11-23 Editas Medicine, Inc. Evaluation of Cas9 molecule/guide RNA molecule complexes
US10561148B2 (en) 2015-05-06 2020-02-18 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11612617B2 (en) 2015-05-06 2023-03-28 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US12502401B2 (en) 2015-05-06 2025-12-23 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US12226430B2 (en) 2015-05-06 2025-02-18 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11147830B2 (en) 2015-05-06 2021-10-19 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US12514869B2 (en) 2015-05-06 2026-01-06 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US10624349B2 (en) 2015-05-06 2020-04-21 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11517582B2 (en) 2015-05-06 2022-12-06 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11844760B2 (en) 2015-05-06 2023-12-19 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US10582712B2 (en) 2015-05-06 2020-03-10 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11400110B2 (en) 2015-05-06 2022-08-02 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US10506812B2 (en) 2015-05-06 2019-12-17 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US12514867B2 (en) 2015-05-06 2026-01-06 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11547716B2 (en) 2015-05-06 2023-01-10 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US11642363B2 (en) 2015-05-06 2023-05-09 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US10524477B2 (en) 2015-05-06 2020-01-07 Snipr Technologies Limited Altering microbial populations and modifying microbiota
US10463049B2 (en) 2015-05-06 2019-11-05 Snipr Technologies Limited Altering microbial populations and modifying microbiota
WO2016182893A1 (en) 2015-05-08 2016-11-17 Teh Broad Institute Inc. Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
US11390884B2 (en) 2015-05-11 2022-07-19 Editas Medicine, Inc. Optimized CRISPR/cas9 systems and methods for gene editing in stem cells
WO2016183438A1 (en) * 2015-05-14 2016-11-17 Massachusetts Institute Of Technology Self-targeting genome editing system
EP4039816A1 (en) * 2015-05-29 2022-08-10 North Carolina State University Methods for screening bacteria, archaea, algae, and yeast using crispr nucleic acids
US11555208B2 (en) 2015-06-03 2023-01-17 Board Of Regents Of The University Of Nebraska DNA editing using relatively long single-stranded DNA and CRISPR/Cas9 to increase success rate in methods for preparing transgenic embryos and animals
US11549126B2 (en) 2015-06-03 2023-01-10 Board Of Regents Of The University Of Nebraska Treatment methods using DNA editing with single-stranded DNA
US11911415B2 (en) 2015-06-09 2024-02-27 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for improving transplantation
WO2016198500A1 (en) * 2015-06-10 2016-12-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for rna-guided treatment of human cytomegalovirus (hcmv) infection
WO2016200263A1 (en) * 2015-06-12 2016-12-15 Erasmus University Medical Center Rotterdam New crispr assays
US11643669B2 (en) 2015-06-17 2023-05-09 Massachusetts Institute Of Technology CRISPR mediated recording of cellular events
WO2016205728A1 (en) 2015-06-17 2016-12-22 Massachusetts Institute Of Technology Crispr mediated recording of cellular events
CN109207477A (en) * 2015-06-18 2019-01-15 布罗德研究所有限公司 Novel C RISPR enzyme and system
US11060115B2 (en) 2015-06-18 2021-07-13 The Broad Institute, Inc. CRISPR enzymes and systems
CN115572718A (en) * 2015-06-18 2023-01-06 布罗德研究所有限公司 Novel CRISPR enzymes and systems
US10494621B2 (en) 2015-06-18 2019-12-03 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
WO2016205745A2 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Cell sorting
KR20180034402A (en) * 2015-06-18 2018-04-04 더 브로드 인스티튜트, 인코퍼레이티드 New CRISPR Enzymes and Systems
WO2016205764A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
US11421250B2 (en) 2015-06-18 2022-08-23 The Broad Institute, Inc. CRISPR enzymes and systems
US11180751B2 (en) 2015-06-18 2021-11-23 The Broad Institute, Inc. CRISPR enzymes and systems
KR102613296B1 (en) 2015-06-18 2023-12-13 더 브로드 인스티튜트, 인코퍼레이티드 Novel CRISPR enzymes and systems
US10876100B2 (en) 2015-06-18 2020-12-29 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
EP4159856A1 (en) 2015-06-18 2023-04-05 The Broad Institute, Inc. Novel crispr enzymes and systems
KR20180034404A (en) * 2015-06-18 2018-04-04 더 브로드 인스티튜트, 인코퍼레이티드 CRISPR enzyme mutations that reduce the target effect
US20180127745A1 (en) * 2015-06-18 2018-05-10 The Broad Institute Inc. Cell sorting
KR102840885B1 (en) 2015-06-18 2025-07-30 더 브로드 인스티튜트, 인코퍼레이티드 Crispr enzyme mutations reducing off-target effects
JP7280312B2 (en) 2015-06-18 2023-05-23 ザ・ブロード・インスティテュート・インコーポレイテッド Novel CRISPR enzymes and systems
US12168789B2 (en) 2015-06-18 2024-12-17 The Broad Institute, Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
EP3666895A1 (en) 2015-06-18 2020-06-17 The Broad Institute, Inc. Novel crispr enzymes and systems
US12123032B2 (en) 2015-06-18 2024-10-22 The Broad Institute, Inc. CRISPR enzyme mutations reducing off-target effects
US11773412B2 (en) 2015-06-18 2023-10-03 The Broad Institute, Inc. Crispr enzymes and systems
US11236327B2 (en) 2015-06-18 2022-02-01 The Broad Institute, Inc. Cell sorting
JP2021151247A (en) * 2015-06-18 2021-09-30 ザ・ブロード・インスティテュート・インコーポレイテッド New CRISPR enzymes and systems
US12091709B2 (en) 2015-06-18 2024-09-17 The Broad Institute, Inc. Crispr enzymes and systems
CN109207477B (en) * 2015-06-18 2021-07-16 布罗德研究所有限公司 CRISPR enzymes and systems
KR102575342B1 (en) 2015-06-18 2023-09-05 더 브로드 인스티튜트, 인코퍼레이티드 CRISPR enzyme mutations that reduce off-target effects
KR20230132877A (en) * 2015-06-18 2023-09-18 더 브로드 인스티튜트, 인코퍼레이티드 Crispr enzyme mutations reducing off-target effects
US11414657B2 (en) 2015-06-29 2022-08-16 Ionis Pharmaceuticals, Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
US10676735B2 (en) 2015-07-22 2020-06-09 Duke University High-throughput screening of regulatory element function with epigenome editing technologies
US10166255B2 (en) 2015-07-31 2019-01-01 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US11266692B2 (en) 2015-07-31 2022-03-08 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US11147837B2 (en) 2015-07-31 2021-10-19 Regents Of The University Of Minnesota Modified cells and methods of therapy
US11903966B2 (en) 2015-07-31 2024-02-20 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US10406177B2 (en) 2015-07-31 2019-09-10 Regents Of The University Of Minnesota Modified cells and methods of therapy
US11583556B2 (en) 2015-07-31 2023-02-21 Regents Of The University Of Minnesota Modified cells and methods of therapy
US11642374B2 (en) 2015-07-31 2023-05-09 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
US11925664B2 (en) 2015-07-31 2024-03-12 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
US11642375B2 (en) 2015-07-31 2023-05-09 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
EP4512819A2 (en) 2015-08-12 2025-02-26 The General Hospital Corporation Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders
WO2017027910A1 (en) 2015-08-14 2017-02-23 The University Of Sydney Connexin 45 inhibition for therapy
EP4043074A1 (en) 2015-08-14 2022-08-17 The University of Sydney Connexin 45 inhibition for therapy
US11214800B2 (en) 2015-08-18 2022-01-04 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
US11427817B2 (en) 2015-08-25 2022-08-30 Duke University Compositions and methods of improving specificity in genomic engineering using RNA-guided endonucleases
EP4177346A3 (en) * 2015-08-25 2023-07-26 Duke University Compositions and methods of improving specificity in genomic engineering using rna-guided endonucleases
US10767173B2 (en) 2015-09-09 2020-09-08 National University Corporation Kobe University Method for converting genome sequence of gram-positive bacterium by specifically converting nucleic acid base of targeted DNA sequence, and molecular complex used in same
US11667911B2 (en) 2015-09-24 2023-06-06 Editas Medicine, Inc. Use of exonucleases to improve CRISPR/CAS-mediated genome editing
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US11970710B2 (en) 2015-10-13 2024-04-30 Duke University Genome engineering with Type I CRISPR systems in eukaryotic cells
CN108431225A (en) * 2015-10-16 2018-08-21 阿斯特拉捷利康股份公司 The induction type of cellular genome is modified
US10947559B2 (en) 2015-10-16 2021-03-16 Astrazeneca Ab Inducible modification of a cell genome
US12509702B2 (en) 2015-10-16 2025-12-30 Astrazeneca Ab Inducible modification of a cell genome
WO2017064566A3 (en) * 2015-10-16 2017-05-26 Astrazeneca Ab Inducible modification of a cell genome
US12049480B2 (en) 2015-10-20 2024-07-30 Institut National De La Sante Et De La Recherche Medicale (INSERM) Paris, FRANCE Methods and products for genetic engineering
US12365707B2 (en) 2015-10-20 2025-07-22 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
US11649264B2 (en) 2015-10-20 2023-05-16 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
WO2017068077A1 (en) 2015-10-20 2017-04-27 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
US12202860B2 (en) 2015-10-20 2025-01-21 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
EP4636083A2 (en) 2015-10-20 2025-10-22 Institut National de la Santé et de la Recherche Médicale (INSERM) Methods and products for genetic engineering
WO2017070605A1 (en) 2015-10-22 2017-04-27 The Broad Institute Inc. Type vi-b crispr enzymes and systems
US12215318B2 (en) 2015-10-22 2025-02-04 The Broad Institute, Inc. Crispr enzymes and systems
US12234454B2 (en) 2015-10-22 2025-02-25 The Broad Institute, Inc. Crispr enzymes and systems
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2017074788A1 (en) 2015-10-27 2017-05-04 The Broad Institute Inc. Compositions and methods for targeting cancer-specific sequence variations
WO2017075478A2 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures
WO2017075451A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1
US11180730B2 (en) 2015-10-28 2021-11-23 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3
WO2017075294A1 (en) 2015-10-28 2017-05-04 The Board Institute Inc. Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction
US11092607B2 (en) 2015-10-28 2021-08-17 The Board Institute, Inc. Multiplex analysis of single cell constituents
US11186825B2 (en) 2015-10-28 2021-11-30 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1
WO2017075465A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3
US11542554B2 (en) 2015-11-03 2023-01-03 President And Fellows Of Harvard College Method and apparatus for volumetric imaging
US11884717B2 (en) 2015-11-19 2024-01-30 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
US11001622B2 (en) 2015-11-19 2021-05-11 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
JPWO2017090761A1 (en) * 2015-11-27 2018-10-25 国立大学法人神戸大学 Method for converting genome sequence of monocotyledonous plant, which specifically converts nucleobase of targeted DNA sequence, and molecular complex used therefor
US11220693B2 (en) 2015-11-27 2022-01-11 National University Corporation Kobe University Method for converting monocot plant genome sequence in which nucleic acid base in targeted DNA sequence is specifically converted, and molecular complex used therein
CN108495932B (en) * 2015-11-27 2022-08-09 国立大学法人神户大学 Method for converting genomic sequence of monocotyledon for specifically converting nucleobase targeting DNA sequence, and molecular complex used therefor
WO2017090761A1 (en) * 2015-11-27 2017-06-01 国立大学法人神戸大学 Method for converting monocot plant genome sequence in which nucleic acid base in targeted dna sequence is specifically converted, and molecular complex used therein
CN108495932A (en) * 2015-11-27 2018-09-04 国立大学法人神户大学 The molecular complex converted the conversion method of the monocotyledonous genome sequence of the nucleic acid base of targeting DNA sequence dna for specificity and its used
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
CN105296518A (en) * 2015-12-01 2016-02-03 中国农业大学 Homologous arm vector construction method used for CRISPR/Cas 9 technology
EP4219689A2 (en) 2015-12-30 2023-08-02 Novartis AG Immune effector cell therapies with enhanced efficacy
WO2017114497A1 (en) 2015-12-30 2017-07-06 Novartis Ag Immune effector cell therapies with enhanced efficacy
WO2017147196A1 (en) 2016-02-22 2017-08-31 Massachusetts Institute Of Technology Methods for identifying and modulating immune phenotypes
WO2017161325A1 (en) 2016-03-17 2017-09-21 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
US11427861B2 (en) 2016-03-17 2022-08-30 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
WO2017158153A1 (en) 2016-03-17 2017-09-21 Imba - Institut Für Molekulare Biotechnologie Gmbh Conditional crispr sgrna expression
WO2017165655A1 (en) * 2016-03-23 2017-09-28 Dana-Farber Cancer Institute, Inc. Methods for enhancing the efficiency of gene editing
US11421218B2 (en) 2016-03-23 2022-08-23 Dana-Farber Cancer Institute, Inc. Methods for enhancing the efficiency of gene editing
US11597924B2 (en) 2016-03-25 2023-03-07 Editas Medicine, Inc. Genome editing systems comprising repair-modulating enzyme molecules and methods of their use
US11512311B2 (en) 2016-03-25 2022-11-29 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency
US11236313B2 (en) 2016-04-13 2022-02-01 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US12049651B2 (en) 2016-04-13 2024-07-30 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US11713485B2 (en) 2016-04-25 2023-08-01 President And Fellows Of Harvard College Hybridization chain reaction methods for in situ molecular detection
US10300138B2 (en) 2016-06-05 2019-05-28 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US11471530B2 (en) 2016-06-05 2022-10-18 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US12318445B2 (en) 2016-06-05 2025-06-03 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10953090B2 (en) 2016-06-05 2021-03-23 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US11141481B2 (en) 2016-06-05 2021-10-12 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10363308B2 (en) 2016-06-05 2019-07-30 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10300139B2 (en) 2016-06-05 2019-05-28 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10765740B2 (en) 2016-06-05 2020-09-08 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US11351252B2 (en) 2016-06-05 2022-06-07 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US11471531B2 (en) 2016-06-05 2022-10-18 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US11291723B2 (en) 2016-06-05 2022-04-05 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10603379B2 (en) 2016-06-05 2020-03-31 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10596255B2 (en) 2016-06-05 2020-03-24 Snipr Technologies Limited Selectively altering microbiota for immune modulation
US10767175B2 (en) 2016-06-08 2020-09-08 Agilent Technologies, Inc. High specificity genome editing using chemically modified guide RNAs
US11788083B2 (en) 2016-06-17 2023-10-17 The Broad Institute, Inc. Type VI CRISPR orthologs and systems
US12612620B2 (en) 2016-06-17 2026-04-28 The Broad Institute, Inc. Type VI CRISPR orthologs and systems
WO2017219027A1 (en) 2016-06-17 2017-12-21 The Broad Institute Inc. Type vi crispr orthologs and systems
US10287575B2 (en) 2016-06-24 2019-05-14 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US10294473B2 (en) 2016-06-24 2019-05-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US10017760B2 (en) 2016-06-24 2018-07-10 Inscripta, Inc. Methods for generating barcoded combinatorial libraries
US11584928B2 (en) 2016-06-24 2023-02-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US12595478B2 (en) 2016-06-29 2026-04-07 The Broad Institute, Inc. Crispr-Cas systems having destabilization domain
US12031150B2 (en) 2016-07-13 2024-07-09 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
WO2018013840A1 (en) 2016-07-13 2018-01-18 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
EP4219462A1 (en) 2016-07-13 2023-08-02 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US11566263B2 (en) 2016-08-02 2023-01-31 Editas Medicine, Inc. Compositions and methods for treating CEP290 associated disease
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
WO2018035250A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
US11352647B2 (en) 2016-08-17 2022-06-07 The Broad Institute, Inc. Crispr enzymes and systems
US12559774B2 (en) 2016-08-17 2026-02-24 The Broad Institute, Inc. CRISPR enzymes and systems
US12431216B2 (en) 2016-08-17 2025-09-30 Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
US12305204B2 (en) 2016-08-17 2025-05-20 The Broad Institute, Inc. CRISPR enzymes and systems
WO2018035364A1 (en) 2016-08-17 2018-02-22 The Broad Institute Inc. Product and methods useful for modulating and evaluating immune responses
US11630103B2 (en) 2016-08-17 2023-04-18 The Broad Institute, Inc. Product and methods useful for modulating and evaluating immune responses
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12565671B2 (en) 2016-08-31 2026-03-03 President And Fellows Of Harvard College Methods of combining the detection of biomolecules into a single assay using fluorescent in situ sequencing
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
WO2018054911A1 (en) 2016-09-23 2018-03-29 Bayer Cropscience Nv Targeted genome optimization in plants
US12499971B2 (en) 2016-09-28 2025-12-16 The Broad Institute, Inc. Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US12447213B2 (en) 2016-10-07 2025-10-21 The Broad Institute, Inc. Modulation of novel immune checkpoint targets
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US11154574B2 (en) 2016-10-18 2021-10-26 Regents Of The University Of Minnesota Tumor infiltrating lymphocytes and methods of therapy
US10912797B2 (en) 2016-10-18 2021-02-09 Intima Bioscience, Inc. Tumor infiltrating lymphocytes and methods of therapy
WO2018083606A1 (en) 2016-11-01 2018-05-11 Novartis Ag Methods and compositions for enhancing gene editing
US12414967B2 (en) 2016-11-04 2025-09-16 Children's Hospital Medical Center Compositions and methods of treating liver disease
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
US12404514B2 (en) 2016-12-09 2025-09-02 The Broad Institute, Inc. CRISPR-systems for modifying a trait of interest in a plant
US12286727B2 (en) 2016-12-19 2025-04-29 Editas Medicine, Inc. Assessing nuclease cleavage
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
US12110545B2 (en) 2017-01-06 2024-10-08 Editas Medicine, Inc. Methods of assessing nuclease cleavage
US12559748B2 (en) 2017-02-06 2026-02-24 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11851690B2 (en) 2017-03-14 2023-12-26 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
EP4361261A2 (en) 2017-03-15 2024-05-01 The Broad Institute Inc. Novel cas13b orthologues crispr enzymes and systems
WO2018170333A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Novel cas13b orthologues crispr enzymes and systems
US11739308B2 (en) 2017-03-15 2023-08-29 The Broad Institute, Inc. Cas13b orthologues CRISPR enzymes and systems
US12180546B2 (en) 2017-03-17 2024-12-31 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
WO2018170515A1 (en) 2017-03-17 2018-09-20 The Broad Institute, Inc. Methods for identifying and modulating co-occurant cellular phenotypes
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US12161694B2 (en) 2017-03-24 2024-12-10 The Broad Institute, Inc. Methods and compositions for regulating innate lymphoid cell inflammatory responses
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2018191520A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
US12331319B2 (en) 2017-04-12 2025-06-17 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
US12590288B2 (en) 2017-04-12 2026-03-31 The Broad Institute, Inc. Method of treating an inflammatory disease by administering an agent which binds a surface receptor on a tuft cell that induces an ILC class 2 inflammatory response
WO2018191388A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Novel type vi crispr orthologs and systems
US12350368B2 (en) 2017-04-14 2025-07-08 The Broad Institute, Inc. Delivery of large payloads
WO2018191750A2 (en) 2017-04-14 2018-10-18 The Broad Institute Inc. Novel delivery of large payloads
US12281334B2 (en) 2017-04-14 2025-04-22 Children's Hospital Medical Center Multi donor stem cell compositions and methods of making same
WO2018195019A1 (en) 2017-04-18 2018-10-25 The Broad Institute Inc. Compositions for detecting secretion and methods of use
US12058986B2 (en) 2017-04-20 2024-08-13 Egenesis, Inc. Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements
WO2018195486A1 (en) 2017-04-21 2018-10-25 The Broad Institute, Inc. Targeted delivery to beta cells
US11499151B2 (en) 2017-04-28 2022-11-15 Editas Medicine, Inc. Methods and systems for analyzing guide RNA molecules
US11591601B2 (en) 2017-05-05 2023-02-28 The Broad Institute, Inc. Methods for identification and modification of lncRNA associated with target genotypes and phenotypes
US11963982B2 (en) 2017-05-10 2024-04-23 Editas Medicine, Inc. CRISPR/RNA-guided nuclease systems and methods
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US12297436B2 (en) 2017-05-18 2025-05-13 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11866697B2 (en) 2017-05-18 2024-01-09 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US12442021B2 (en) 2017-06-05 2025-10-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US11603544B2 (en) 2017-06-05 2023-03-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US12371713B2 (en) 2017-06-08 2025-07-29 Osaka University Method for producing DNA-edited eukaryotic cell, and kit used in the same
EP4349973A3 (en) * 2017-06-08 2024-06-26 Osaka University Method for manufacturing dna-edited eukaryotic cell
US11807869B2 (en) 2017-06-08 2023-11-07 Osaka University Method for producing DNA-edited eukaryotic cell, and kit used in the same
EP3636753A4 (en) * 2017-06-08 2021-03-31 Osaka University PROCESS FOR MANUFACTURING A DNA-EDITED EUKARYOTE CELL, AND KIT USED IN THE PROCESS
US10428319B2 (en) 2017-06-09 2019-10-01 Editas Medicine, Inc. Engineered Cas9 nucleases
US12297466B2 (en) 2017-06-09 2025-05-13 Editas Medicine, Inc. Engineered Cas9 nucleases
US11098297B2 (en) 2017-06-09 2021-08-24 Editas Medicine, Inc. Engineered Cas9 nucleases
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US12180502B2 (en) 2017-06-23 2024-12-31 Inscripta, Inc. Nucleic acid-guided nucleases
US10435714B2 (en) 2017-06-23 2019-10-08 Inscripta, Inc. Nucleic acid-guided nucleases
US9982279B1 (en) 2017-06-23 2018-05-29 Inscripta, Inc. Nucleic acid-guided nucleases
US10011849B1 (en) 2017-06-23 2018-07-03 Inscripta, Inc. Nucleic acid-guided nucleases
US12195749B2 (en) 2017-06-23 2025-01-14 Inscripta, Inc. Nucleic acid-guided nucleases
US11697826B2 (en) 2017-06-23 2023-07-11 Inscripta, Inc. Nucleic acid-guided nucleases
US10626416B2 (en) 2017-06-23 2020-04-21 Inscripta, Inc. Nucleic acid-guided nucleases
US10337028B2 (en) 2017-06-23 2019-07-02 Inscripta, Inc. Nucleic acid-guided nucleases
WO2019005884A1 (en) 2017-06-26 2019-01-03 The Broad Institute, Inc. Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing
WO2019003193A1 (en) 2017-06-30 2019-01-03 Novartis Ag Methods for the treatment of disease with gene editing systems
US11098325B2 (en) 2017-06-30 2021-08-24 Intima Bioscience, Inc. Adeno-associated viral vectors for gene therapy
US11866726B2 (en) 2017-07-14 2024-01-09 Editas Medicine, Inc. Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
WO2019018440A1 (en) 2017-07-17 2019-01-24 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
US12105089B2 (en) 2017-07-17 2024-10-01 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
US12239646B2 (en) 2017-07-19 2025-03-04 Dana-Farber Cancer Institute, Inc. Cancer diagnostic and treatment
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11384383B2 (en) 2017-08-08 2022-07-12 Depixus In vitro isolation and enrichment of nucleic acids using site-specific nucleases
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
WO2019060746A1 (en) 2017-09-21 2019-03-28 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
US12043870B2 (en) 2017-10-02 2024-07-23 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2019071054A1 (en) 2017-10-04 2019-04-11 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
US12297457B2 (en) 2017-10-10 2025-05-13 Children's Hospital Medical Center Esophageal tissue and/or organoid compositions and methods of making same
US11680296B2 (en) 2017-10-16 2023-06-20 Massachusetts Institute Of Technology Mycobacterium tuberculosis host-pathogen interaction
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US12589145B2 (en) 2017-10-20 2026-03-31 Fred Hutchinson Cancer Center Systems to produce B cells genetically modified to express selected antibodies
US11578118B2 (en) 2017-10-20 2023-02-14 Fred Hutchinson Cancer Center Systems and methods to produce B cells genetically modified to express selected antibodies
US12227742B2 (en) 2017-10-23 2025-02-18 The Broad Institute, Inc. Nucleic acid modifiers
US11547614B2 (en) 2017-10-31 2023-01-10 The Broad Institute, Inc. Methods and compositions for studying cell evolution
US12433803B2 (en) 2017-10-31 2025-10-07 The Broad Institute, Inc. Methods and compositions for studying cell evolution
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
US12221720B2 (en) 2017-11-13 2025-02-11 The Broad Institute, Inc. Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
US11332736B2 (en) 2017-12-07 2022-05-17 The Broad Institute, Inc. Methods and compositions for multiplexing single cell and single nuclei sequencing
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12379372B2 (en) 2017-12-21 2025-08-05 Children's Hospital Medical Center Digitalized human organoids and methods of using same
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
US12005127B2 (en) 2018-01-17 2024-06-11 Vertex Pharmaceuticals Incorporated DNA-PK inhibitors
US12121524B2 (en) 2018-01-17 2024-10-22 Vertex Pharmaceuticals Incorporated DNA-PK inhibitors
US12269804B2 (en) 2018-01-17 2025-04-08 Vertex Pharmaceuticals Incorporated Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency
WO2019143675A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
WO2019143678A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
AU2022200130B2 (en) * 2018-02-15 2024-03-07 Sigma-Aldrich Co. Llc Engineered Cas9 systems for eukaryotic genome modification
US12031132B2 (en) 2018-03-14 2024-07-09 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
US12589115B2 (en) 2018-03-29 2026-03-31 The University Court Of The University Of Edinburgh Haematopoietic stem cell treatment
WO2019204585A1 (en) 2018-04-19 2019-10-24 Massachusetts Institute Of Technology Single-stranded break detection in double-stranded dna
WO2019206927A1 (en) 2018-04-24 2019-10-31 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
EP3560330A1 (en) 2018-04-24 2019-10-30 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US12180490B2 (en) 2018-04-24 2024-12-31 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
WO2019210268A2 (en) 2018-04-27 2019-10-31 The Broad Institute, Inc. Sequencing-based proteomics
US10920222B2 (en) 2018-04-30 2021-02-16 Snipr Biome Aps Treating and preventing microbial infections
US11485973B2 (en) 2018-04-30 2022-11-01 Snipr Biome Aps Treating and preventing microbial infections
US10760075B2 (en) 2018-04-30 2020-09-01 Snipr Biome Aps Treating and preventing microbial infections
US11421227B2 (en) 2018-04-30 2022-08-23 Snipr Biome Aps Treating and preventing microbial infections
US11788085B2 (en) 2018-04-30 2023-10-17 Snipr Biome Aps Treating and preventing microbial infections
US12448619B2 (en) 2018-04-30 2025-10-21 Snipr Biome Aps Treating and preventing microbial infections
US11643653B2 (en) 2018-04-30 2023-05-09 Snipr Biome Aps Treating and preventing microbial infections
WO2019213660A2 (en) 2018-05-04 2019-11-07 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses
US11345932B2 (en) 2018-05-16 2022-05-31 Synthego Corporation Methods and systems for guide RNA design and use
US11802296B2 (en) 2018-05-16 2023-10-31 Synthego Corporation Methods and systems for guide RNA design and use
US11697827B2 (en) 2018-05-16 2023-07-11 Synthego Corporation Systems and methods for gene modification
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
US12286624B2 (en) 2018-06-08 2025-04-29 Johann Wolfgang Goethe-Universität Frankfurt am Main Method for generating a gene editing vector with fixed guide RNA pairs
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
WO2020006036A1 (en) 2018-06-26 2020-01-02 Massachusetts Institute Of Technology Crispr effector system based amplification methods, systems, and diagnostics
WO2020006049A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr/cas and transposase based amplification compositions, systems and methods
US12338436B2 (en) 2018-06-29 2025-06-24 Editas Medicine, Inc. Synthetic guide molecules, compositions and methods relating thereto
WO2020002592A1 (en) 2018-06-29 2020-01-02 Stichting Het Nederlands Kanker Instituut - Antoni Van Leeuwenhoek Ziekenhuis Traf2 inhibitors for use in the treatment of a cancer
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US12421500B2 (en) 2018-07-26 2025-09-23 Children's Hospital Medical Center Hepato-biliary-pancreatic tissues and methods of making same
WO2020028555A2 (en) 2018-07-31 2020-02-06 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2020033601A1 (en) 2018-08-07 2020-02-13 The Broad Institute, Inc. Novel cas12b enzymes and systems
WO2020041380A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. Methods and compositions for optochemical control of crispr-cas9
US12421507B2 (en) 2018-08-20 2025-09-23 The Broad Institute, Inc. Methods and compositions for optochemical control of CRISPR-CAS9
WO2020041387A1 (en) 2018-08-20 2020-02-27 The Brigham And Women's Hospital, Inc. Degradation domain modifications for spatio-temporal control of rna-guided nucleases
WO2020051507A1 (en) 2018-09-06 2020-03-12 The Broad Institute, Inc. Nucleic acid assemblies for use in targeted delivery
US12428622B2 (en) 2018-09-12 2025-09-30 Children's Hospital Medical Center Organoid compositions for the production of hematopoietic stem cells and derivatives thereof
EP4268831A2 (en) 2018-09-12 2023-11-01 Fred Hutchinson Cancer Center Reducing cd33 expression to selectively protect therapeutic cells
US11505578B2 (en) 2018-09-18 2022-11-22 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
US11447527B2 (en) 2018-09-18 2022-09-20 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
US12617822B2 (en) 2018-09-18 2026-05-05 Aera Therapeutics, Inc. Arc-based capsids and uses thereof
WO2020065062A1 (en) 2018-09-28 2020-04-02 Wageningen Universiteit Off-target activity inhibitors for guided endonucleases
US12098425B2 (en) 2018-10-10 2024-09-24 Readcoor, Llc Three-dimensional spatial molecular indexing
WO2020077236A1 (en) 2018-10-12 2020-04-16 The Broad Institute, Inc. Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
AU2019372642B2 (en) * 2018-10-29 2023-11-23 China Agricultural University Novel CRISPR/Cas12f enzyme and system
WO2020093025A1 (en) * 2018-11-01 2020-05-07 Synthego Corporation Methods for knock-out of a target sequence through introduction of a premature stop codon
US11970733B2 (en) 2018-11-01 2024-04-30 Synthego Corporation Methods for analyzing nucleic acid sequences
US12165743B2 (en) 2018-11-09 2024-12-10 The Broad Institute, Inc. Compressed sensing for screening and tissue imaging
US12402610B2 (en) 2018-11-09 2025-09-02 The Broad Institute, Inc. Methods and compositions for modulating innate lymphoid cell pathogenic effectors
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
WO2020131862A1 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
US12264323B2 (en) 2018-12-17 2025-04-01 The Broad Institute, Inc. CRISPR CPF1 direct repeat variants
US11384344B2 (en) 2018-12-17 2022-07-12 The Broad Institute, Inc. CRISPR-associated transposase systems and methods of use thereof
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12600943B2 (en) 2019-02-01 2026-04-14 The University Of Hong Kong Innervated organoid compositions and methods of making same
US12534714B2 (en) 2019-03-18 2026-01-27 The Broad Institute, Inc. Type VII CRISPR proteins and systems
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12624354B2 (en) 2019-03-19 2026-05-12 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12624353B2 (en) 2019-03-19 2026-05-12 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
WO2020206036A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Novel nucleic acid modifier
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
WO2020229241A1 (en) 2019-05-10 2020-11-19 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2020229533A1 (en) 2019-05-13 2020-11-19 KWS SAAT SE & Co. KGaA Drought tolerance in corn
WO2020236972A2 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Non-class i multi-component nucleic acid targeting systems
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020239680A2 (en) 2019-05-25 2020-12-03 KWS SAAT SE & Co. KGaA Haploid induction enhancer
US12534709B2 (en) 2019-05-31 2026-01-27 Children's Hospital Medical Center Shaped organoid compositions and methods of making same
WO2020243661A1 (en) 2019-05-31 2020-12-03 The Broad Institute, Inc. Methods for treating metabolic disorders by targeting adcy5
US12497597B2 (en) 2019-05-31 2025-12-16 Children's Hospital Medical Center Methods of generating and expanding hematopoietic stem cells
WO2021003432A1 (en) 2019-07-02 2021-01-07 Fred Hutchinson Cancer Research Center Recombinant ad35 vectors and related gene therapy improvements
WO2021001534A1 (en) 2019-07-03 2021-01-07 Wageningen Universiteit Crispr type v-u1 system from mycobacterium mucogenicum and uses thereof
EP3772542A1 (en) 2019-08-07 2021-02-10 KWS SAAT SE & Co. KGaA Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
WO2021048316A1 (en) 2019-09-12 2021-03-18 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021055874A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Novel type vi crispr enzymes and systems
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
WO2021069387A1 (en) 2019-10-07 2021-04-15 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
WO2021074367A1 (en) 2019-10-17 2021-04-22 KWS SAAT SE & Co. KGaA Enhanced disease resistance of crops by downregulation of repressor genes
WO2021105191A1 (en) 2019-11-29 2021-06-03 Basf Se Increasing resistance against fungal infections in plants
WO2021111466A1 (en) * 2019-12-02 2021-06-10 Council Of Scientific & Industrial Research Method and kit for detection of polynucleotide
WO2021110582A1 (en) 2019-12-03 2021-06-10 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021122687A1 (en) 2019-12-19 2021-06-24 Basf Se Increasing space-time-yield, carbon-conversion-efficiency and carbon substrate flexibility in the production of fine chemicals
WO2021122528A1 (en) 2019-12-20 2021-06-24 Basf Se Decreasing toxicity of terpenes and increasing the production potential in micro-organisms
US12559790B2 (en) 2020-01-29 2026-02-24 10X Genomics, Inc. Compositions and methods for analyte detection
EP3872190A1 (en) 2020-02-26 2021-09-01 Antibodies-Online GmbH A method of using cut&run or cut&tag to validate crispr-cas targeting
US12057197B2 (en) 2020-04-03 2024-08-06 Creyon Bio, Inc. Oligonucleotide-based machine learning
US12400739B2 (en) 2020-04-03 2025-08-26 Creyon Bio, Inc. Oligonucleotide-based machine learning
WO2021202938A1 (en) 2020-04-03 2021-10-07 Creyon Bio, Inc. Oligonucleotide-based machine learning
US12629428B2 (en) 2020-04-14 2026-05-19 Duke University AAV vector-mediated deletion of large mutational hotspot for treatment of Duchenne muscular dystrophy
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US12505549B1 (en) 2020-05-22 2025-12-23 Insitro, Inc. Microscopy image analyses for disease modeling
WO2021239986A1 (en) 2020-05-29 2021-12-02 KWS SAAT SE & Co. KGaA Plant haploid induction
US12203136B2 (en) 2020-08-17 2025-01-21 Readcoor, Llc Methods and systems for spatial mapping of genetic variants
CN112080587A (en) * 2020-08-31 2020-12-15 上海海关动植物与食品检验检疫技术中心 RAA-CRISPR amplification primer group, kit and method for efficiently detecting novel coronavirus
EP4001429A1 (en) 2020-11-16 2022-05-25 Antibodies-Online GmbH Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq)
WO2022155265A2 (en) 2021-01-12 2022-07-21 Mitolab Inc. Context-dependent, double-stranded dna-specific deaminases and uses thereof
WO2022221699A1 (en) 2021-04-16 2022-10-20 Beam Therapeutics, Inc. Genetic modification of hepatocytes
WO2022256440A2 (en) 2021-06-01 2022-12-08 Arbor Biotechnologies, Inc. Gene editing systems comprising a crispr nuclease and uses thereof
WO2023006933A1 (en) 2021-07-30 2023-02-02 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US11884915B2 (en) 2021-09-10 2024-01-30 Agilent Technologies, Inc. Guide RNAs with chemical modification for prime editing
WO2023093862A1 (en) 2021-11-26 2023-06-01 Epigenic Therapeutics Inc. Method of modulating pcsk9 and uses thereof
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
US12076375B2 (en) 2022-06-29 2024-09-03 Snipr Biome Aps Treating and preventing E coli infections
WO2024042199A1 (en) 2022-08-26 2024-02-29 KWS SAAT SE & Co. KGaA Use of paired genes in hybrid breeding
WO2024064824A2 (en) 2022-09-21 2024-03-28 Yale University Compositions and methods for identification of membrane targets for enhancement of nk cell therapy
WO2024080067A1 (en) 2022-10-14 2024-04-18 株式会社インプランタイノベーションズ Genome editing method and composition for genome editing
WO2024083579A1 (en) 2022-10-20 2024-04-25 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2024168253A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
WO2024168265A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system
WO2024173645A1 (en) 2023-02-15 2024-08-22 Arbor Biotechnologies, Inc. Gene editing method for inhibiting aberrant splicing in stathmin 2 (stmn2) transcript
WO2024206911A2 (en) 2023-03-30 2024-10-03 Children's Hospital Medical Center Clinical-grade organoids
WO2024220741A1 (en) 2023-04-19 2024-10-24 Flagship Pioneering Innovations Vii, Llc Compositions and methods for the production of libraries
WO2024238977A2 (en) 2023-05-18 2024-11-21 Children's Hospital Medical Center Liver organoids with intrahepatic sympathetic nerves, and methods of use thereof
WO2024236547A1 (en) 2023-05-18 2024-11-21 Inceptor Bio, Llc Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof
US12630838B2 (en) 2023-06-01 2026-05-19 Egenesis, Inc. Cells, tissues, organs, and animals having one or more modified genes for enhanced xenograft survival and tolerance
WO2024263961A2 (en) 2023-06-23 2024-12-26 Children's Hospital Medical Center Methods of matrix-free suspension culture
WO2025006419A1 (en) 2023-06-26 2025-01-02 Flagship Pioneering Innovations Vii, Llc Engineered plasmodia and related methods
WO2025027165A1 (en) 2023-08-01 2025-02-06 Basf Plant Science Company Gmbh Increased resistance by expression of an ics protein
WO2025027166A1 (en) 2023-08-01 2025-02-06 Basf Plant Science Company Gmbh Increased resistance by expression of msbp1 protein
WO2025046513A1 (en) 2023-08-29 2025-03-06 Inceptor Bio, Llc Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof
WO2025072803A1 (en) 2023-09-29 2025-04-03 Children's Hospital Medical Center Ntrk2 signaling-mediated alveolar capillary injury and repair
WO2025158400A1 (en) 2024-01-24 2025-07-31 Yale University Compositions and methods of natural killer cell hyperboosts for enhancement of nk cell therapy
WO2025162985A1 (en) 2024-01-30 2025-08-07 Basf Plant Science Company Gmbh Increased plant disease resistance by expression of a glycine-rich protein
WO2025171210A1 (en) 2024-02-09 2025-08-14 Arbor Biotechnologies, Inc. Compositions and methods for gene editing via homology-mediated end joining
WO2025212920A1 (en) 2024-04-03 2025-10-09 Children's Hospital Medical Center Multi-zonal liver organoids
WO2025217202A1 (en) 2024-04-08 2025-10-16 Children's Hospital Medical Center Bile duct organoid
WO2026006542A2 (en) 2024-06-26 2026-01-02 Yale University Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome
WO2026015832A2 (en) 2024-07-12 2026-01-15 Arbor Biotechnologies, Inc. Reverse transcriptases and gene editing systems comprising such
WO2026015829A2 (en) 2024-07-12 2026-01-15 Arbor Biotechnologies, Inc. Small reverse transcriptases and gene editing systems comprising such
WO2026047626A1 (en) 2024-08-30 2026-03-05 Inceptor Bio, Llc Compositions and methods involving immune cells engineered for binding bispecific antibodies for use in cell therapy

Also Published As

Publication number Publication date
AU2022203763A1 (en) 2022-06-16
EP4286403A3 (en) 2024-02-14
KR102955556B1 (en) 2026-04-22
US20190292550A1 (en) 2019-09-26
EP3825401A1 (en) 2021-05-26
JP2023093658A (en) 2023-07-04
KR20260055511A (en) 2026-04-23
HK1208056A1 (en) 2016-02-19
BR122021008308B1 (en) 2022-12-27
EP3252160A1 (en) 2017-12-06
EP4234696A2 (en) 2023-08-30
US20150079681A1 (en) 2015-03-19
US20250250578A1 (en) 2025-08-07
US20200080094A1 (en) 2020-03-12
AU2019280394B2 (en) 2022-06-09
US20260022392A1 (en) 2026-01-22
US20150031134A1 (en) 2015-01-29
EP4286403A2 (en) 2023-12-06
CN110982844B (en) 2024-08-13
WO2014093595A9 (en) 2015-08-06
US20230374527A1 (en) 2023-11-23
AU2025203777A9 (en) 2026-03-19
JP7542681B2 (en) 2024-08-30
US20160115488A1 (en) 2016-04-28
AU2013359262B2 (en) 2019-10-31
US8871445B2 (en) 2014-10-28
EP4234696A3 (en) 2023-09-06
JP7269990B2 (en) 2023-05-09
DK3252160T3 (en) 2021-02-01
AU2019280394A1 (en) 2020-01-16
US20220135985A1 (en) 2022-05-05
AU2013359262A1 (en) 2015-07-30
US20200063147A1 (en) 2020-02-27
CN110982844A (en) 2020-04-10
US20140273231A1 (en) 2014-09-18
BR112015013786B1 (en) 2022-03-15
US20140179006A1 (en) 2014-06-26
US9822372B2 (en) 2017-11-21
AU2022203763B2 (en) 2025-02-27
CN105658796B (en) 2021-10-26
US20190040399A1 (en) 2019-02-07
US20230340505A1 (en) 2023-10-26
JP6896786B2 (en) 2021-06-30
JP2016505256A (en) 2016-02-25
AU2013359262C1 (en) 2021-05-13
EP4570817A2 (en) 2025-06-18
EP4286404A2 (en) 2023-12-06
US20240182913A1 (en) 2024-06-06
EP4570817A3 (en) 2025-09-24
BR112015013786A2 (en) 2017-07-11
US20140189896A1 (en) 2014-07-03
US20200032278A1 (en) 2020-01-30
EP2840140A1 (en) 2015-02-25
JP2019162113A (en) 2019-09-26
AU2025203777A1 (en) 2025-06-12
US9840713B2 (en) 2017-12-12
JP2024170441A (en) 2024-12-10
EP2840140B1 (en) 2016-11-16
US20180179547A1 (en) 2018-06-28
EP2825654A1 (en) 2015-01-21
KR20150105635A (en) 2015-09-17
US20250304977A1 (en) 2025-10-02
US20240117365A1 (en) 2024-04-11
EP2825654B1 (en) 2017-04-26
US20160115489A1 (en) 2016-04-28
US20200032277A1 (en) 2020-01-30
EP4286404A3 (en) 2024-02-14
CN105658796A (en) 2016-06-08
EP4286402A3 (en) 2024-02-14
US20210079407A1 (en) 2021-03-18
JP2021166513A (en) 2021-10-21
HK1206388A1 (en) 2016-01-08
EP3252160B1 (en) 2020-10-28
CA2894668A1 (en) 2014-06-19
JP7847620B2 (en) 2026-04-17
US20190017058A1 (en) 2019-01-17
US20180327756A1 (en) 2018-11-15
EP2840140B2 (en) 2023-02-22
US8795965B2 (en) 2014-08-05
CN114634950A (en) 2022-06-17
US20180305704A1 (en) 2018-10-25
US20200318123A1 (en) 2020-10-08
EP4286402A2 (en) 2023-12-06

Similar Documents

Publication Publication Date Title
US20260022392A1 (en) Crispr-cas component systems, methods and compositions for sequence manipulation
US20200354742A1 (en) CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
HK1247961A1 (en) Crispr-cas component systems, methods and compositions for sequence manipulation
HK1208056B (en) Crispr-cas component systems, methods and compositions for sequence manipulation
HK1206388B (en) Crispr-cas component systems, methods and compositions for sequence manipulation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13812430

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2013812430

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2013812430

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2894668

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2015547530

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: P789/2015

Country of ref document: AE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015013786

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20157018662

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015128102

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013359262

Country of ref document: AU

Date of ref document: 20131212

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015013786

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150611

WWW Wipo information: withdrawn in national office

Ref document number: 2013812430

Country of ref document: EP

WWR Wipo information: refused in national office

Ref document number: 1020157018662

Country of ref document: KR

WWC Wipo information: continuation of processing after refusal or withdrawal

Ref document number: 1020157018662

Country of ref document: KR

WWD Wipo information: divisional of initial pct application

Ref document number: 1020267010790

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 1020267010790

Country of ref document: KR