WO2014016362A1 - Vaccine compositions for prevention against dengue virus infection - Google Patents
Vaccine compositions for prevention against dengue virus infection Download PDFInfo
- Publication number
- WO2014016362A1 WO2014016362A1 PCT/EP2013/065669 EP2013065669W WO2014016362A1 WO 2014016362 A1 WO2014016362 A1 WO 2014016362A1 EP 2013065669 W EP2013065669 W EP 2013065669W WO 2014016362 A1 WO2014016362 A1 WO 2014016362A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- dengue
- sequence
- polypeptide
- serotype
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/295—Polyvalent viral antigens; Mixtures of viral and bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5252—Virus inactivated (killed)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to vaccine compositions and uses of such compositions in a method of protecting a human subject against dengue disease.
- Dengue is the second most important infectious tropical disease after malaria with approximately one-half of the world's population living in areas where there is a risk of epidemic transmission. There are estimated to be 50-100 million cases of dengue disease every year resulting in 500,000 patients being hospitalized for dengue hemorrhagic fever (DHF) and resulting in approximately 25,000 deaths.
- DHF dengue hemorrhagic fever
- Dengue disease infections are endemic in more than 100 tropical countries and dengue hemorrhagic fever (DHF) has been documented in 60 of these countries (Gubler, 2002, TRENDS in Microbiology, 10: 100-103).
- DHF dengue hemorrhagic fever
- Dengue disease is caused by four antigenically distinct, but closely related dengue virus serotypes of the flavivirus genus (Gubler et al., 1988, in: Epidemiology of arthropod- borne viral disease. Monath TPM, editor, Boca Raton (FL): CRC Press: 223-60; Kautner et al., 1997, J. of Pediatrics, 131 : 516-524; Rigau-Perez et al., 1998, Lancet, 352: 971 - 977; Vaughn et al., 1997, J. Infect. Dis., 176: 322-30).
- Dengue disease is usually transmitted by injection of the dengue virus during the blood meal of an Aedes aegypti mosquito infected by the virus. After an incubation period of 4-10 days, the illness begins abruptly and is followed by three phases: febrile (2 to 7 days), critical (24-48 hours - during which severe complications may occur) and recovery (48-72 hours). During the critical phase, life threatening complications such as hemorrhages, shock and acute organ impairment may occur. A proper management of these unpredictable outcomes can reduce the case fatality rate. Cure of dengue fever is complete after 7 to 10 days, but prolonged asthenia is normal. Reduced leukocyte and platelet numbers are frequently observed.
- DHF Dengue haemorrhagic fever
- a potentially deadly complication of dengue virus infection DHF is characterized by a high fever and symptoms of dengue disease, but with extreme lethargy and drowsiness. Increased vascular permeability and abnormal homeostasis can lead to a decrease in blood volume, hypotension, and in severe cases, hypovolemic shock and internal bleeding.
- Two factors appear to play a major role in the occurrence of DHF - rapid viral replication with a high level of viremia (the severity of the disease being associated with the level of viremia; Vaughn et al., 2000, J. Inf.
- DSS Dengue shock syndrome
- the four serotypes of dengue virus possess approximately 60-80% sequence homology. Infection with one dengue serotype provides durable homologous immunity but limited heterologous immunity (Sabin, 1952, Am. J. Trop. Med. Hyg., 1 : 30-50). Accordingly, an individual that has been infected with one serotype of dengue may subsequently become infected with a different serotype. In the past, it has been considered that a second infection arising from a different dengue virus serotype is theoretically a risk factor for the development of DHF, since the majority of patients that exhibit DHF have been previously exposed to at least one of the other four serotypes of dengue viruses.
- dengue prevention measures such as mosquito control and personal protection from bites
- a safe and efficacious dengue vaccine would be the best mode of prevention.
- the present invention relates to a dengue virus serotype 2 vaccine composition
- a dengue virus serotype 2 vaccine composition comprising:
- a dengue antigen selected from the group consisting of:
- VLP dengue virus-like particle
- dengue antigen comprises a polypeptide having at least 90% identity to SEQ ID NO: 12.
- the present invention further relates to a vaccine composition
- a dengue antigen of serotype 2 selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus; or (d) a combination of two or more of (a) to (c); wherein said dengue antigen comprises a nucleotide sequence encoding a protein comprising a polypeptide or polypeptides as defined in the claims.
- a vaccine composition comprising a dengue antigen of serotype 2 selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus; or (d) a combination of two or more of (a) to (c); wherein said dengue antigen comprises a nucleotide sequence having at least 90% sequence identity to a sequence selected from the group consisting of the RNA equivalent of SEQ ID NO: 1 , the RNA equivalent of SEQ ID NO: 4, the RNA equivalent of SEQ ID NO: 5, the RNA equivalent of SEQ ID NO: 6, the RNA equivalent of SEQ ID NO: 7 and SEQ ID NO: 25.
- the present invention further relates to pharmaceutical formulation comprising a vaccine composition of the present invention and a pharmaceutically acceptable carrier, diluent or excipient.
- the present invention further relates to a vaccine composition of the present invention for use in therapy.
- the present invention further relates to a vaccine composition of the present invention for use in a method of protecting a human subject against dengue disease caused by a dengue virus of serotype 2.
- the present invention further relates to a vaccine composition of the present invention for use in a method of generating neutralising antibodies against a dengue virus of serotype 2.
- the present invention further relates to vaccine composition of the present invention which comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4 for use in a method of generating neutralising antibodies against the four serotypes of dengue.
- the present invention further relates to the use of a vaccine composition of the present invention for the manufacture of a medicament for protecting a human subject against dengue disease caused by a dengue virus of serotype 2.
- the present invention further relates to a method of protecting a human subject against dengue disease caused by a dengue virus of serotype 2, wherein said method comprises administering to said subject an effective amount of a composition according to the present invention.
- the present invention further relates to a kit comprising a composition according to the present invention and instructions for the use of said composition in a method of protecting a human subject against dengue disease caused by a dengue virus of serotype 2.
- the present invention relates to a vaccine composition for use in a method of protecting a human subject against dengue disease, wherein said composition comprises: (i) a dengue antigen selected from the group consisting of:
- VLP dengue virus-like particle
- the present invention further relates to the use of a vaccine composition of the present invention for the manufacture of a medicament for protecting a human subject against dengue disease.
- the present invention further relates to a method of protecting a human subject against dengue disease, wherein said method comprises administering to said human subject an effective amount of a composition according to the present invention.
- the present invention relates to a kit comprising a composition according to the present invention and instructions for the use of said composition in a method of protecting a human subject against dengue disease.
- Figure 1 illustrates the construction of the YF-VAX cDNA by RT-PCR and cloning Definitions
- Dengue disease refers to the clinical symptoms exhibited by an individual following infection by any one of the four Dengue virus serotypes. Since 1970, clinical dengue has been classified according to World Health Organization guidelines as (i) dengue fever or (ii) dengue hemorrhagic fever (World Health Organization. Dengue hemorrhagic fever: Diagnosis, treatment, prevention and control 2 nd Ed. Geneva: WHO, 1997; ISBN 92 4 154500 3). In 2009, the WHO issued new guidelines that classify clinical dengue as (i) dengue with or without warning signs or (ii) severe dengue. Both classifications are shown in Figures 1 & 2 of Srikiatkachorn et al., Clin. Infect. Dis.
- dengue fever is characterized by at least two symptoms selected from headache, arthralgia, retro-orbital pain, rash, myalgia, hemorrhagic manifestations, and leucopenia, together with supportive serology or occurrence at the same location and time as other confirmed dengue cases. Progression to Dengue hemorrhagic fever is confirmed when fever, hemorrhagic manifestations, thrombocytopenia and evidence of plasma leakage are all observed.
- diagnosis of dengue requires the presence of fever and at least two clinical symptoms selected from nausea, vomiting, rash, aches and pains, a positive tourniquet test, or any warning signs selected from abdominal pain and tenderness, persistent vomiting, clinical fluid accumulation, mucosal bleed, lethargy or restlessness, liver enlargement greater than 2 cm or an increase in hematocrit concurrent with a rapid decrease in platelet count.
- Severe dengue is diagnosed when any of the following events are observed: severe plasma leakage leading to shock or respiratory distress, severe bleeding as evaluated by clinicians or severe organ involvement
- DHF Dengue hemorrhagic fever or DHF
- DHF refers to virologically-confirmed dengue disease wherein fever, hemorrhagic manifestations, thrombocytopenia and evidence of plasma leakage are all observed.
- DHF may be further defined on the basis of its severity. For instance, DHF may be defined as being of Grade I, Grade II, Grade III or Grade IV (World Health Organization. Dengue hemorrhagic fever: Diagnosis, treatment, prevention and control 2 nd Ed. Geneva: WHO, 1997; ISBN 92 4 154500 3).
- Grade I is defined as fever accompanied by nonspecific constitutional symptoms; the only haemorrhagic manifestation is a positive tourniquet test and/or easy bruising.
- Grade II is defined as spontaneous bleeding in addition to the manifestations of Grade I patients, usually in the form of skin or other haemorrhages.
- Grade III is defined as circulatory failure manifested by a rapid, weak pulse and narrowing of pulse pressure or hypotension, with the presence of cold clammy skin and restlessness.
- Grade IV is defined as profound shock with undetectable blood pressure or pulse.
- Results are expressed as a concentration of logioGEQ (genome equivalent)/ml_, by comparison with standards containing known concentrations of viral genomic serotype-specific nucleic acid sequences integrated into plasmids.
- 50 ⁇ _ of patient serum, a positive control, a negative control, or a cut-off control are diluted 1 :2 in sample diluent and combined with 100 ⁇ _ of diluted horseradish peroxidase (HRP)-labeled anti-NS1 monoclonal Ab (MAb).
- HRP horseradish peroxidase
- MAb monoclonal Ab
- Capture MAb/NS1/HRP-labeled-MAb complexes are formed when NS1 is present in the serum. Complexes are detected via a colorimetric reaction in positive wells which is induced by adding 160 ⁇ _ of 3, 3', 5, 5' tetramethylbenzidine (TMB) substrate and incubating for 30 minutes at room temperature in the dark. The reaction is stopped with the addition of 100 ⁇ _ of stop solution (1 N H 2 S04) and the plate is read. A sample ratio is determined for each sample by dividing the average optical density (OD) of the test sample by the average OD of the cut-off control (tested in quadruplicate). Sample ratios of ⁇ 0.5, 0.5- ⁇ 1.0, and ⁇ 1 are indicative of negative, equivocal, and positive results, respectively.
- TMB tetramethylbenzidine
- severe virologicallv-confirmed dengue refers to dengue haemorrhagic fever (DHF) as defined by the 1997 WHO classification and further characterized by the following additional list of symptoms: haemorrhage requiring blood transfusion, objective evidence of capillary permeability, signs of circulatory failure or visceral manifestations.
- DHF dengue haemorrhagic fever
- DSS dengue shock syndrome
- dengue fever viruses refer to positive single-strand RNA viruses belonging to the Flavivirus genus of the family of flaviviridae.
- dengue virus There are four different serotypes of dengue virus (serotypes 1 , 2 3 and 4), which possess approximately 60-80% sequence homology.
- the organization of the genome comprises the following elements: a 5' non-coding region (NCR), a region encoding structural proteins (capsid (C), pre-membrane (prM) and envelope (E)) and a region encoding non-structural proteins (NS1 -NS2A-NS2B-NS3- NS4A-NS4B-NS5) and a 3' NCR.
- the dengue viral genome encodes an uninterrupted coding region which is translated into a single polyprotein which undergoes post- translational processing.
- the sub-sequences included in the prM-E sequences may be numbered in various ways: (i) the total prM-E protein sequence is numbered from position 1 to position 661 , with the preM protein sequence designated as position 1 to position 90/91 , the M protein sequence designated as position 91/92 to position 166 and the E protein sequence designated as position 167 to position 661 ; (ii) the prM and M protein sequences are numbered together, i.e.
- E is numbered separately from position 1 to position 495;
- prM is numbered from position 1 to 90/91
- M is numbered from 1 to 75/76 and E from position 1 to position 495.
- E protein is always numbered from position 1 to position 495.
- a residue designated herein as E-154 refers to position 154 of the E protein.
- vaccinal dengue virus refers to a virus which is capable of inducing neutralizing antibodies against the dengue virus serotype from which the vaccinal dengue virus is derived, by the administration of such vaccinal dengue virus to an immunocompetent subject.
- vaccinal dengue viruses which may be used in a method of the present invention include inactivated dengue viruses, live attenuated dengue viruses and live attenuated or inactivated chimeric dengue viruses.
- Serotypes of vaccinal dengue viruses for use in the present invention include serotypes 1 , 2, 3, and 4.
- a vaccinal dengue virus for use in the present invention is a live attenuated chimeric dengue virus.
- inactivated virus refers to a virus that is incapable of replication to any significant degree in cells permissive for replication of the corresponding wild type virus. Viruses may be inactivated by a number of means well known to those skilled in the art. Examples of methods for inactivating a virus include chemical treatments, or radiation treatments (including heat or electromagnetic radiation typically in the forms of X-ray or ultraviolet radiation).
- inactivated dengue virus refers to an inactivated wild- type virus containing all the dengue structural proteins (env, premembrane/membrane and capsid proteins) and inactivated viral RNA.
- An inactivated dengue virus may also refer to an inactivated chimeric dengue virus. Inactivated dengue viruses are for instance described in United States Patent No. 6,254,873.
- live attenuated virus or LAV refers to a virus which is not able to induce a disease state characterised by the same sets of symptoms associated with the corresponding wild-type virus.
- live attenuated viruses are well known in the art.
- a live attenuated virus may be prepared from a wild-type virus, for example, by recombinant DNA technology, site directed mutagenesis, genetic manipulation, serial passages on replication-competent cells, chemical mutagenesis treatment or electromagnetic radiation.
- live attenuated dengue virus refers to a live dengue virus derived from a virulent wild-type dengue virus by genetic modification resulting in attenuation of virulence and an inability to induce a disease state characterised by the same sets of symptoms associated with the corresponding wild type dengue virus.
- Examples of live attenuated dengue viruses useful in the practice of the present invention include VDV-1 , VDV-2, and the strains described for example in applications WO
- Live attenuated dengue viruses of serotype 1 which may be used in the method of the invention include VDV-1 .
- Live attenuated dengue viruses of serotype 2 which may be used in the method of the invention include VDV-2, and LAV-2.
- VDV and "Vero dengue vaccine” are used interchangeably herein and designate a live attenuated dengue virus capable of replication in Vero cells and capable of inducing a specific humoral response, including the induction of neutralizing antibodies, in a human.
- the DEN-1 16007/PDK13 strain also called “LAV1”
- LAV1 is derived from wild-type DEN-1 (dengue virus serotype 1 ) 16007 strain which has undergone 1 1 passages through primary dog kidney (PDK) cells (DEN-1 16007/PDK1 1 ).
- LAV1 has been described in patent application EP1 159968 in the name of Mahidol University and has been filed with the National Microorganisms Cultures Collection (CNCM) under number I-2480.
- VDV-1 is a virus derived from LAV1 by subsequent adaptation to Vero cells; in this regard, the RNA from LAV1 has been extracted and purified before being transfected into Vero cells.
- the VDV-1 strain has subsequently been obtained by plate purification and amplification in Vero cells.
- the VDV-1 strain has 14 additional mutations in comparison with the DEN-1 16007/PDK13 strain (13 passes through PDK cells).
- a process for preparing and characterizing the VDV-1 strain has been described in international patent application filed under number WO06/134433 in the names of Sanofi-Pasteur and the Center for Disease Control and Prevention.
- the DEN-2 16681/PDK53 strain also known as "LAV2”
- LAV2 has been obtained from wild-type strain DEN-2 (dengue virus serotype 2) 16681 which has undergone 50 passes through PDK cells (DEN-2 16681/PDK50).
- LAV2 has been described in in patent application EP1 159968 in the name of Mahidol University and has been filed with the National Microorganisms Cultures Collection (CNCM) under number 1 -2481 .
- VDV-2 is a strain derived from LAV2 by subsequent adaptation to Vero cells; in this regard, the RNA from LAV2 has been extracted and purified before being transfected in Vero cells. The VDV-2 strain has subsequently been obtained by plate purification and amplification in Vero cells.
- the VDV-2 strain has 10 additional mutations in comparison with the DEN-2 16681/PDK53 strain (53 passes through PDK cells), including 4 silent mutations.
- a process for preparing and characterizing the VDV-2 strain has been described in the international patent application filed under number WO06/134443 in the names of Sanofi- Pasteur and the Center for Disease Control and Prevention.
- the complete nucleic acid sequence of the VDV-2 strain is as shown in SEQ ID NO: 24.
- the sequence of the E protein of the VDV-2 strain is as shown in SEQ ID NO: 26 and the sequence of the M protein of the VDV-2 strain is as shown in the SEQ ID NO: 27.
- the VDV 1 and 2 strains are prepared by amplification in Vero cells.
- the viruses produced are harvested and clarified from cell debris by filtration.
- the DNA is digested by treatment with enzymes. Impurities are eliminated by ultrafiltration. Infectious titers may be increased by a concentration method. After adding a stabilizer, the strains are stored in lyophilized or frozen form before use and then reconstituted when needed.
- dengue chimera or chimeric dengue virus means a recipient flavivirus in which the genetic backbone has been modified by exchanging the sequences encoding the prM and E proteins of the recipient flavivirus by the corresponding sequences of a dengue virus.
- the recipient flavivirus may be attenuated.
- the recipient flavivirus may be a yellow fever (YF) virus such as the attenuated YF 17D, YF 17DD and YF 17D204 (YF-VAX®) viruses; in that case, such chimeras are referred to as YF/dengue chimeras.
- YF yellow fever
- the recipient flavivirus may also be a dengue virus and in that case, it is referred to as dengue/dengue chimera, the dengue virus serotype characteristic of the prM and E proteins being identical or different from the recipient dengue virus serotype characteristic of the genetic backbone.
- the serotypes are identical, the recipient dengue virus and the dengue virus from which the prM and E protein encoding sequences originate, are two different virus strains of the same serotype.
- chimeric dengue viruses are typically YF/dengue chimeras. Chimeric dengue viruses are preferably inactivated or live attenuated chimeric dengue viruses.
- the recipient flavivirus of a live attenuated chimeric dengue virus of the present invention is YF 17D or YF 17D204 (YF- VAX®).
- dengue chimera is an inactivated virus.
- the dengue chimera is a live attenuated virus.
- Dengue Chimera that can be used in a vaccine composition of the present invention include ChimerivaxTM Dengue Serotype 1 (also known as CYD-1 ), ChimerivaxTM Dengue Serotype 2 (also known as CYD-2), ChimerivaxTM Dengue Serotype 3 (also known as CYD-3) and ChimerivaxTM Dengue Serotype 4 (also known as CYD-4).
- the chimeric YF/dengue virus comprises the genomic backbone of the attenuated yellow fever virus strain YF17D (Theiler M. and Smith H.H., 1937, J.Exp.Med., 65. 767-786), e.g. viruses YF17D/DEN-1 , YF17D/DEN-2, YF17D/DEN- 3 and YF17D/DEN-4.
- YF17D strains which may be used include YF17D204 (YF-VAX(R), Sanofi-Pasteur, Swiftwater, PA, USA; Stamaril(R), Sanofi-Pasteur, Marcy I'Etoile, France; ARILVAX(TM), Chiron, Speke, Liverpool, UK; FLAVIMUN(R), Berna Biotech, Bern, Switzerland; YF17D-204 France (X15067, X15062); YF17D-204,234 US (Rice et al., 1985, Science, 229: 726-733), or the related strains YF17DD (Genbank access number U17066), YF17D-213 (Genbank access number U17067) and the strains YF17DD described by Galler et al. (1998, Vaccines, 16(9/10): 1024-1028).
- the chimeric YF/dengue virus comprises the genomic backbone of the attenuated yellow fever virus
- a chimeric dengue virus particularly suitable for use in the practice of the present invention is a "Chimerivax dengue virus".
- a “Chimerivax dengue virus” is a live attenuated chimeric YF/dengue virus which comprises the genomic backbone of a YF17D or YF17D204 (YF-VAX®) virus in which the nucleic acid sequences encoding the pre-membrane (prM) and envelope (E) proteins have been replaced by nucleic acid sequences encoding the corresponding structural proteins of a dengue virus.
- a preferred chimeric dengue virus for use in the present invention is a live attenuated chimeric YF/dengue virus which comprises the genomic backbone of a YF17D virus in which the nucleic acid sequences encoding the pre-membrane (prM) and envelope (E) proteins have been replaced by nucleic acid sequences encoding the corresponding structural proteins of a dengue virus.
- a preferred chimeric dengue virus for use in the present invention is a live attenuated chimeric YF/dengue virus which comprises the genomic backbone of a YF17D204 (YF-VAX®) virus in which the nucleic acid sequences encoding the pre-membrane (prM) and envelope (E) proteins have been replaced by nucleic acid sequences encoding the corresponding structural proteins of a dengue virus.
- Construction of such Chimerivax viruses may be achieved in accordance with, or in substantial accordance with, the teaching of Chambers, et al. (1999, J. Virology 73(4):3095-3101 ).
- the particular Chimerivax (CYD) dengue viruses described in the examples have been generated by using prM and E sequences from strains DEN 1 PU0359 (TYP1 140), DEN2 PU0218, DEN3 PaH881/88 and DEN 4 1228 (TVP 980) and the genomic backbone of YF17D virus.
- Those particular Chimerivax strains are referred to herein (see the present examples) as "CYD-1 ", "CYD-2", “CYD-3” and "CYD-4" respectively.
- dengue fever virus strains may be used as a source of nucleic acids to facilitate construction of chimeric viruses useful in the practice of the present invention, for example in the construction of other Chimerivax dengue serotype 1 (CYD-1 ), Chimerivax dengue serotype 2 (CYD-2), Chimerivax dengue serotype 3 (CYD-3) and Chimerivax dengue serotype 4 (CYD-4) strains.
- a vaccine composition of the present invention e.g.
- a chimeric dengue virus, of serotype 2 may comprise prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 as described in the examples or may comprise prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequence shown in SEQ ID NO: 2.
- a vaccine composition e.g.
- a chimeric dengue virus, of serotype 2 for use in the method of the present invention may comprise prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or the prM-E sequence from SEQ ID NO: 2 as described in the examples.
- prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or the prM-E sequence from SEQ ID NO: 2 as described in the examples.
- the recipient genomic backbone of such chimeric dengue viruses is derived from YF-VAX®, such strains are referred to herein as CYD-LAV, CYD-BID, CYD-PR and CYD-MD.
- a vaccine composition of the present invention comprising chimeric dengue virus of serotype 2 generated using the prM-E sequences of the serotype 2 strains LAV-2 (SEQ ID NO: 8), BID-V585 (SEQ ID NO: 9), PR/DB023 (SEQ ID NO: 10), MD1280 (SEQ ID NO: 1 1 ) or SEQ ID NO: 2, or generated using prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023, MD1280 or the prM-E sequence from SEQ ID NO: 2 may advantageously be used in combination with CYD-1 , CYD-3 and CYD-4 in a vaccine composition according to the present invention.
- Examples of chimeric dengue virus of serotype 2 generated using the prM-E sequences of the serotype 2 strains LAV-2 (SEQ ID NO: 8), PR/DB023 (SEQ ID NO: 10) and MD1280 (SEQ ID NO: 1 1 ) include CYD-LAV, CYD-PR and CYD-MD respectively.
- chimeric dengue virus usable in the method of protection of the invention is a recipient flavivirus in which the genetic backbone has been modified by exchanging (i) the sequence encoding the E protein of the recipient flavivirus by the corresponding sequence of a dengue virus and (ii) the sequence encoding the prM protein of the recipient flavivirus by the corresponding sequence of a non-dengue flavivirus, e.g. a JEV virus.
- the said chimeric virus may be a live attenuated virus or an inactivated virus. Examples of such chimeric dengue viruses are described in WO201 1/138586.
- a vaccinal dengue virus of serotype 1 for use in a vaccine composition of the present invention may, for example, be the strain VDV1 , CYD-1 or a YF17D/DEN-1 chimeric virus comprising the prM and E amino acid sequences of the DEN-1 16007/PDK13 strain.
- a vaccinal dengue virus of serotype 2 for use in the method of the present invention may, for example, be the strain VDV2, CYD-2, a YF17D/DEN-2 chimeric virus comprising the prM and E amino acid sequences of the DEN-2 16681/PDK53 strain, a chimeric virus comprising the prM and E amino acid sequences of the DEN-2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or a chimeric virus comprising prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequence in SEQ ID NO: 2.
- a vaccinal dengue virus of serotype 3 for use in the method of present invention may, for example, be CYD-3 or an alternative YF17D/DEN-3 chimeric virus.
- An example of a vaccinal dengue virus of serotype 4 is CYD-4 or an alternative YF17D/DEN- 4 chimeric virus.
- a composition of the present invention comprises at least one dengue antigen.
- a composition of the present invention comprises a dengue antigen, e.g. a vaccinal dengue virus, of each of serotypes 1 , 2, 3 and 4.
- Dengue antigens, e.g. vaccinal dengue viruses, of the present invention of each serotype may be as described herein.
- a composition of the present invention may advantageously comprise any one of the following combinations of dengue antigens: i) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-LAV, a chimeric dengue virus comprising the prM and E amino acid sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4; ii) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-BID, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD- 4; (iii) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of
- composition of the present invention may also advantageously comprise any one of the following combinations of dengue antigens: i) CYD-1 , CYD-LAV, CYD-3 and CYD-4; ii) CYD-1 , CYD-BID, CYD-3 and CYD-4; (iii) CYD-1 , CYD-PR, CYD-3 and CYD-4 or (iv) CYD-1 , CYD-MD, CYD-3 and CYD-4.
- a composition of the present invention may also advantageously comprise the following combination of dengue antigens: i) a dengue antigen comprising the prM and E sequences of CYD-1 , VDV2, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4.
- a composition of the present invention may advantageously comprise CYD-1 , VDV-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a sequence having at least 90% identity to the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- said sequence may be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the prm-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- virus-like particles or VLPs refers to virus particles that do not contain replicative genetic material but present at their surface a dengue E protein in a repetitive ordered array similar to the virion structure.
- dengue VLPs also contain dengue prM and/or M, and E proteins.
- VLPs may be produced in vitro (Zhang et al, J. Virol. (201 1 ) 30 (8):333). VLPs may also be produced in vivo.
- nucleic acid constructs e.g. DNA or RNA constructs
- encoding prM and E dengue proteins may be introduced into a cell of a subject, e.g. a human subject, via methods known in the art, e.g.
- a viral vector via use of a viral vector.
- Any viral vector may be used provided it is able to contain and express both prM and E dengue virus sequences.
- viral vectors that may be used in the method of the present invention include the poxviruses (e.g. the attenuated pox Ankara virus) and the measles virus.
- a particular category of viral vector expressing VLPs in vivo includes replication- deficient pseudoinfectious (PIV) viruses, e.g. according to the ReplivaxTM technology. (Rumyantsev AA, et al. Vaccine. 201 1 Jul 18;29(32):5184-94).
- replication-defective pseudo-infectious virus refers to a virion particle that is replication-defective in vivo, owing to the absence in their genome of an essential sequence of the replicative cycle, for example the sequence encoding a capsid protein. However, the virion particles can propagate in a culture of helper cells that provide for the essential sequence(s) in trans.
- Replication-deficient pseudoinfectious viruses for use in the present invention include any virus according to the above definition which is capable of expressing the prM and E proteins of a dengue virus of any serotype. Examples include replication defective flavivirus / dengue chimeras such as replication defective West Nile virus / dengue, Japanese Encephalitis virus / dengue and YF / dengue chimeras.
- the ability of a vaccine composition of the present invention to provoke an immune response in a subject can be assessed, for example, by measuring the neutralizing antibody titre raised against the dengue virus serotype(s) comprised within the composition.
- the neutralizing antibody titre may be measured by the Plaque Reduction Neutralization Test (PRNT 50 ) test. Briefly, neutralizing antibody titre is measured in sera collected from vaccinated subjects at least 28 days following administration of a vaccine composition of the present invention. Serial, two-fold dilutions of sera (previously heat-inactivated) are mixed with a constant challenge-dose of each dengue virus of serotype 1 , 2, 3 or 4 as appropriate (expressed as PFU/mL).
- the mixtures are inoculated into wells of a microplate with confluent Vero cell monolayers. After adsorption, cell monolayers are incubated for a few days. The presence of dengue virus infected cells is indicated by the formation of infected foci and a reduction in virus infectivity due to the presence of neutralising antibodies in the serum samples can thus be detected.
- the reported value represents the highest dilution of serum at which ⁇ 50 % of dengue challenge virus (in foci counts) is neutralized when compared to the mean viral focus count in the negative control wells (which represents the 100% virus load).
- the end point neutralization titres are presented as continuous values.
- the lower limit of quantification (LLOQ) of the assay is 10 (1/dil).
- CCIDsn refers to the quantity of virus (e.g. vaccinal virus) infecting 50% of the cell culture.
- the CCID 50 assay is a limit dilution assay with statistical titer calculation (Morrison D et al J Infect Dis. 2010; 201(3):370-7)).
- human subject is intended to mean males and females of various ages.
- a human subject according to the present invention is less than 18 years of age or less than 12 years of age.
- a human subject according to the present invention may be 0-17 years of age, 0-1 1 years of age, 4-17 years of age, 4-1 1 years of age, 4-6 years of age, 6-8 years of age, 8-10 years of age, 2-8 years of age, 2-1 1 years of age, 2-14 years of age, 9-16 years of age, 12-17 years of age or 18-45 years of age.
- a human subject according to the present invention is 4-1 1 years of age, 2-14 years of age or 9-16 years of age.
- a human subject according to the present invention may be at least 9 months old or less than 9 months old.
- a human subject according to the present invention may be 9 months to 16 years of age, 9 months to 14 years of age, 9 months to 1 1 years of age or 9 months to 8 years of age.
- a human subject according to the present invention may be at least 9 months old, with no history of severe allergy to any component of the vaccine composition as defined herein, no congenital or acquired immune deficiency, no symptomatic HIV infection and said subject should not be pregnant or breast feeding.
- flavivirus-na ' i ' ve subject refers to a subject who has not been infected by a flavivirus nor previously immunized with a flavivirus vaccine, i.e. a serum sample taken from said subject will produce a negative result in a flavivirus ELISA or PRNT assay.
- dengue-naive subject refers to a subject who has not been infected by a dengue virus nor previously immunized with a dengue vaccine, i.e. a serum sample taken from said subject will produce a negative result in a dengue ELISA or PRNT assay.
- the expression "flavivirus-immune subject” refers to a subject who has been infected or immunized by a flavivirus before administration of the vaccine composition of the invention, i.e. a serum sample taken from said subject will produce a positive result in a flavivirus ELISA or PRNT assay.
- the expression "dengue-immune subject” refers to a subject who has been infected by a dengue virus or immunized by a dengue vaccine before administration of the vaccine composition of the present invention, i.e. a serum sample taken from said subject will produce a positive result in a dengue ELISA or PRNT assay.
- a "method of protecting”, as used herein, results in a reduction in the severity or in the likelihood of developing dengue disease in a human subject exposed to a dengue virus.
- said reduction is statistically significant.
- a method of protecting, according to the present invention may result in a reduction in at least one symptom of dengue disease as defined herein or a reduction in a combination of any two or more of those symptoms.
- the protection may result in any one or more of the following:
- xv a statistically significant reduction in the incidence or likelihood of, e.g. the prevention of, increases in the level of liver enzymes including alanine aminotransferase (ALT) and aspartate aminotransferase (AST);
- a fever i.e. a febrile episode
- haematocrit, thrombocytopenia and hepatic enzyme levels are standard tests well-known to the person of skill in the art, for example as described in the pharmacopea.
- Protection against dengue disease may be demonstrated in respect of dengue disease caused by a particular dengue virus serotype.
- protection against dengue disease may be demonstrated in respect of dengue disease caused by a dengue virus of serotype 1 , a dengue virus of serotype 2, a dengue virus of serotype 3 or a dengue virus of serotype 4.
- dengue disease caused by, for example, dengue virus of serotype 1 or serotype 3, dengue virus of serotype 1 or serotype 4, dengue virus of serotype 3 or serotype 4, dengue virus of serotype 1 or serotype 2, dengue virus of serotype 2 or serotype 3, dengue virus of serotype 2 or serotype 4, dengue virus of serotype 1 , 2 or 3, dengue virus of serotype 1 , 3 or 4, dengue virus of serotype 2, 3 or 4 or dengue virus of serotype 1 , 2, 3 or 4.
- Protection against dengue disease may advantageously be demonstrated in particular sub-groups of human subjects.
- protection against dengue disease may advantageously be demonstrated in a human subject who is less than 18 years of age or less than 12 years of age.
- a human subject according to the present invention may be 0-17 years of age, 0-1 1 years of age, 4-17 years of age, 4-1 1 years of age, 4-6 years of age, 6-8 years of age, 8-10 years of age, 2-8 years of age, 2-1 1 years of age, 2-14 years of age, 9-16 years of age, 12-17 years of age or 18-45 years of age. More preferably, a human subject according to the present invention is 4-1 1 years of age, 2-14 years of age or 9-16 years of age.
- a human subject according to the present invention may be at least 9 months old or less than 9 months old.
- a human subject according to the present invention may be 9 months to 16 years of age, 9 months to 14 years of age, 9 months to 1 1 years of age or 9 months to 8 years of age.
- a human subject according to the present invention may be at least 9 months old, with no history of severe allergy to any component of the vaccine composition as defined herein, no congenital or acquired immune deficiency, no symptomatic HIV infection and said subject should not be pregnant or breast feeding.
- Protection against dengue disease may advantageously be demonstrated in particular countries, areas or regions of the world.
- protection against dengue disease may advantageously be demonstrated in a dengue endemic area.
- a dengue endemic area according to the present invention in which protection may be demonstrated may comprise those American countries or parts thereof which fall within the tropics and sub-tropics.
- a dengue endemic area in which protection may be demonstrated according to the present invention may thus comprise any one or more of the following: Brazil, Venezuela, Colombia, Ecuador, Peru, Venezuela, Paraguay, Panama, Costa Rica, Portugal, Honduras, El Salvador, Guatemala, Caribbean, Mexico, the USA and the islands of the Caribbean.
- a dengue endemic area of the present invention in which protection may be demonstrated may consist of the following: Brazil, Colombia, Honduras, Mexico and Puerto Rico.
- a dengue endemic area in which protection may be demonstrated according to the present invention may also include south Asian and Oceania countries within the tropics and sub-tropics.
- a dengue endemic area according to the present invention in which protection may be demonstrated may thus consist of any one or more of the following: India, Vietnamese (Burma), Thailand, Laos, Vietnam, Cambodia, Indonesia, Malaysia, Singapore, the Philippines, Taiwan, Papua New Guinea and Australia.
- a particular serotype, strain or genotype of wild type dengue virus may be the dominant circulating strain.
- a dengue virus of serotype 2 may be characterised as having an Asian I or an Asian/American genotype.
- Asian/American genotype strains are characterised by at least one of, at least two of, at least three of, at least four of, at least five of or all six of the following residues Arg, Asn, Asp, Thr, Gly and His at positions prM- 16, E-83, E-203, E-226, E-228 and E-346 respectively (wherein prM-16 designates position 16 of the prM protein and E-83 etc. designates position 83 of the E protein).
- Asian I genotype strains are characterised by at least one of, at least two of, at least three of, at least four of, at least five of or all six of the following residues lie, Lys, Asn, Arg, Glu and Tyr at positions prM-16, E-83, E-203, E-226, E-228 and E-346 respectively (see Table 1 of Hang et al., PLoS NTD, 4(7): e757).
- a preferred dengue endemic area in which protection may be demonstrated according to the present invention is one in which a dengue virus having an Asian/American genotype is the dominant circulating strain, i.e.
- a preferred dengue endemic area in which protection may be demonstrated according to the present invention is one in which a dengue virus of any one or more of serotypes 1 , 3 or 4 is/are the dominant circulating serotype(s), i.e. at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or 100% of the cases of dengue disease are caused by dengue virus of serotypes 1 , 3 or 4.
- RNA equivalent of a given DNA sequence refers to a sequence wherein deoxythymidines have been replaced by uridines. Since the DNA sequences in question constitute the cDNA sequences of the dengue viruses, the equivalent RNA sequences constitute the positive strand RNA of those dengue viruses.
- the present inventors have, for the first time, demonstrated the efficacy of a vaccine composition in protecting a human subject against dengue disease.
- the present invention relates to a dengue virus serotype 2 vaccine composition comprising: a dengue antigen selected from the group consisting of:
- VLP dengue virus-like particle
- a nucleic acid construct or viral vector which is able to express in a human cell a dengue antigen which is a dengue VLP; wherein said dengue antigen comprises a polypeptide having at least 90% identity to SEQ ID NO: 12.
- said polypeptide has at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% identity or 100% identity with SEQ ID NO: 12.
- said dengue antigen is selected from the group consisting of a live attenuated dengue virus and a live attenuated or inactivated chimeric dengue virus.
- said dengue antigen is selected from the group consisting of a live attenuated dengue virus and a live attenuated chimeric dengue virus.
- said dengue antigen is a live attenuated chimeric dengue virus.
- said dengue antigen according to the present invention comprises a polypeptide having at least 90% identity to SEQ ID NO: 12, for example at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% identity or 100% identity to SEQ ID NO: 12 over the full length of SEQ ID NO: 12.
- said dengue antigen does not comprise the prM-E sequence of CYD-2, as defined herein.
- said vaccine composition does not comprise CYD-2.
- said dengue antigen comprises a polypeptide which comprises a valine residue at the position within the polypeptide that corresponds to position 251 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a methionine residue at the position within the polypeptide that corresponds to position 6 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a valine residue at the position within the polypeptide that corresponds to position 129 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 129 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 141 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 164 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an aspartate residue at the position within the polypeptide that corresponds to position 203 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an asparagine residue at the position within the polypeptide that corresponds to position 203 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a threonine residue at the position within the polypeptide that corresponds to position 226 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a glycine residue at the position within the polypeptide that corresponds to position 228 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 308 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a valine residue at the position within the polypeptide that corresponds to position 308 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a threonine residue at the position within the polypeptide that corresponds to position 478 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a valine residue at the position within the polypeptide that corresponds to position 484 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 484 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a isoleucine residue at the position within the polypeptide that corresponds to position 485 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a alanine residue at the position within the polypeptide that corresponds to position 491 of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide having at least 90% sequence identity to SEQ ID NO: 3.
- said polypeptide has at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% identity or 100% identity with SEQ ID NO: 3.
- a composition of the present invention comprises a polypeptide having at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% identity or 100% identity with SEQ ID NO: 3.
- a dengue antigen according to the present invention comprises a polypeptide having at least 90% identity to SEQ ID NO: 12, for example at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% identity or 100% identity to SEQ ID NO: 12 over the full length of SEQ ID NO: 12.
- said dengue antigen comprises a polypeptide which comprises a glycine residue at the position within the polypeptide that corresponds to position 15 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises a serine residue at the position within the polypeptide that corresponds to position 15 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises a leucine residue at the position within the polypeptide that corresponds to position 24 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises an isoleucine residue at the position within the polypeptide that corresponds to position 39 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises a methionine residue at the position within the polypeptide that corresponds to position 39 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises a valine residue at the position within the polypeptide that corresponds to position 120 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises an alanine residue at the position within the polypeptide that corresponds to position 120 of SEQ ID NO: 3.
- said dengue antigen comprises a polypeptide which comprises a threonine residue at the position within the polypeptide that corresponds to position 125 of SEQ ID NO: 3.
- the polypeptides as defined herein (as comprised within the dengue antigens as comprised within the vaccine compositions of the present invention) comprise a threonine residue at the position within the polypeptide that corresponds to position 125 of SEQ ID NO: 3 and a valine residue at the position within the polypeptide that corresponds to position 417 of SEQ ID NO: 3.
- the polypeptides which are encoded by the nucleotide sequences as defined herein comprise a leucine residue at the position within the polypeptide that corresponds to position 24 of SEQ ID NO: 3, a threonine residue at the position within the polypeptide that corresponds to position 125 of SEQ ID NO: 3 and a valine residue at the position within the polypeptide that corresponds to position 417 of SEQ ID NO: 3.
- a polypeptide (as comprised within a dengue antigen as comprised within a vaccine composition of the invention) comprises (i) the sequence as set forth in SEQ ID NO: 13 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 13; (ii) the sequence as set forth in SEQ ID NO: 14 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 14; (iii) the sequence as set forth in SEQ ID NO: 15 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 15; (iv) the sequence as set forth in SEQ I D NO: 16 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 16; (v) the sequence as set forth in SEQ ID NO: 18 or a sequence having at least 1 and
- said sequences comprise an amino acid substitution
- said sequences have at least 1 and no more than 4 amino acid substitutions, preferably at least 1 and no more than 3 amino acid substitutions, preferably 1 or 2 amino acid substitutions, preferably 1 amino acid substitution.
- at most two, preferably one preferably none of the substitutions are high impact amino acid substitutions (i.e. achieving a score of > 25 in the impact scoring method disclosed in Example 2); preferably at most three, preferably two, preferably one, preferably none of the substitutions are median impact amino acid substitutions (i.e.
- a dengue antigen comprising said polypeptide leads to a balanced immune response when used in the context of a tetravalent composition.
- a vaccine composition comprising a dengue antigen comprising said polypeptide further comprises a dengue antigen of serotypes 1 , 3 and 4 as defined herein
- said vaccine composition produces a balanced immune response when administered to a mammal, preferably a human.
- said dengue antigen comprises a polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 13; SEQ ID NO: 14, SEQ ID NO: 15 SEQ ID NO: 16; SEQ ID NO: 18 and SEQ ID NO: 26.
- said dengue antigen comprises a polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 13 and SEQ ID NO: 16.
- a dengue antigen (as comprised within a vaccine composition of the invention) comprises a polypeptide comprising: (i) the sequence as set forth in SEQ ID NO: 19 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 19; (ii) the sequence as set forth in SEQ ID NO: 20 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 20; (iii) the sequence as set forth in SEQ ID NO: 21 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 21 ; (iv) the sequence as set forth in SEQ I D NO: 22 or a sequence having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 22; (v) the sequence as set forth in SEQ ID NO: 23 or a sequence having at least 1 and no no
- said sequences comprise an amino acid substitution
- said sequences have at least 1 and no more than 4 amino acid substitutions, preferably at least 1 and no more than 3 amino acid substitutions, preferably 1 or 2 amino acid substitutions, preferably 1 amino acid substitution.
- at most two, preferably one preferably none of the substitutions are high impact amino acid substitutions (i.e. achieving a score of > 25 in the impact scoring method disclosed in Example 2); preferably at most three, preferably two, preferably one, preferably none of the substitutions are median impact amino acid substitutions (i.e.
- a score of >10 to 25 in the impact scoring method disclosed in Example 2 preferably at most five, preferably four, preferably three, preferably two, preferably one, preferably none of the substitutions are low impact amino acid substitutions (i.e. achieving a score of >0 to 10 in the impact scoring method disclosed in Example 2); preferably all said substitutions are no impact amino acid substitutions (i.e. achieving a score of 0 in the impact scoring method disclosed in Example 2).
- said substitutions do not occur at the position within said sequences corresponding to position 125 of SEQ ID NO: 3.
- a dengue antigen comprising said polypeptide leads to a balanced immune response when used in the context of a tetravalent composition.
- a vaccine composition comprising a dengue antigen comprising said polypeptide further comprises a dengue antigen of serotypes 1 , 3 and 4 as defined herein
- said vaccine composition produces a balanced immune response when administered to a mammal, preferably a human.
- a dengue antigen (as comprised within a vaccine composition of the invention) comprises a polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 19; SEQ ID NO: 20, SEQ ID NO: 21 ; SEQ ID NO: 22; SEQ ID NO: 23 and SEQ ID NO: 27.
- a dengue antigen (as comprised within a vaccine composition of the invention) comprises: i) a polypeptide having the sequence as set forth in SEQ ID NO: 13 or a polypeptide having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 13; and a polypeptide having the sequence as set forth in SEQ ID NO: 19 or a polypeptide having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 19; ii) a polypeptide having the sequence as set forth in SEQ ID NO: 14 or a polypeptide having at least 1 and no more than 5 amino acid substitutions with respect to the sequence as set forth in SEQ ID NO: 14; and
- said sequences comprise an amino acid substitution
- said sequences have at least 1 and no more than 4 amino acid substitutions, preferably at least 1 and no more than 3 amino acid substitutions, preferably 1 or 2 amino acid substitutions, preferably 1 amino acid substitution.
- at most two, preferably one preferably none of the substitutions are high impact amino acid substitutions (i.e. achieving a score of >25 in the impact scoring method disclosed in Example 2); preferably at most three, preferably two, preferably one, preferably none of the substitutions are median impact amino acid substitutions (i.e.
- substitutions are low impact amino acid substitutions (i.e. achieving a score of >0 to 10 in the impact scoring method disclosed in Example 2); preferably all said substitutions are no impact amino acid substitutions (i.e. achieving a score of 0 in the impact scoring method disclosed in Example 2).
- substitutions do not occur at the positions within said sequences corresponding to positions 226, 228 and 251 of SEQ ID NO: 12 and the position corresponding to position 125 of SEQ ID NO: 3.
- a dengue antigen comprising said polypeptides leads to a balanced immune response when used in the context of a tetravalent composition.
- a vaccine composition comprising a dengue antigen comprising said polypeptides further comprises a dengue antigen of serotypes 1 , 3 and 4 as defined herein, said vaccine composition produces a balanced immune response when administered to a mammal, preferably a human.
- a dengue antigen (as comprised within a vaccine composition of the invention) comprises: i) a polypeptide of SEQ ID NO: 13 and a polypeptide of SEQ ID NO: 19; ii) a polypeptide of SEQ ID NO: 14 and a polypeptide of SEQ ID NO: 20; iii) a polypeptide of SEQ ID NO: 15 and a polypeptide of SEQ ID NO: 21 ; iv) a polypeptide of SEQ ID NO: 16 and a polypeptide of SEQ ID NO: 22; v) a polypeptide of SEQ ID NO: 18 and a polypeptide of SEQ ID NO: 23 or vi) a polypeptide of SEQ ID NO: 26 and a polypeptide of SEQ ID NO: 27.
- said dengue antigen comprises a polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 8; SEQ ID NO: 9, SEQ I D NO: 10 and SEQ ID NO: 1 1 .
- said dengue antigen comprises a polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 8 and SEQ ID NO: 1 1.
- a composition of the present invention comprises a dengue antigen selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus; or (d) a combination of two or more of (a) to (c); wherein said dengue antigen comprises a nucleotide sequence encoding a polypeptide comprising a polypeptide as defined herein.
- the present invention is also directed to a vaccine composition
- a dengue antigen of serotype 2 selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus; or (d) a combination of two or more of (a) to (c); wherein said dengue antigen comprises a nucleotide sequence having at least 90% sequence identity to a sequence selected from the group consisting of the RNA equivalent of SEQ ID NO: 1 , the RNA equivalent of SEQ ID NO: 4, the RNA equivalent of SEQ ID NO: 5, the RNA equivalent of SEQ ID NO: 6, the RNA equivalent of SEQ ID NO: 7 and SEQ ID NO: 25.
- references to at least 90% sequence identity to the RNA equivalent of SEQ ID NO: 1 , the RNA equivalent of SEQ ID NO: 4, the RNA equivalent of SEQ ID NO: 5, the RNA equivalent of SEQ ID NO: 6, the RNA equivalent of SEQ ID NO: 7 or SEQ ID NO: 25 may preferably be read herein as at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% or 100% sequence identity.
- nucleotide sequences of this embodiment of the invention encode polypeptides comprising one or more amino acid substitutions with respect to the polypeptides encoded by SEQ ID NO: 1 , SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 25, preferably at most two, preferably one preferably none of the substitutions are high impact amino acid substitutions (i.e. achieving a score of >25 in the impact scoring method disclosed in Example 2); preferably at most three, preferably two, preferably one, preferably none of the substitutions are median impact amino acid substitutions (i.e.
- substitutions do not occur at the positions within said polypeptides corresponding to positions 226, 228 and 251 of SEQ ID NO: 12 and the positions within said polypeptides corresponding to positions 24 and 125 of SEQ ID NO: 3.
- the vaccine compositions comprising a dengue antigen of serotype 2 of this embodiment of the invention lead to a balanced immune response when used in the context of a tetravalent composition.
- a dengue antigen of serotype 2 according to this embodiment of the invention further comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 3 and a dengue antigen of serotype 4 as described elsewhere herein.
- a vaccine composition comprising a dengue antigen of serotype 2 according to this embodiment of the invention further comprises a dengue antigen of serotypes 1 , 3 and 4 as defined herein
- said vaccine composition produces a balanced immune response when administered to a mammal, preferably a human.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7, wherein said dengue antigen is not CYD-MD or (ii) a vaccine composition comprising a dengue antigen which is CYD-MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ I D NO: 7, wherein said vaccine composition does not comprise prM-E sequences from MD1280 or (ii) a vaccine composition comprising prM-E sequences from MD1280.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD- MD.
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequences of MD1280 (SEQ ID NO: 1 1 ) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequences of MD1280 (SEQ ID NO: 1 1 ).
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD- MD.
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7, wherein said vaccine composition does not comprise a dengue antigen comprising a polypeptide of SEQ ID NO: 16 and a polypeptide of SEQ ID NO: 22 (or a dengue antigen comprising a nucleotide sequence encoding a protein comprising said polypeptides) or (ii) a vaccine composition comprising a dengue antigen comprising a polypeptide of SEQ ID NO: 16 and a polypeptide of SEQ ID NO: 22 (or a dengue antigen comprising a nucleotide sequence encoding a protein comprising said polypeptides).
- a vaccine composition of the present invention which comprises a dengue antigen of serotype 2 which comprises a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 7 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of MD1280 or (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-MD (SEQ ID NO: 1 1 ).
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said dengue antigen is not CYD-LAV or (ii) a vaccine composition comprising a dengue antigen which is CYD-LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said vaccine composition does not comprise prM-E sequences from LAV2 or (ii) a vaccine composition comprising prM-E sequences from LAV2.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD-LAV.
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequences of LAV2 (SEQ ID NO: 8) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequences of LAV2 (SEQ ID NO: 8).
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-LAV.
- Said vaccine composition is also preferably either (i) a vaccine composition comprising a dengue antigen comprising a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4, wherein said vaccine composition does not comprise a dengue antigen comprising a polypeptide of SEQ ID NO: 13 and a polypeptide of SEQ ID NO: 19 (or a dengue antigen comprising a nucleotide sequence encoding a protein comprising said polypeptides) or (ii) a vaccine composition comprising a dengue antigen comprising a polypeptide of SEQ ID NO: 13 and a polypeptide of SEQ ID NO: 19 (or a dengue antigen comprising a nucleotide sequence encoding a protein comprising said polypeptides).
- a vaccine composition of the present invention which comprises a dengue antigen of serotype 2 which comprises a nucleotide sequence having at least 90% identity to the RNA equivalent of SEQ ID NO: 4 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of LAV2 or (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8).
- the present invention is also directed to a vaccine composition
- a dengue antigen of serotype 2 selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus; or (d) a combination of two or more of (a) to (c); wherein said dengue antigen comprises a nucleotide sequence having at least 1 and no more than 20 nucleotide substitutions with respect to a sequence selected from the group consisting of the RNA equivalent of SEQ ID NO: 1 , the RNA equivalent of SEQ ID NO: 4, the RNA equivalent of SEQ ID NO: 5, the RNA equivalent of SEQ ID NO: 6, the RNA equivalent of SEQ ID NO: 7 and SEQ ID NO: 25.
- nucleotide sequences of this embodiment of the invention encode polypeptides comprising one or more amino acid substitutions with respect to the polypeptides encoded by SEQ ID NO: 1 , SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 25, preferably at most two, preferably one preferably none of the substitutions are high impact amino acid substitutions (i.e. achieving a score of >25 in the impact scoring method disclosed in Example 2); preferably at most three, preferably two, preferably one, preferably none of the substitutions are median impact amino acid substitutions (i.e.
- substitutions do not occur at the positions within said polypeptides corresponding to positions 226, 228 and 251 of SEQ ID NO: 12 and the positions within said polypeptides corresponding to positions 24 and 125 of SEQ ID NO: 3.
- the vaccine compositions comprising a dengue antigen of serotype 2 of this embodiment of the invention lead to a balanced immune response when used in the context of a tetravalent composition.
- a dengue antigen of serotype 2 according to this embodiment of the invention further comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 3 and a dengue antigen of serotype 4 as described elsewhere herein.
- a vaccine composition comprising a dengue antigen of serotype 2 according to this embodiment of the invention further comprises a dengue antigen of serotypes 1 , 3 and 4 as defined herein
- said vaccine composition produces a balanced immune response when administered to a mammal, preferably a human.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 as defined herein which comprises a polypeptide having at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% or 100% identity to SEQ ID NO : 12, wherein said polypeptide comprises an isoleucine residue at the position within the polypeptide that corresponds to position 485 of SEQ ID NO : 12 or an alanine residue at the position within the polypeptide that corresponds to position 491 of SEQ ID NO : 12, said vaccine composition preferably (i) is not CYD-MD; (ii) does not comprise the prM-E sequence from MD1280; (iii) does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequences of MD1280 (SEQ ID NO: 1 1 ); (iv) does not comprise a dengue antigen comprising the prM and E sequences of CYD-MD; (v)
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 as defined herein which comprises a polypeptide having at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, at least 99.5% or 100% identity to SEQ ID NO : 12, wherein said polypeptide comprises a methionine residue at the position within the polypeptide that corresponds to position 6 of SEQ ID NO : 12 or a threonine residue at the position within the polypeptide that corresponds to position 478 of SEQ ID NO : 12, said vaccine composition preferably (i) is not CYD-LAV; (ii) does not comprise the prM-E sequence from LAV2; (iii) does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequences of LAV2 (SEQ ID NO: 8); (iv) does not comprise a dengue antigen comprising the prM and E sequences of CYD-LAV; (v
- said dengue antigen comprises a polypeptide which comprises no more than 1 , no more than 2, no more than 3, no more than 4, no more than 5, nor more than 6, no more than 7, no more than 8, no more than 9, no more than 10, no more than 1 1 or no more than 12 minor amino acid residues, wherein a minor amino acid residue at a given position of a prM-E or E sequence is defined as an amino acid that appears in less than 15% of dengue virus prM-E or E sequences of serotype 2 at that position.
- the dengue disease according to the present invention is virologically- confirmed dengue disease.
- a human subject according to the present invention is less than 18 years of age or less than 12 years of age.
- a human subject according to the present invention may be 0-17 years of age, 0-1 1 years of age, 4-17 years of age, 4-1 1 years of age, 4-6 years of age, 6-8 years of age, 8-10 years of age, 2-8 years of age, 2-1 1 years of age, 2-14 years of age, 9-16 years of age, 12-17 years of age or 18-45 years of age. More preferably, a human subject according to the present invention is 4-1 1 years of age, 2-14 years of age or 9-16 years of age.
- a human subject according to the present invention may be at least 9 months old or less than 9 months old.
- a human subject according to the present invention may be 9 months to 16 years of age, 9 months to 14 years of age, 9 months to 1 1 years of age or 9 months to 8 years of age.
- a human subject according to the present invention may be at least 9 months old, with no history of severe allergy to any component of the vaccine composition as defined herein, no congenital or acquired immune deficiency, no symptomatic HIV infection and said subject should not be pregnant or breast feeding.
- a human subject to which a vaccine composition of the present invention is to be administered is preferably a person at risk of infection, for instance a person travelling in an area where dengue fever is present, i.e. a dengue endemic area, or a resident of such an area.
- a human subject of the present invention resides in a dengue endemic area.
- Dengue endemic areas according to the present invention include most of the tropics and sub-tropics, for instance any country identified as an endemic country by the WHO.
- a dengue endemic area according to the present invention may comprise those American countries or parts thereof which fall within the tropics and sub- tropics.
- a dengue endemic area according to the present invention may thus comprise any one or more of the following: Brazil, Venezuela, Colombia, Ecuador, Peru, Venezuela, Paraguay, Panama, Costa Rica, Portugal, Honduras, El Salvador, Guatemala, Caribbean, Mexico, the USA and the islands of the Caribbean.
- a dengue endemic area of the present invention may consist of the following: Brazil, Colombia, Honduras, Mexico and Puerto Rico.
- a dengue endemic area according to the present invention may also include south Asian and Oceania countries within the tropics and sub- tropics.
- a dengue endemic area according to the present invention may thus consist of any one or more of the following: India, Srima), Thailand, Laos, Vietnam, Cambodia, Indonesia, Malaysia, Singapore, the Philippines, Taiwan, Papua New Guinea and Australia.
- a particular serotype, strain or genotype of wild type dengue virus may be the dominant circulating strain.
- a dengue virus of serotype 2 may be characterised as having an Asian I or an Asian/American genotype.
- Asian/American genotype strains are characterised by at least one of, at least two of, at least three of, at least four of, at least five of or all six of the following residues Arg, Asn, Asp, Thr, Gly and His at positions prM- 16, E-83, E-203, E-226, E-228 and E-346 respectively (wherein prM-16 designates position 16 of the prM protein and E-83 etc. designates position 83 of the E protein).
- Asian I genotype strains are characterised by at least one of, at least two of, at least three of, at least four of, at least five of or all six of the following residues lie, Lys, Asn, Arg, Glu and Tyr at positions prM-16, E-83, E-203, E-226, E-228 and E-346 respectively (see Table 1 of Hang et al., PLoS NTD, 4(7): e757).
- a preferred dengue endemic area according to the present invention is one in which a dengue virus having an Asian/American genotype is the dominant circulating strain, i.e.
- a preferred dengue endemic area according to the present invention is one in which a dengue virus of any one or more of serotypes 1 , 3 or 4 is/are the dominant circulating serotype(s), i.e. at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or 100% of the cases of dengue disease are caused by dengue virus of serotypes 1 , 3 or 4.
- a vaccine composition of the present invention may be administered to a flavivirus immune subject, for example a dengue-immune subject, or a vaccine composition of the present invention may be administered to a flavivirus-na ' i ' ve subject.
- a vaccine composition of the present invention is administered to a flavivirus-immune subject, for example a dengue-immune subject.
- a composition according to the present invention reduces the likelihood or severity of DHF.
- a reduction in the likelihood of DHF i.e. a reduction in the probability of contracting DHF
- a reduction in the severity of DHF may be determined by calculating the number of subjects displaying DHF of each of Grades I, II,
- a composition for use in a method according to the present invention preferably reduces the number of cases of Grade I DHF, the number of cases of Grade II DHF, the number of cases of Grade III DHF and/or the number of cases of Grade
- a composition according to the present invention reduces the incidence or likelihood of symptomatic virologically-confirmed dengue disease.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the incidence or likelihood of symptomatic virologically- confirmed dengue disease caused by dengue virus of serotypes 1 , 3 or 4.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the incidence or likelihood of symptomatic virologically- confirmed dengue disease caused by dengue virus of serotypes 1 , 3 or 4.
- a composition according to the present invention e.g.
- a composition for use in a method according to the present invention reduces the incidence or likelihood of symptomatic virologically-confirmed dengue disease caused by dengue virus of serotypes 1 , 2, 3 or 4.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the rate of hospitalization due to virologically-confirmed dengue disease, i.e. reduces the incidence of hospitalized virologically-confirmed dengue disease.
- a composition according to the present invention e.g.
- composition for use in a method according to the present invention reduces the rate of hospitalization due to virologically-confirmed dengue disease caused by dengue virus of serotypes 1 , 3 or 4, i.e. reduces the incidence of hospitalized virologically-confirmed dengue disease caused by dengue virus of serotypes 1 , 3 or 4.
- a composition according to the present invention reduces the incidence or likelihood of dengue disease.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the incidence or likelihood of dengue disease caused by dengue virus of serotypes 1 , 3 or 4.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the incidence or likelihood of dengue disease caused by dengue virus of serotypes 1 , 2, 3 or 4.
- a composition according to the present invention e.g.
- a composition for use in a method according to the present invention reduces the rate of hospitalization due to dengue disease, i.e. reduces the incidence of hospitalized dengue disease.
- a composition according to the present invention e.g. a composition for use in a method according to the present invention, reduces the rate of hospitalization due to dengue disease caused by dengue virus of serotypes 1 , 3 or 4, i.e. reduces the incidence of hospitalized dengue disease caused by dengue virus of serotypes 1 , 3 or 4.
- a vaccine composition according to the present invention may be administered in multiple doses. Doses of a vaccine composition according to the present invention may be administered in an initial vaccination regimen followed by booster vaccinations. For example, a vaccine composition according to the present invention may be administered in one, two or three doses or more than three doses, e.g. four doses. Preferably, the first dose and the third dose are to be administered approximately twelve months apart. For example, an initial vaccination regimen according to the present invention is administered in three doses, wherein the first and third doses of said vaccination regimen are to be administered approximately twelve months apart.
- a vaccine composition according to the present invention is to be administered in a first dose, a second dose and a third dose.
- said first dose and said third dose may be administered approximately twelve months apart.
- a vaccine composition of the present invention may be administered in a first dose, a second dose and a third dose, wherein said second dose is to be administered about six months after said first dose and wherein said third dose is to be administered about twelve months after said first dose.
- the three doses may be administered at zero months, at about three to four months (e.g. at about three-and-a-half months) and at about twelve months (i.e. a regimen wherein the second dose of the composition is administered at about three-and-a-half months after the first dose, and wherein the third dose of the composition is administered at about twelve months after the first dose).
- a vaccine composition according to the present invention may be administered in two doses.
- the first dose and the second dose are to be administered approximately about six to twelve months after the first dose months apart.
- the second dose is to be administered at eight months after the first dose.
- the second dose is administered at about eight-and-a-half to nine months after the first dose.
- a vaccine composition according to the present invention may be administered in a single dose.
- Dengue disease may be caused by any one of two serotypes of a dengue virus.
- dengue disease is preferably caused by a dengue virus of serotype 1 or serotype 3, a dengue virus of serotype 1 or serotype 4, a dengue virus of serotype 3 or serotype 4, a dengue virus of serotype 1 or serotype 2, a dengue virus of serotype 2 or serotype 3, a dengue virus of serotype 2 or serotype 4.
- Dengue disease as defined herein, is preferably caused by any one of three serotypes of a dengue virus.
- dengue disease is preferably caused by a dengue virus of serotype 1 , 2 or 3, a dengue virus of serotype 1 , 3 or 4, a dengue virus of serotype 1 , 2 or 4, a dengue virus of serotype 2, 3 or 4.
- dengue disease is caused by a dengue virus of serotype 1 , a dengue virus of serotype 2, a dengue virus of serotype 3 or a dengue virus of serotype 4.
- a vaccine composition according to the present invention e.g. for use in a method according to the present invention preferably comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4.
- a composition may be described herein as a tetravalent composition.
- a composition of the present invention e.g.
- dengue antigens of serotypes 1 , 2, 3 and 4 may advantageously comprise any one of the following combinations of dengue antigens of serotypes 1 , 2, 3 and 4: i) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-LAV, a chimeric dengue virus comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4; ii) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-BID, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4; (iii) a dengue antigen comprising the prM and E sequences of CYD-1
- composition of the present invention may also advantageously comprise any one of the following combinations of dengue antigens: i) CYD-1 , CYD-LAV, CYD-3 and CYD-4; ii) CYD-1 , CYD-BID, CYD-3 and CYD-4; (iii) CYD-1 , CYD-PR, CYD-3 and CYD-4 or (iv) CYD-1 , CYD-MD, CYD-3 and CYD-4.
- a composition of the present invention may also advantageously comprise the following combination of dengue antigens: i) a dengue antigen comprising the prM and E sequences of CYD-1 , VDV2, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4.
- a composition of the present invention may advantageously comprise CYD-1 , VDV-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a sequence having at least 90% identity to the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- said sequence may be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the prm-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a vaccine composition according to the present invention preferably comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4.
- a composition may be described herein as a tetravalent composition.
- a composition of the present invention e.g.
- dengue antigens of serotypes 1 , 2, 3 and 4 may advantageously comprise any one of the following combinations of dengue antigens of serotypes 1 , 2, 3 and 4: i) a dengue antigen comprising the M and E sequences of CYD-1 , a dengue antigen comprising the M and E sequences of CYD-LAV, a chimeric dengue virus comprising the M and E sequences of CYD-3 and a dengue antigen comprising the M and E sequences of CYD-4; ii) a dengue antigen comprising the M and E sequences of CYD-1 , a dengue antigen comprising the M and E sequences of CYD-BID, a dengue antigen comprising the M and E sequences of CYD-3 and a dengue antigen comprising the M and E sequences of CYD-4; (iii) a dengue antigen comprising the M and E sequences of CYD-1 , a dengue antigen compris
- composition of the present invention may also advantageously comprise any one of the following combinations of dengue antigens: i) CYD-1 , CYD-LAV, CYD-3 and CYD-4; ii) CYD-1 , CYD-BID, CYD-3 and CYD-4; (iii) CYD-1 , CYD-PR, CYD-3 and CYD-4 or (iv) CYD-1 , CYD-MD, CYD-3 and CYD-4.
- a composition of the present invention may also advantageously comprise the following combination of dengue antigens: i) a dengue antigen comprising the M and E sequences of CYD-1 , VDV2, a dengue antigen comprising the M and E sequences of CYD-3 and a dengue antigen comprising the M and E sequences of CYD-4.
- a composition of the present invention may advantageously comprise CYD-1 , VDV-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises the E sequence of CYD-LAV (SEQ ID NO: 13), CYD-BID (SEQ ID NO: 14), CYD-PR (SEQ ID NO: 15) CYD-MD (SEQ ID NO: 16) or SEQ ID NO: 18.
- a composition of the present invention which comprises a dengue antigen comprising the sequence as set forth in SEQ ID NO: 18 is not a vaccine composition of serotype 2 comprising the prM-E sequence from SEQ ID NO: 2.
- a composition of the present invention is either a composition comprising a dengue antigen comprising the sequence as set forth in SEQ ID NO: 18, wherein said composition is not a vaccine composition of the present invention comprising chimeric dengue virus of serotype 2 generated using the prM-E sequence of SEQ ID NO: 2, or it is a composition comprising chimeric dengue virus of serotype 2 generated using the prM-E sequence of SEQ ID NO: 2.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a sequence having at least 90% identity to the E sequence of CYD-LAV (SEQ ID NO: 13), CYD-BID (SEQ ID NO: 14), CYD-PR (SEQ ID NO: 15) CYD-MD (SEQ ID NO: 16) or SEQ ID NO: 18.
- said sequence may be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the E sequence of CYD-LAV (SEQ ID NO: 13), CYD-BID (SEQ ID NO: 14), CYD-PR (SEQ ID NO: 15) CYD-MD (SEQ ID NO: 16) or SEQ ID NO: 18.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a polypeptide selected from the group consisting of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22 or SEQ ID NO: 23.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 19
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise CYD-LAV or (ii) a vaccine composition comprising CYD-LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD- LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of LAV-2 or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of LAV-2 (SEQ ID NO: 8).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 19 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of LAV-2; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ I D NO: 8) or (iii) a dengue antigen comprising the prM-E sequence from LAV-2.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 21
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise CYD-PR or (ii) a vaccine composition comprising CYD- PR.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-PR or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-PR.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of PR/DB023 (SEQ ID NO: 10) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of PR/DB023 (SEQ ID NO: 10).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 21 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of PR/DB023; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-PR (SEQ ID NO: 10) or (iii) a dengue antigen comprising the prM-E sequence from PR/DB023.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO:
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise CYD-MD or (ii) a vaccine composition comprising CYD-MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD- MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD-MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of MD1280 (SEQ ID NO: 1 1 ) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of MD1280 (SEQ ID NO: 1 1 ).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 22 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of MD1280; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-MD (SEQ ID NO: 1 1 ) or (iii) a dengue antigen comprising the prM-E sequence from MD1280.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO:
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 23, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence SEQ ID NO: 2 or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of SEQ ID NO: 2.
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 23 does not comprise: (i) a dengue antigen of serotype 2 which comprises SEQ ID NO: 2 or (ii) a dengue antigen comprising the prM-E sequence from SEQ ID NO: 2.
- a dengue antigen of serotype 2 of the present invention further comprises a polypeptide selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 or SEQ ID NO: 18.
- said dengue antigen of serotype 2 preferably comprises: i) a polypeptide of SEQ ID NO: 13 and a polypeptide of SEQ ID NO: 19; ii) a polypeptide of SEQ ID NO: 14 and a polypeptide of SEQ ID NO: 20; iii) a polypeptide of SEQ ID NO: 15 and a polypeptide of SEQ ID NO: 21 ; iv) a polypeptide of SEQ ID NO: 16 and a polypeptide of SEQ ID NO: 22; or v) a polypeptide of SEQ ID NO: 18 and a polypeptide of SEQ ID NO: 23.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19, said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise CYD-LAV or (ii) a vaccine composition comprising CYD-LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-LAV or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD- LAV.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of LAV-2 or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of LAV-2 (SEQ ID NO: 8).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 13 and a polypeptide having the sequence of SEQ ID NO: 19 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of LAV-2; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8) or (iii) a dengue antigen comprising the prM-E sequence from LAV-2.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 15 and a polypeptide having the sequence of SEQ ID NO: 21
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 15 and a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise CYD-PR or (ii) a vaccine composition comprising CYD-PR.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen a polypeptide having the sequence of SEQ ID NO: 15 and comprising a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-PR or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-PR.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 15 and a polypeptide having the sequence of SEQ ID NO: 21 , wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of PR/DB023 (SEQ ID NO: 10) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of PR/DB023 (SEQ ID NO: 10).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 15 and a polypeptide having the sequence of SEQ ID NO: 21 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of PR/DB023; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-PR (SEQ ID NO: 10) or (iii) a dengue antigen comprising the prM-E sequence from PR/DB023.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 16 and a polypeptide having the sequence of SEQ ID NO: 22, said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 16 and a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise CYD-MD or (ii) a vaccine composition comprising CYD-MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a polypeptide having the sequence of SEQ ID NO: 16 and a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a dengue antigen comprising the prM and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the prM and E sequences of CYD-MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 16 and a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a dengue antigen comprising the M and E sequences of CYD-MD or (ii) a vaccine composition comprising a dengue antigen comprising the M and E sequences of CYD- MD.
- Said vaccine composition is also preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 16 and a polypeptide having the sequence of SEQ ID NO: 22, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of MD1280 (SEQ ID NO: 1 1 ) or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of MD1280 (SEQ ID NO: 1 1 ).
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 16 and a polypeptide having the sequence of SEQ ID NO: 22 does not comprise: (i) a chimeric virus comprising the prM and E amino acid sequences of MD1280; (ii) a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-MD (SEQ ID NO: 1 1 ) or (iii) a dengue antigen comprising the prM-E sequence from MD1280.
- a vaccine composition of the present invention comprises a dengue antigen of serotype 2 which comprises a polypeptide having the sequence of SEQ ID NO: 18 and a polypeptide having the sequence of SEQ ID NO: 23
- said vaccine composition is preferably either: (i) a vaccine composition comprising a dengue antigen comprising a polypeptide having the sequence of SEQ ID NO: 18 and a polypeptide having the sequence of SEQ ID NO: 23, wherein said vaccine composition does not comprise a chimeric dengue virus of serotype 2 generated using the prM-E sequence of SEQ ID NO: 2 or (ii) a vaccine composition comprising a chimeric dengue virus of serotype 2 generated using the prM-E sequence of SEQ ID NO: 2.
- a vaccine composition of the present invention which comprises a polypeptide having the sequence of SEQ ID NO: 18 and a polypeptide having the sequence of SEQ ID NO: 23 does not comprise: (i) a dengue antigen of serotype 2 which comprises SEQ ID NO: 2 or (ii) a dengue antigen comprising the prM-E sequence from SEQ ID NO: 2.
- a composition of the present invention, as described herein e.g. a tetravalent formulation, e.g.
- a dengue antigen of serotype 2 which comprises a polypeptide having at least 90% identity to SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22 or SEQ ID NO: 23.
- said dengue antigen of serotype 2 further comprises a polypeptide having at least 90% identity to SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 or SEQ ID NO: 18.
- said dengue antigen of serotype 2 preferably comprises: i) a polypeptide having at least 90% sequence identity to SEQ ID NO: 13 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 19; ii) a polypeptide having at least 90% sequence identity to SEQ ID NO: 14 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 20; iii) a polypeptide having at least 90% sequence identity to SEQ ID NO: 15 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 21 ; iv) a polypeptide having at least 90% sequence identity to SEQ ID NO: 16 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 22; or v) a polypeptide having at least 90% sequence identity to SEQ ID NO: 18 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 23.
- references herein to at least 90% identity may be read as at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the given sequence.
- the dengue antigens of serotype 2 as described in the preceding paragraphs may advantageously be combined with any of the dengue antigens of serotypes 1 , 3 and 4 as described elsewhere herein to form a tetravalent formulation comprising a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4.
- the dengue antigens of serotypes 1 , 3 and 4 may each be independently selected from the group consisting of a live attenuated dengue virus, an inactivated dengue virus, a live attenuated or inactivated chimeric dengue virus or a dengue virus-like particle (VLP).
- said dengue antigens of serotype 1 , 3 and 4 are each independently selected from the group consisting of a live attenuated dengue virus and a live attenuated chimeric dengue virus.
- said dengue antigens of serotypes 1 , 3 and 4 are live attenuated chimeric dengue viruses of serotypes 1 , 3 and 4 respectively.
- said live attenuated chimeric dengue viruses of serotypes 1 , 3 and 4 each comprise one or more proteins from a dengue virus and one or more proteins from a different flavivirus.
- each of said live attenuated chimeric dengue viruses of serotypes 1 , 3 and 4 is advantageously a YF/Dengue chimera.
- said dengue antigens of serotypes 1 , 3 and 4 are each a live attenuated chimeric dengue virus in which the genetic backbone of a recipient flavivirus has been modified by exchanging the sequences encoding the prM and E proteins of the recipient flavivirus with the corresponding sequences of a dengue virus.
- said recipient flavivirus is a yellow fever virus.
- said live attenuated chimeric dengue viruses of serotypes 1 , 3 and 4 are respectively a Chimerivax dengue serotype 1 strain (i.e. a CYD-1 strain), a
- Chimerivax dengue serotype 3 strain i.e. a CYD-3 strain
- Chimerivax dengue serotype 4 strain i.e. a CYD-4 strain
- It is an aim of the present inventors to provide an optimized tetravalent dengue vaccine composition i.e. vaccine composition comprising a dengue antigen of each of serotypes 1 , 2, 3 and 4) which provides an improved neutralising antibody response against dengue virus of serotype 2 when compared with the neutralising antibody response generated by CYD-1 , CYD-2, CYD-3 and CYD-4 as defined in Example 1.
- the present invention advantageously provides a vaccine composition which comprises a dengue antigen of each of serotypes 1 , 2, 3 and 4, wherein said dengue antigens of serotypes 1 , 3 and 4 are each a live attenuated chimeric dengue virus and said dengue antigen of serotype 2 is a live attenuated dengue virus which comprises a nucleic acid sequence having at least 90% sequence identity to the sequence as set forth in SEQ ID NO: 24.
- the present invention advantageously provides a vaccine composition which comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4, wherein:
- said dengue antigen of serotype 1 is a YF/dengue chimeric dengue virus (i.e. a recipient yellow fever virus in which the genetic backbone of the YF virus has been modified by exchanging the sequences encoding the prM and E proteins of the YF virus by the corresponding sequences of a dengue serotype 1 virus);
- said dengue antigen of serotype 2 is a live attenuated dengue virus of serotype 2 which comprises a nucleic acid sequence having at least 90% sequence identity to the sequence as set forth in SEQ ID NO: 24;
- said dengue antigen of serotype 3 is a YF/dengue chimeric dengue virus (i.e. a recipient yellow fever virus in which the genetic backbone of the YF virus has been modified by exchanging the sequences encoding the prM and E proteins of the YF virus by the corresponding sequences of a dengue serotype 3 virus) and
- said dengue antigen of serotype 4 is a YF/dengue chimeric dengue virus (i.e. a recipient yellow fever virus in which the genetic backbone of the YF virus has been modified by exchanging the sequences encoding the prM and E proteins of the YF virus by the corresponding sequences of a dengue serotype 4 virus).
- said recipient YF virus (which forms the genetic backbone of the YF/dengue chimeric viruses of serotypes 1 , 3 and 4) is an attenuated YF virus.
- said recipient YF virus may be an attenuated YF virus selected from the group consisting of YF 17D, YF 17DD and YF 17D204.
- the YF/dengue chimeric viruses of serotypes 1 , 3 and 4 are respectively a Chimerivax dengue serotype 1 (i.e. a CYD-1 ), a Chimerivax dengue serotype 3 (i.e. a CYD-3) and a Chimerivax dengue serotype 4 (i.e. a CYD-4).
- a Chimerivax dengue serotype 1 i.e. a CYD-1
- a Chimerivax dengue serotype 3 i.e. a CYD-3
- a Chimerivax dengue serotype 4 i.e. a CYD-4
- a reference herein to a nucleic acid sequence having at least 90% sequence identity to the sequence as set forth in SEQ ID NO: 24 may preferably be read as a nucleic acid sequence having at least 92%, at least 94%, at least 96%, at least 98%, at least 99% or 100% sequence identity to the sequence as set forth in SEQ ID NO: 24.
- nucleotides at the positions within said nucleic acid sequences which correspond to positions 736, 1619, 4723, 5062, 9191 , 10063, 10507, 57, 524, 2055, 2579, 4018, 5547, 6599 and 8571 of SEQ ID NO: 24 are not mutated.
- a dengue antigen of serotype 2 which is a live attenuated dengue virus for use in a composition of the present invention (for example for use in combination with a dengue antigen of serotypes 1 , 3 and 4 as described above and elsewhere herein (e.g.
- dengue antigens of serotypes 1 , 3 and 4 which are live attenuated chimeric dengue viruses, e.g. YF/dengue chimeric dengue viruses)) is a live attenuated dengue virus which comprises a nucleic acid sequence having 100% sequence identity to the sequence as set forth in SEQ ID NO: 24 or a live attenuated dengue virus which comprises at least one and no more than 20 nucleotide substitutions when compared with the sequence as set forth in SEQ ID NO: 24.
- said live attenuated dengue virus comprises at least one and no more than 15, 14, 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3 or 2 nucleotide substitutions when compared with the sequence as set forth in SEQ ID NO: 24.
- the nucleotides at the positions within said nucleic acid sequences which correspond to positions 736, 1619, 4723, 5062, 9191 , 10063, 10507, 57, 524, 2055, 2579, 4018, 5547, 6599 and 8571 of SEQ ID NO: 24 are not mutated.
- said live attenuated dengue virus of serotype 2 comprises a nucleic acid sequence that has no more than 15 or even no more than 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 base mutations, deletions or insertions when compared with the sequence as set forth in SEQ ID NO: 24.
- nucleotides at the positions within said nucleic acid sequence that correspond to positions 736, 1619, 4723, 5062, 9191 , 10063, 10507, 57, 524, 2055, 2579, 4018, 5547, 6599 and 8571 of SEQ ID NO: 24 are not mutated.
- a dengue antigen of serotype 2 for use in a vaccine composition of the present invention e.g. a dengue antigen which is a live attenuated dengue virus or a live attenuated chimeric dengue virus of serotype 2
- a dengue antigen of serotype 2 for use in a vaccine composition of the present invention is capable of inducing neutralizing antibodies in humans and is capable of inducing a balanced immune response when used in the context of a tetravalent dengue vaccine composition.
- a dengue antigen of serotype 2 for use in a vaccine composition of the present invention e.g.
- a dengue antigen which is a live attenuated dengue virus or a live attenuated chimeric dengue virus of serotype 2) for use in a vaccine composition of the invention results in low or absent viremia in humans.
- a dengue antigen of serotype 2 for use in a tetravalent vaccine composition of the present invention e.g. a dengue antigen which is a live attenuated dengue virus or a live attenuated chimeric dengue virus of serotype 2 provides an improved neutralising antibody response against dengue virus of serotype 2 when compared with the neutralising antibody response generated by CYD-1 , CYD-2, CYD-3 and CYD-4 as defined in Example 1.
- a composition for use in the present invention comprises a dengue antigen of each of serotypes 1 , 2, 3 and 4, wherein: (i) said dengue antigen of serotype 1 is a live attenuated chimeric dengue virus other than CYD-1 or said dengue antigen of serotype 1 is CYD-1 ; (ii) said dengue antigen of serotype 2 is a live attenuated dengue virus other than VDV-2 or said dengue antigen of serotype 2 is VDV-2; (iii) said dengue antigen of serotype 3 is a live attenuated chimeric dengue virus other than CYD-3 or said dengue antigen of serotype 3 is CYD-3 and (iv) said dengue antigen of serotype 4 is a live attenuated chimeric dengue virus other than CYD-4 or said dengue antigen of serotype 4 is CYD-4.
- the VDV-2 strain is the strain derived from the DEN-2 16681/PDK53 strain (LAV2) by subsequent adaptation to Vero cells, wherein said VDV-2 strain has 10 additional mutations in comparison with the DEN-2 16681/PDK53 strain including four silent mutations.
- a composition for use in the present invention comprises a dengue antigen of each of serotypes 1 , 2, 3 and 4, wherein said dengue antigens of serotypes 1 , 3 and 4 are each a live attenuated chimeric dengue virus and said dengue antigen of serotype 2 is a live attenuated dengue virus which comprises a nucleic acid sequence having at least 90% sequence identity to the sequence as set forth in SEQ ID NO: 24 and wherein said dengue antigens of serotypes 1 , 2, 3 and 4 are not CYD-1 , VDV- 2, CYD-3 and CYD-4 respectively or a dengue antigen comprising the M and E sequences of CYD-1 , VDV2, a dengue antigen comprising the M and E sequences of CYD-3 and a dengue antigen comprising the M and E sequences of CYD-4 respectively.
- a composition for use in the present invention comprises a dengue antigen of each of serotypes 1 , 2, 3 and 4, wherein: (i) said dengue antigen of serotype 1 is a live attenuated chimeric dengue virus other than CYD-1 or said dengue antigen of serotype 1 is CYD-1 ; (ii) said dengue antigen of serotype 2 is a live attenuated dengue virus other than VDV-2 or said dengue antigen of serotype 2 is VDV-2; (iii) said dengue antigen of serotype 3 is a live attenuated chimeric dengue virus other than CYD-3 or said dengue antigen of serotype 3 is CYD-3 and (iv) said dengue antigen of serotype 4 is a live attenuated chimeric dengue virus other than CYD-4 or said dengue antigen of serotype 4 is CYD-4.
- the VDV-2 strain is the strain comprising the nucleic acid
- a preferred vaccine composition according to the present invention e.g. for use in a method according to the present invention, comprises a dengue antigen of serotype 1 , a dengue antigen of serotype 2, a dengue antigen of serotype 3 and a dengue antigen of serotype 4, wherein:
- said dengue antigen of serotype 1 is a YF/dengue chimeric dengue virus other than a CYD-1 or said dengue antigen of serotype 1 is a CYD-1 ;
- said dengue antigen of serotype 2 is a live attenuated dengue virus of serotype
- said dengue antigen of serotype 2 is not a live attenuated dengue virus of serotype 2 which comprises a nucleic acid sequence having 100% sequence identity to the sequence as set forth in SEQ ID NO: 24 or said dengue antigen of serotype 2 is a live attenuated dengue virus of serotype 2 which comprises a nucleic acid sequence having 100% sequence identity to the sequence as set forth in SEQ ID NO: 24;
- said dengue antigen of serotype 3 is a YF/dengue chimeric dengue virus other than a CYD-3 or said dengue antigen of serotype 3 is a CYD-3;
- said dengue antigen of serotype 4 is a YF/dengue chimeric dengue virus other than a CYD-4 or said dengue antigen of serotype 4 is a CYD-4.
- a dengue antigen of serotype 2 which is a live attenuated chimeric dengue virus for use in a vaccine composition of the present invention (for example for use in combination with a dengue antigen of serotypes 1 , 3 and 4 as described above and elsewhere herein (e.g. dengue antigens of serotypes 1 , 3 and 4 which are YF/dengue chimeric dengue viruses)) comprises a nucleic acid sequence having at least 90% identity to the sequence as set forth in SEQ ID NO: 25.
- said nucleic acid sequence has at least 92%, at least 94%, at least 96%, at least 98%, at least 99% or 100% sequence identity to the sequence as set forth in SEQ ID NO: 25.
- nucleotides at the positions within said nucleic acid sequence which correspond to positions 524, 736, 1619 and 2055 of SEQ I D NO: 24 are not mutated (i.e. maintain the nucleotide appearing in SEQ ID NO: 24 at those positions).
- a dengue antigen of serotype 2 which is a chimeric dengue virus for use in a vaccine composition of the present invention (for example for use in combination with a dengue antigen of serotypes 1 , 3 and 4 as described above and elsewhere herein (e.g. dengue antigens of serotypes 1 , 3 and 4 which are YF/dengue chimeric dengue viruses)) comprises a prM-E sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% identity to the prM-E sequence from the LAV-2 strain (i.e. the RNA equivalent of SEQ ID NO: 4).
- nucleotides at the positions within said prM-E sequence which correspond to positions 524, 736, 1619 and 2055 of the RNA equivalent of SEQ ID NO: 24 are not mutated (i.e. maintain the nucleotide appearing in the RNA equivalent of SEQ ID NO: 24 at those positions).
- a dengue antigen of serotype 2 which is a chimeric dengue virus for use in a vaccine composition of the present invention (for example for use in combination with a dengue antigen of serotypes 1 , 3 and 4 as described above and elsewhere herein (e.g. dengue antigens of serotypes 1 , 3 and 4 which are YF/dengue chimeric dengue viruses)) comprises a prM-E sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% identity to the prM-E sequence from the MD1280 strain (i.e. the RNA equivalent of SEQ ID NO: 7).
- a composition of the present invention may advantageously comprise a dengue antigen selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus and (d) a combination of two or more of (a) to (c), wherein said dengue antigen comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 1 .
- a composition of the present invention may advantageously comprise a dengue antigen selected from the group consisting of: (a) a live attenuated dengue virus; (b) an inactivated dengue virus; (c) a live attenuated or inactivated chimeric dengue virus and (d) a combination of two or more of (a) to (c), wherein said dengue antigen comprises a nucleotide sequence encoding M and E sequences as described herein.
- a composition of the present invention e.g.
- a method of protecting according to the present invention may advantageously comprise any one of the following combinations of dengue antigens of serotypes 1 , 2, 3 and 4: i) CYD-1 , CYD- LAV, CYD-3 and CYD-4; ii) CYD-1 , CYD-BID, CYD-3 and CYD-4; (iii) CYD-1 , CYD-PR, CYD-3 and CYD-4 or (iv) CYD-1 , CYD-MD, CYD-3 and CYD-4.
- a composition of the present invention may also advantageously comprise the following combination of dengue antigens: i) a dengue antigen comprising the prM and E sequences of CYD-1 , VDV2, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4.
- a composition of the present invention may advantageously comprise CYD-1 , VDV-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a sequence having at least 90% identity to the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD- BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- said sequence may be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the prm-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a vaccine composition for use the present invention e.g. for use in a method according to the present invention preferably comprises a dengue antigen which is a vaccinal dengue virus.
- vaccinal dengue viruses include, for example, inactivated viruses, live attenuated viruses and live attenuated chimeric dengue viruses.
- the vaccinal dengue viruses are live attenuated chimeric dengue viruses.
- a live attenuated chimeric dengue virus according to the present invention comprises one or more proteins from a dengue virus and one or more proteins from a different flavivirus.
- said different flavivirus is a yellow fever virus, for example a yellow fever virus of strain YF 17D.
- a chimeric dengue virus according to the present invention comprises the prM-E amino acid sequences of a dengue virus, for example a chimeric dengue virus according to the present invention comprises a yellow fever virus genome whose prM-E whose prM-E sequence has been substituted with the prM-E sequence of a dengue virus.
- a vaccine composition according to the present invention e.g. for use in a method of the present invention, comprises CYD-1 , CYD-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise any one of the following combinations of dengue antigens i) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-LAV, a chimeric dengue virus comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4; ii) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-BID, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4; (iii) a dengue antigen comprising the prM and E sequences of CYD-1 , a dengue antigen comprising the prM and E sequences of CYD-PR,
- composition of the present invention may also advantageously comprise any one of the following combinations of dengue antigens: i) CYD-1 , CYD-LAV, CYD-3 and CYD-4; ii) CYD-1 , CYD-BID, CYD-3 and CYD-4; (iii) CYD-1 , CYD-PR, CYD-3 and CYD-4 or (iv) CYD-1 , CYD-MD, CYD-3 and CYD-4.
- a composition of the present invention may also advantageously comprise the following combination of dengue antigens: i) a dengue antigen comprising the prM and E sequences of CYD-1 , VDV2, a dengue antigen comprising the prM and E sequences of CYD-3 and a dengue antigen comprising the prM and E sequences of CYD-4.
- a composition of the present invention may advantageously comprise CYD-1 , VDV-2, CYD-3 and CYD-4.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- a vaccine composition of the present invention e.g.
- a chimeric dengue virus, of serotype 2 may comprise prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 as described in the examples or may comprise prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequence shown in SEQ ID NO: 2.
- a vaccine composition e.g.
- a chimeric dengue virus, of serotype 2 for use in the method of the present invention may comprise prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or the prM-E sequence from SEQ ID NO: 2 as described in the examples.
- prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023 or MD1280 or the prM-E sequence from SEQ ID NO: 2 as described in the examples.
- the recipient genomic backbone of such chimeric dengue viruses is derived from YF-VAX®, such strains are referred to herein as CYD-LAV, CYD-BID, CYD-PR and CYD-MD.
- a vaccine composition of the present invention comprising chimeric dengue virus of serotype 2 generated using the prM-E sequences of the serotype 2 strains LAV-2 (SEQ ID NO: 8), BID-V585 (SEQ ID NO: 9), PR/DB023 (SEQ ID NO: 10), MD1280 (SEQ ID NO: 1 1 ) or SEQ ID NO: 2, or generated using prM-E sequences having at least 90%, at least 95%, at least 98% or at least 99% identity to the prM-E sequences from the serotype 2 strains LAV-2, BID-V585, PR/DB023, MD1280 or the prM-E sequence from SEQ ID NO: 2 may advantageously be used in combination with CYD-1 , CYD-3 and CYD-4 in a vaccine composition according to the present invention.
- a composition of the present invention may advantageously comprise a dengue antigen of serotype 2 which comprises a sequence having at least 90% identity to the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD- BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- said sequence may be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the prM-E sequence of CYD-LAV (SEQ ID NO: 8), CYD-BID (SEQ ID NO: 9), CYD-PR (SEQ ID NO: 10) CYD-MD (SEQ ID NO: 1 1 ) or SEQ ID NO: 2.
- the exact quantity of a vaccinal dengue virus of the present invention to be administered may vary according to the age and the weight of the patient being vaccinated, the frequency of administration as well as the other ingredients (e.g. adjuvants) in the composition.
- the quantity of a live attenuated dengue virus of each of serotypes 1 to 4 comprised in a vaccine composition of the present invention lies within a range of from about 10 3 to about 10 7 CCID 50 .
- the quantity of a live attenuated dengue virus of each of serotypes 1 to 4 comprised in a vaccine composition of the present invention lies within a range of from about 10 3 to about 10 6 CCID 50 , for example within a range of from about 5 x 10 3 to about 5 x 10 5 CCID 50 , for example within a range of from about 1 x 10 4 to about 1 x 10 5 CCID 50 , for example about 10 5 CCID 50 .
- the quantity of a live attenuated dengue virus of each of serotypes 1 to 4 comprised in a vaccine composition of the present invention may also lie within a range of from about 10 4 to about 10 7 CCID 50 , for example about 10 6 CCID 50 .
- the quantity of a live attenuated dengue virus of each of serotypes 1 to 4 comprised in a tetravalent composition of the present invention may be equal.
- a tetravalent composition of the present invention may comprise about 10 5 CCID 50 of each live attenuated dengue virus of serotypes 1 to 4.
- a tetravalent composition of the present invention may comprise about 10 6 CCID 50 of each live attenuated dengue virus of serotypes 1 to 4.
- the quantity of an inactivated dengue virus of each of serotypes 1 to 4 comprised in a composition of the present invention lies within a range of from about 10 4 to about 10 8 CCID 50 equivalent, preferably within a range of from about 5 x 10 4 to about 5 x 10 7 CCID 50 equivalent, preferably within a range of from about 1 x 10 4 to about 1 x 10 6 CCID 50 equivalent, preferably about 10 5 CCID 50 equivalent.
- the quantity of a VLP of each of serotypes 1 to 4 comprised in the composition lies within a range of from about 100ng to about 10C ⁇ g of VLP, preferably within a range of from about 100ng to about 5C ⁇ g, preferably within a range of from about 100ng to about 2C ⁇ g, preferably about ⁇ g to 1 C ⁇ g.
- the amount of VLP can be determined by ELISA.
- a vaccine composition according to the present invention comprises an effective amount of a dengue antigen as defined herein.
- a vaccine composition according to the present invention may further comprise a pharmaceutically acceptable carrier or excipient.
- a pharmaceutically acceptable carrier or excipient according to the present invention means any solvent or dispersing medium etc., commonly used in the formulation of pharmaceuticals and vaccines to enhance stability, sterility and deliverability of the active agent and which does not produce any secondary reaction, for example an allergic reaction, in humans.
- the excipient is selected on the basis of the pharmaceutical form chosen, the method and the route of administration. Appropriate excipients, and requirements in relation to pharmaceutical formulation, are described in "Remington's Pharmaceutical Sciences” (19th Edition, A.R. Gennaro, Ed., Mack Publishing Co., Easton, PA (1995)).
- compositions according to the present invention may advantageously comprise 0.4% saline and 2.5% human serum albumin (HSA).
- HSA human serum albumin
- a vaccine composition for use in a method of the present invention may optionally contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, human serum albumin, essential amino acids, nonessential amino acids, L- arginine hydrochlorate, saccharose, D-trehalose dehydrate, sorbitol, tris (hydroxymethyl) aminomethane and/or urea.
- the vaccine composition may optionally comprise pharmaceutically acceptable additives including, for example, diluents, binders, stabilizers, and preservatives. Preferred stabilizers are described in WO 2010/003670.
- a vaccine composition of the present invention may comprise a dengue antigen which is a dengue immunoprotein.
- a dengue immunoprotein as used herein, is a dengue envelope (E) protein, or derivative or fragment thereof, that when administered to an immunocompetent subject induces neutralizing antibodies against a dengue virus of serotype 1 , 2, 3 or 4.
- Dengue immunoproteins include native and derivatized forms of dengue E proteins, including chemical conjugates, immunological fragments, and fusion proteins thereof.
- Dengue immunoproteins, or derivatives or fragments thereof may be conjugated to carrier molecules. Such conjugation may be achieved by chemical conjugation techniques or through the recombinant expression of fusion proteins comprising the dengue immunoproteins or derivatives or fragments thereof and the carrier molecule.
- carrier molecules which may be used for preparing conjugates include diphtheria toxoid, tetanus toxoid, fragment C of tetanus toxin, mutants of diphtheria toxin including CRM 197, CRM 176, CRM228, CRM 45, CRM 9, CRM 45, CRM 102, CRM 103 and CRM 107, pneumococcal pneumolysin, OMPC, heat shock proteins, pertussis proteins, pneumococcal surface protein PspA or the toxin A or B of Clostridium difficile.
- a vaccine composition of the present invention may comprise one or more adjuvants to enhance the immunogenicity of the dengue antigens.
- an adjuvant is preferably used in a vaccine composition of the invention comprising an inactivated virus or a VLP or a dengue structural protein.
- An adjuvant may be used in a vaccine composition of the invention comprising a live attenuated virus, as long as said adjuvant does not impact replication.
- Suitable adjuvants include an aluminum salt such as aluminum hydroxide gel, aluminum phosphate or alum, but may also be a salt of calcium, magnesium, iron or zinc. Further suitable adjuvants include an insoluble suspension of acylated tyrosine or acylated sugars, cationically or anionically derivatized saccharides, or polyphosphazenes. Alternatively, the adjuvant may be an oil-in-water emulsion adjuvant (EP 0 399 843B), as well as combinations of oil-in-water emulsions and other active agents (WO 95/17210; WO 98/56414; WO 99/12565 and WO 99/1 1241 ).
- oil emulsion adjuvants have been described, such as water-in-oil emulsions (U.S. Pat. No. 5,422, 109; EP 0 480 982 B2) and water-in-oil-in-water emulsions (U.S. Pat. No. 5,424,067; EP 0 480 981 B).
- water-in-oil emulsions U.S. Pat. No. 5,422, 109; EP 0 480 982 B2
- water-in-oil-in-water emulsions U.S. Pat. No. 5,424,067; EP 0 480 981 B.
- adjuvants include MF59, AF03 (WO 2007/006939), AF04 (WO 2007/080308), AF05, AF06 and derivatives thereof.
- the adjuvant may also be a saponin, lipid A or a derivative thereof, an immunostimulatory oligonucleotide, an alkyl glucosamide phosphate, an oil in water emulsion or combinations thereof.
- saponins include Quil A and purified fragments thereof such as QS7 and QS21.
- a vaccine composition of the present invention is suitably formulated to be compatible with the intended route of administration.
- suitable routes of administration include for instance intramuscular, transcutaneous, subcutaneous, intranasal, oral or intradermal.
- the route of administration is subcutaneous.
- the vaccine compositions of the present invention may be administered using conventional hypodermic syringes or safety syringes such as those commercially available from Becton Dickinson Corporation (Franklin Lakes, NJ, USA) or jet injectors.
- conventional hypodermic syringes may be employed using the Mantoux technique or specialized intradermal delivery devices such as the BD Soluvia(TM) microinjection system (Becton Dickinson Corporation, Franklin Lakes, NJ, USA), may be used.
- the volume of a vaccine composition of the present invention administered will depend on the method of administration. In the case of subcutaneous injections, the volume is generally between 0.1 and 1.0 ml, preferably approximately 0.5 ml.
- booster administrations of a vaccine composition according to the present invention may be used, for example between six months and ten years, for example six months, one year, three years, five years or ten years after initial immunization (i.e. after administration of the last dose scheduled in the initial immunization regimen).
- the invention also provides a kit comprising a vaccine composition of the invention and instructions for the use of said vaccine composition in a method of protecting a human subject against dengue disease.
- the kit can comprise at least one dose (typically in a syringe) of any vaccine composition contemplated herein.
- the kit may comprises a multi-dose formulation (typically in a vial) of any vaccine composition as described herein.
- the kit further comprises a leaflet mentioning the use of the said vaccine composition for the prevention of dengue disease or the use of the said vaccine for the prophylaxis of dengue disease.
- the leaflet may further mention the vaccination regimen and the human subject population to be vaccinated.
- the efficacy of a vaccine composition of the present invention in reducing the likelihood or severity of dengue disease may be measured in a number of ways.
- the efficacy of a vaccine composition of the present invention in reducing the likelihood or severity of symptomatic virologically-confirmed dengue disease may be calculated by measuring after the administration of at least one dose of said vaccine composition (e.g. after administration of one, two or three doses of said vaccine composition):
- a statistically significant reduction in any one or more of (i) to (ix) in the vaccinated group of subjects when compared with the unvaccinated control group of subjects is indicative of the efficacy of a vaccine composition according to the present invention.
- the efficacy of a vaccine composition according to the present invention is demonstrated by a statistically significant reduction of one or more of the measures as described above, wherein the DHF cases or dengue cases are caused by dengue virus of serotypes 1 , 3 or 4.
- the efficacy of a vaccine composition according to the present invention in reducing the severity or likelihood of dengue disease may also be calculated by measuring after the administration of at least one dose of said vaccine composition (e.g. after administration of one, two or three doses of said vaccine composition):
- ALT alanine aminotransferase
- AST aspartate aminotransferase
- a statistically significant reduction in any one or more of (i) to (v) in the vaccinated group of subjects who have developed virologically-confirmed dengue disease when compared with the control group of subjects who have developed virologically- confirmed dengue disease is indicative of the efficacy of a vaccine composition according to the present invention in reducing the severity or likelihood of dengue disease.
- the efficacy of the method of protection of the invention against a dengue disease is at least 50%, preferably at least 60%, wherein said dengue disease is caused by serotype 1 , 3 or 4.
- the efficacy of the method of protection being advantageously at least 70%, preferably 80% against a dengue disease caused by serotype 3 or 4.
- the efficacy of the method of protection being advantageously at least 90% against dengue disease caused by serotype 4.
- Percent identity between two amino acid sequences or two nucleotide sequences is determined by standard alignment algorithms such as, for example, Basic Local Alignment Tool (BLAST) described in Altschul et al. (1990) J. Mol. Biol., 215: 403-410, the algorithm of Needleman et al. (1970) J. Mol. Biol., 48: 444-453; the algorithm of Meyers et al. (1988) Comput. Appl. Biosci., 4: 1 1 -17; or Tatusova et al. (1999) FEMS Microbiol. Lett., 174: 247-250, etc.
- BLAST Basic Local Alignment Tool
- Such algorithms are incorporated into the BLASTN, BLASTP and "BLAST 2 Sequences" programs (see www.ncbi.nim.nih.gov/BLAST).
- the default parameters can be used.
- program BLASTN reward for match 2, penalty for mismatch-2, open gap and extension gap penalties 5 and 2 respectively, gap x ⁇ dropoff 50, expect 10, word size 1 1 , filter ON.
- amino acid sequences the following settings can be used for "BLAST 2 Sequences” : program BLASTP, matrix BLOSUM62, open gap and extension gap penalties 1 1 and 1 respectively, gap x ⁇ dropoff 50, expect 10, word size 3, filter ON.
- Example 1 One year follow-up in Thailand of patients vaccinated with a tetravalent dengue vaccine (TDV) composition comprising ChimerivaxTM DEN-1 , DEN-2, DEN-3 and DEN-4
- TDV tetravalent dengue vaccine
- tetravalent ChimerivaxTM vaccine i.e. a tetravalent vaccine comprising the particular CYD-1 strain generated from the prM and E sequences of DEN 1 PU0359 (TYP 1 140), the particular CYD-2 strain generated from the prM and E sequences of DEN2 PU0218, the particular CYD-3 strain generated from the prM and E sequences of DEN3 PaH881/88 and the particular CYD-4 strain generated from the prM and E sequences of DEN4 1228 (TVP 980), see WO 03/101397 and Guy et al., Vaccine (201 1 ), 29(42): 7229- 41 ) against virologically-confirmed dengue disease is conducted.
- a tetravalent vaccine comprising the particular CYD-1 strain generated from the prM and E sequences of DEN 1 PU0359 (TYP 1 140), the particular CYD-2 strain generated from the prM and E sequences of DEN2 PU0218, the particular
- Each of the chimeric viruses are produced and cultured on Vero cells as described in WO 03/10197, Guy et al, Hum. Vaccines (2010) 6 (9): 696; Guy et al, Vaccine (2010) 28: 632; Guirakhoo et al, J. Virol. (2000) 74 : 5477 ; Guirakhoo et al, J. Virol. (2001 ) 75 (16) : 7290 ; Guirakaro et al, Virol. (June 20, 2002) 298: 146; and Guirakaro et al, J. Virol. (2004) 78 (9): 4761.
- the vaccine is presented as a lyophilized powder (previously stored at temperature of between 2°C and 8°C), which is reconstituted with 0.5 mL of solvent for injection (0.4% NaCI containing 2.5% human serum albumin).
- each 0.5 mL dose of vaccine contains 5 ⁇ 1 logi 0 CCID 50 of each chimeric dengue serotype (1 , 2, 3 and 4) and excipients (essential amino acids, non-essential amino acids, L-arginine chlorhydrate, saccharose, D-trehalose dehydrate, sorbitol, tris (hydroxymethyl) aminoethane and urea).
- the control product is inactivated rabies vaccine (Verorab ® , Sanofi Pasteur, Lyon France) for the first injection of the first 50 children randomised to the control group, and 0-9% NaCI saline placebo for all other injections. All products are injected subcutaneously into the deltoid region of the upper arm.
- Paired serum samples are collected at presentation (i.e., acute sample, collected no later than 7 days after fever onset) and 7-14 days later (convalescent sample) and sent to Sanofi Pasteur's Global Clinical Immunology (GCI) laboratory (Swiftwater, PA, USA) and to the Centre for Vaccine Development (CVD, Mahidol University, Thailand).
- GCI Global Clinical Immunology
- Acute samples are screened for the presence of flavivirus using an initial RT-PCR assay which detects the presence of any flavivirus (using primers composed of highly conserved flavivirus sequences). Positive samples are tested for wild-type dengue virus with a serotype-specific quantitative RT- PCR, as described herein.
- Dengue immune responses are assessed in the first 300 enrolled children at RRH in sera collected at enrolment and 28 days after each injection. Sera are also prospectively collected from all participants on Day 28 after the third injection to assess immune responses in children with virologically-confirmed dengue occurring from this timepoint. Sera are sent to GCI for measurement of serotype-specific neutralizing antibody titres against the CYD parental dengue viruses using the plaque-reduction neutralization test (PRNT 50 ) as described herein. The assay's quantitation limit is 10 (1/dil). Samples below this value are assigned the titre 5 and considered seronegative.
- VE against dengue is determined before completion of the 3-dose vaccination regimen.
- VE against each serotype individually is investigated. Analyses for safety and immunogenicity endpoints are descriptive, using 95%CI.
- Serotype 2 episodes 2510 31 1250 17 9-2 (-75 -3-51 -3)
- Serotype 3 episodes 2541 1 1257 2 75 -3 (-375 0-99-6)
- Serotype 4 episodes 2542 0 1263 4 100 (24- 8-100)
- GTT Geometric mean titres
- Post one year GMTs are respectively 76.5; 122; 94 and 153 for serotypes 1 , 2, 3 and 4.
- the nucleotide and amino acid sequence of the prM-E region of the wild type serotype 2 strain that causes the DEN-2 cases in the trial is determined. These are set out below as SEQ ID NO: 1 and SEQ ID NO: 2 respectively.
- the E and the M amino acid sequences of the serotype 2 strain that causes the DEN-2 cases in the trial are described in SEQ ID NOs: 18 and 23 respectively.
- the vaccine's safety and reactogenicity profile is good, and no vaccine-related SAEs and no safety signals are identified during the review of AEs and SAEs collected from over two years of active follow-up of more than 2600 vaccinees.
- Theoretical safety concerns associated with the potential enhancement of the rate or severity of dengue disease by an incomplete immune response against the four serotypes of dengue have previously hampered vaccine development.
- the absence of disease enhancement in the presence of an incomplete immune response against the circulating DENV2 viruses is an important and reassuring finding. For instance, cases in vaccinees do not differ from cases in controls in terms of factors such as the duration of fever or in terms of the classical clinical signs of dengue such as bleeding, plasma leakage or thrombocytopenia. Furthermore, severe dengue was not more frequent among vaccinees than controls at any point during the trial).
- DENV2 The results observed in respect of DENV2 may be explained by a number of contributing factors. For instance, there is a possible antigenic mismatch between the CYD2 vaccine virus and the DENV2 virus that causes disease in the trial. In the 1990s, the Asian 1 genotype of DENV2 emerged in South-East Asia, replacing the previously dominant Asian/American lineage of viruses. Several mutations identified in Domain 2 of the E protein (E83, and in particular E226 and E228) are suggestive of changing viral fitness and antigenicity. The donor wild-type virus for the CYD2 vaccine (and the challenge strain used in the PRNT50) was a clinical isolate from Bangkok in 1980 (Guirakhoo F et al., J Virol 2000, 74: 5477-85).
- CYD2 vaccine that may also contribute to a mismatched immune response. These mutations are at positions prM24 and E251 (Guirakhoo et al, J. Virol. (2004) 78 (9): 4761 ).
- the objective of the present example is to identify dengue virus strains of serotype 2 which provide the basis for generating optimized dengue vaccine compositions against dengue virus of serotype 2, wherein said optimized dengue vaccine compositions provide improved efficacy in comparison to ChimerivaxTM CYD-2 when used in a method according to the present invention.
- Criteria determining the selection of optimized strains for the determination of a universal dengue 2 antigen include: (i) recently circulating strain; (ii) balanced selection between Asian and American strains; (iii) an optimized strain should have a prM-E sequence that is as similar as possible to a calculated global consensus sequence generated by aligning the available prM-E sequences of dengue viruses of serotype 2; (iv) amino acid variations that are predicted to impact antibody recognition should be avoided; (v) rare amino acids at a particular positions in the prM and E sequences should be avoided, especially in the E protein ectodomain (a rare amino acid at a particular position is defined as a amino acid that appears at that position in less than 15% of the aligned sequences); (vi) optimized strains for which some previous laboratory experience exists are preferred and (vii) a dengue antigen that leads to a balanced immune response in a tetravalent composition.
- Criteria determining the selection of optimized strains for a local dengue 2 antigen are criteria (i) and (vii).
- NCBI National Center for Biotechnology Information
- Sequence alignment outputs are generated in Vector NTi version 9, module AlignX
- the sub-sequences included in the prM-E sequences may be numbered in various ways: (i) the total prM-E protein sequence is numbered from position 1 to position 661 , with the preM protein sequence designated as position 1 to position 90/91 , the M protein sequence designated as position 91/92 to position 166 and the E protein sequence designated as position 167 to position 661 ; (ii) the prM and M protein sequences are numbered together, i.e. from position 1 to position 166 of the total sequence and E is numbered separately from position 1 to position 495; (iii) the prM, M and E sequences are numbered separately, i.e. prM is numbered from position 1 to 90/91 , M is numbered from 1 to 75/76 and E from position 1 to position 495. Results
- the global consensus sequence is an artificial sequence containing the most frequently encountered amino acid at each position.
- the global consensus sequences for the 2010 alignment and the 201 1 alignment only differ by two amino acids.
- the global consensus sequence contains isoleucine and valine at positions 129 and 308 respectively of the E protein (by reference to the 1 -495 E sequence numbering) and, by contrast, in the 201 1 alignment, the global consensus sequence contains valine and isoleucine at positions 129 and 308 respectively of the E protein (by reference to the 1 -495 E sequence numbering).
- the differences in the 2010 and 201 1 global consensus sequences is explained by the fact that the respective percentages of strains containing valine or isoleucine at those positions is close to 50%.
- the global consensus sequence for the prM-E sequence is therefore represented as follows: fhlttrngephmivgrqekgksllfktedgvnmctlmaidlgelcedtitykcpllrqnep edidcwcnststwvtygtctttgehrrekrsvalvphvgmgletrtetwmssegawkhvqr ietwilrhpgftimaailaytigtthfqralifilltavapsmtMRCIGISNRDFVEGVSG GSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQG EPSLNEEQDKRFVCKHSMVDRGWGNGCGLFG
- the global consensus sequence for the E sequence is represented as follows: MRCIGI SNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCI EAKLTNTTTESRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCK KNMEGKXVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSI EAELTGYGTVTM ECSPRTGLDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPH AKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGK FKZVKEIAETQHG IVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVN IEAEPPFGDSYI I IGVEPGQLKLNWFKKGSS IGQ
- the global consensus prM sequence is shown in lower case letters and the E sequence is shown in upper case letters.
- the amino acid positions denoted as X (position 129 of the E sequence) and Z (position 308 of the E sequence) are each independently Val or lie, i.e. the proportion of aligned amino acid sequences including Val or lie at those positions is close to 50%.
- a list of variable amino acid positions is established from the global alignment containing all amino acid positions varying in at least 5% of the aligned sequences.
- any amino acid from the sequence of the prM and E proteins of ChimerivaxTM CYD2 that do not match the global consensus sequence are also identified.
- the results are shown in Table 4 (N.B., in the table, the prM and M protein sequences are numbered together, i.e. from position 1 to position 166 of the total sequence and E is numbered separately from position 1 to position 495).
- a total of 41 amino acid positions are identified in the prM and E sequences which either vary from the global consensus sequence in at least 5% of the aligned sequences and/or differ from the sequence of the prM and E proteins in CYD2.
- Ten amino acid positions in the sequence of the prM and E proteins in CYD2 differ from the global consensus sequence (5 positions in E, 2 positions in M and 3 in its precursor part, see Table 4). Five out of the ten differing residues present a variation distribution close to 50:50, suggesting a naturally variable position. Only three positions in the CYD2 prM-E sequence appear as very minor variants (pr-24 Val, M-125 lie and E-251 Phe).
- the variation at position 251 of the E protein of ChimerivaxTM CYD2 (Phe in ChimerivaxTM CYD2 and Val in the global consensus sequence) is extremely rare among retrieved strains. Such a variation could have some impact on recognition by an antibody, as it is rare, rather well exposed at the surface of the virion (29%) and corresponds to a non-conservative amino acid change.
- the present inventors consider that the impact of amino acid variations in dengue virus sequences can also be assessed using a scoring method which takes into account a number of relevant factors.
- this method takes into account the genome location of the variation (G), the nature of the amino acid change (B), 3D mapping (M) and known variants at the position in question (DB), wherein the score is calculated as G x B x M x DB.
- G genome location of the variation
- B the nature of the amino acid change
- M 3D mapping
- DB known variants at the position in question
- the genome location (G) score is 0 if the amino acid is located in the M part of the prM/M protein (i.e. position 92 to 166 of the prM/M sequence) or in position 396 to 495 of the E protein.
- the genome location score is 1 if the amino acid is located in prM part of the prM/M protein (i.e. position 1 to 91 of the prM/M sequence) or in position 1 to 395 of the E protein.
- the M value depends on whether the amino acid is or is not located at the prM/E interface.
- the amino acids that are located at the interface are prM residues 6, 7, 39, 40, 46-54, 56, 59-65, 67, 74 and 77 and E residues 64-72, 82-84, 101 -104, 106-108 and 244-247.
- M Y x SAS %.
- Y is 1 if the amino acid is located in an "up" position (i.e.
- Y is 0.5 if the amino acid is located on the "side" of the molecule (i.e. the amino acid is neither directed towards the external environment nor towards the capsid) and Y is 0 if the amino acid is located in a "down" position (i.e. directed towards the capsid).
- SAS % The solvent accessibility surface % (SAS %) value is generated using the Discovery Studio 3D modeling software (Accelrys, Inc., CA, USA).
- the DB value is 0 when the amino acid substitution results in an amino acid at the substitution position which is the most common amino acid at that position in the dengue sequences present in the GenBank database (http://www.ncbi.nlm.nih.gov).
- the DB value is 0.25 when the amino acid substitution results in an amino acid at the substitution position which is found in more than 5% of the dengue sequences present in the database (but is not the most common amino acid at that position).
- the DB value is 0.50 when the amino acid substitution results in an amino acid at the substitution position which is found in less than 5% of the dengue sequences present in the database (except unique substitutions).
- the DB value is 1 when the substitution amino acid is unique.
- viruses may acquire a mutation leading to an amino acid substitution.
- the above-mentioned method provides a means to determine the effect of such mutations on the progeny of the mutated viruses.
- Preferred sequences may have: (i) at most two, preferably one or no high-impact amino acid substitutions; (ii) at most three, preferably two or one, or no median impact amino acid substitutions; and/or (iii) at most five, four, three, two or one low impact amino acid substitutions.
- Optimised serotype 2 strains are identified on the basis of the selection criteria described above.
- a BLAST search is conducted to identify the strain having the closest sequence to the prM-E global consensus sequence in all of the available sequences. No sequence that is 100% identical to the prM-E global consensus sequence is found, but the best hit is a sequence from strain BID-V585 (NCBI Protein ID no. ACA58343; Genome ID no. EU529706; isolated from Puerto Rico in 2006) which shows only one variation from the global consensus sequence, at position 91 (Val in the global consensus sequence and lie in BID-V585).
- the BID-V585 prM-E sequence contains 13 variations from the ChimerivaxTM CYD-2 prM-E sequence.
- a further strain selection is made so as to provide geographical balance in strain origin.
- a further strain selection is made on the basis of a large amount of previously accumulated experience with the strain. It is the PDK53-16681 strain, also known as the LAV-2 strain, a live-attenuated virus derived from Dengue serotype 2 16681 strain from Mahidol University (NCBI Protein ID no. AAA73186; Genome ID no. M84728; isolated from Thailand in 1964; Blok.J., et al. (1992); Virology 187 (2), 573-590).
- the LAV-2 prM-E sequence contains 10 variations from the global consensus sequence and 13 variations from the ChimerivaxTM CYD-2 prM-E sequence.
- a further strain selected on the basis of the above-mentioned criteria is strain PR/DB023 (NCBI Protein ID no. AEN71248; Genome ID no. JF804036; isolated from Puerto Rico in 2007).
- the PR/DB023 prM-E sequence contains 3 variations from the global consensus sequence and 13 variations from the ChimerivaxTM CYD-2 prM-E sequence.
- chimeric dengue viruses corresponding to the optimized serotype 2 strains are constructed as follows (N.B. the optimized chimeric dengue viruses are constructed using the genomic backbone of YF strain YF17D204 (YF-VAX(R), Sanofi-Pasteur, Swiftwater, PA, USA).
- a full-length infectious cDNA clone of YF-VAX is constructed.
- the full-length infectious cDNA clone is based on the sequence of YF-VAX.
- a low copy number plasmid pACYC177 (New England Biolabs, Inc., Ipswich, MA, USA) is used to assemble the full- length cDNA clone.
- a DNA sequence named as SP6 YF-Vax 5-3 is synthesized by GeneArt®.
- the sequence of SP6 YF-Vax 5-3 is designed in a way to facilitate an easy assembly of a full- length YF-Vax cDNA clone.
- the sequence is 2897 bp long and comprises the Xma I-SP6 promoter, the YF-Vax 5'UTR, the capsid, prM, M, part of E which extends to the Apa I site followed by unique sites Mlu l-Sap l-Ngo Ml-Aat ll-CIa I for assembly, part of NS5 and further extended to 3' UTR followed by an Nru I site, which is used for run-off.
- This synthesized DNA sequence is flanked by EcoR V and Xho I sites. After digestion with EcoR V/Xho I, this DNA fragment is then cloned into the Aat ll/Xho I sites of low copy number plasmid pACYC177 to replace the 1615bp Aat ll/Xho I fragment.
- the resulting plasmid pJSY2284.1 (pACYC YF-Vax 5-3) is confirmed by sequence analysis.
- the yellow fever vaccine YF-VAX is grown in Vero cells, and the virus particles are concentrated.
- the viral RNA of YF-VAX is extracted from the concentrated virus and the cDNA copy is made by reverse transcriptase.
- Five cDNA fragments as shown herein are PCR amplified, TOPO cloned, sequenced and compared to the sequence of YF-VAX 2003.
- the PCR errors found in each fragment are corrected by either site-directed mutagenesis or fragment switching. There are too many sequence differences found in Ngo Ml-Aat II fragment after TOPO cloning, and therefore, this fragment is synthesized by GeneArt®.
- the strategy is to replace the prM and E genes of the YF-VAX® vaccine strain in the pJSY2374.5 plasmid containing the YF-VAX genome with those of the LAV2 strain, as done previously to build the CYD-1 , CYD-2, CYD-3 and CYD-4 dengue vaccines, using the ChimerivaxTM technology.
- the resulting plasmid is pSP1 101.
- restriction sites used for cloning are Xma I and Mlu I. These sites are located upstream and downstream of a 3000 bp fragment which contains: the SP6 promoter, YF17D 5'UTR, YF17D-capsid, YF17D-prM, YF17D-E and the N terminus of YF17D-NS1 .
- a sequence corresponding to this fragment but instead containing the prM and E genes of LAV2 flanked by Xma I and Mlu I sites is synthesized by GeneArt® and cloned into plasmid pMK-RQ (GeneArt®, Life Technologies Ltd, Paisley, U.K.) to create plasmid pMK-RQ-Seq1 .
- Plasmid pJSY2374.5 and pMK-RQ-Seq1 are digested by Xma I and Mlu 1 .
- Xma l-Mlu I fragment from pMK-RQ-Seq1 is then inserted into plasmid pJSY2374.5 to form plasmid pSP1 101.
- XL-10 Gold Ultracompetent bacteria (Agilent Technologies, CA, USA) are used for transformation, as they are suitable for large plasmids.
- positive clones are transferred into One Shot® TOP10 E. coli (Life Technologies Ltd, Paisley, U.K.), which allows the amplification of large size plasmids in significant amounts.
- Plasmid pSP1 101 thus allows the expression of LAV2 strain prM and E proteins with a YF-VAX replication engine.
- the resulting chimeric virus is designated CYD-LAV. Sequencing analysis shows no mutation as compared to the original sequences. Construction of corresponding plasmids for strains BID-V585, PR/DB023 and MD1280
- Example 4 Evaluation of the immunogenicity and viremia of the optimized serotype 2 chimeric viruses in a monkey model
- Control tetravalent formulation i.e. a formulation comprising CYD-1 , CYD-2, CYD-3 and CYD-4.
- CYD-LAV tetravalent formulation i.e. a formulation comprising CYD-1 , CYD-3, CYD-4 and CYD-LAV.
- CYD-MD tetravalent formulation i.e. a formulation comprising CYD-1 , CYD-3, CYD-4 and CYD-MD.
- CYD-PR tetravalent formulation i.e. a formulation comprising CYD-1 , CYD-3, CYD-4 and CYD-PR.
- Example 5 Assessment of tetravalent dengue vaccine formulations in flavivirus- na ' i ' ve adults in Mexico.
- the objective of the present study was to compare the immunogenicity and viremia of a blended tetravalent dengue vaccine comprising CYD-1 (i.e. the particular Chimerivax dengue serotype 1 (CYD-1 ) strain generated from the prM and E sequences of DEN 1 PU0359 (TYP 1 140)), VDV2, CYD-3 (i.e. the particular Chimerivax dengue serotype 3 (CYD-3) strain generated from the prM and E sequences of DEN3 PaH881/88) and CYD- 4 (i.e.
- CYD-1 i.e. the particular Chimerivax dengue serotype 1 (CYD-1 ) strain generated from the prM and E sequences of DEN 1 PU0359 (TYP 1 140)
- VDV2 i.e. the particular Chimerivax dengue serotype 3 (CYD-3) strain generated from the prM and E sequences of DEN3 PaH881/88
- CYD- 4 i.e.
- CYD-4 Chimerivax dengue serotype 4
- TVP 980 the particular Chimerivax dengue serotype 4
- CYD-2 i.e. the particular Chimerivax dengue serotype 2 (CYD-2) strain generated from the prM and E sequences of DEN2 PU0218
- CYD-3 i.e. the particular Chimerivax dengue serotype 2 (CYD-2) strain generated from the prM and E sequences of DEN2 PU0218
- CYD-3 and CYD-4 See Example 1 for more detail concerning the particular CYD-1 , CYD-2, CYD-3 and CYD-4 used in this study.
- the relevant nucleotide and protein sequences of the VDV2 strain are as follows:
- Group 1 Blended CYDA DV2 tetravalent formulation, i.e. a formulation comprising CYD-1 , CYD-3, CYD4 and VDV2.
- Group 2 Control tetravalent formulation (CYD-TDV), i.e. CYD-1 , CYD-2, CYD-3 and CYD-4.
- the formulations contained 10 5 CCID 50 of each serotype of the CYD viruses and the formulation administered to Group 1 contained 10 4 CCID 50 of the VDV-2 virus.
- RNA was again extracted from the serum using a commercial kit and an RT-PCR was carried out with serotype-specific primers from the envelope non-structural protein 1 junction gene sequence for each serotype.
- a dengue RT-PCR for serotype 2 was performed in group 1 since the tetravalent blending formulation administered to this group contained the VDV-2 virus.
- Antibody levels to each of the four dengue virus serotypes were determined by 50% plaque reduction neutralisation test on serum collected 28 days after each injection as well as on day 365 after the first injection. Briefly, serial 2-fold dilutions of heat- inactivated serum were mixed with a constant challenge dose of each dengue serotype DEN-1 , -2, -3, or -4 (expressed as plaque forming unit [PFU]/ml_). The mixtures were inoculated into wells of a 24-well plate of confluent VERO cell monolayers. After incubation for several days, dengue virus infection is indicated by formation of plaques.
- the neutralising antibody titre is calculated as the highest reciprocal dilution (1/dil) of serum at which ⁇ 50% reduction in viral plaque count is observed (PRNT50).
- the lower limit of quantitation of the dengue PRNT50 is 10; samples with titres ⁇ 10 were considered seropositive.
- Formulations were administered to participants in Groups 1 and 2 on day 0 and day 105 of the study. There were no marked differences between the two groups with regard to the injection site or systemic reactogenicity after either the first or the second vaccination.
- Viremia was assessed in serum collected 7, 14 and 21 days after each injection (Table 7). The neutralising antibody titres were measured 28 days after each injection and on day 365 after the first injection (Table 8).
- Table 7 Vaccine virus viremia 7, 14, or 21 days after first and second injections (n (%) with detectable and quantifiable viremia)
- Quantifiable viraemia 0 0 0 0 0
- Quantifiable viraemia 0 0 0 0 0
- the second injection of the blended CYDA/DV vaccine resulted in an improved neutralising antibody response against all serotypes of dengue virus when compared with the group receiving the CYD-TDV vaccine (Group 2).
- the blended CYDA/DV formulation group demonstrated a more persistent neutralising antibody response against dengue virus than the CYD-TDV group on day 365 after the first injection.
- the example therefore shows that, overall, the blended CYD-1 , 3, 4A/DV2 vaccine formulation induces stronger and longer lasting immune responses against the dengue virus serotypes than the CYD-TDV vaccine while showing a similar safety profile, as determined by the levels of viremia.
- nucleotide sequences where a nucleotide sequence is DNA, the nucleotide T may be replaced with the nucleotide U to give the RNA equivalent of that DNA sequence. Similarly, where a nucleotide sequence is RNA, the nucleotide U may be replaced by the nucleotide T to give the equivalent DNA sequence.
- the DNA sequences listed above constitute the cDNA sequences of the noted dengue viruses and therefore the equivalent RNA sequences constitute the positive strand RNA of those dengue viruses.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG11201500439RA SG11201500439RA (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
| MX2015000446A MX2015000446A (es) | 2012-07-24 | 2013-07-24 | Composiciones de vacuna para la prevencion contra la infeccion por el virus del dengue. |
| US14/416,492 US20150265695A1 (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
| AU2013295016A AU2013295016A1 (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
| CA2878599A CA2878599A1 (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
| BR112015001313A BR112015001313A2 (pt) | 2012-07-24 | 2013-07-24 | composições de vacina |
| JP2015523550A JP2015524422A (ja) | 2012-07-24 | 2013-07-24 | ワクチン組成物 |
| CN201380049741.2A CN104812408A (zh) | 2012-07-24 | 2013-07-24 | 用于防止登革热病毒感染的疫苗组合物 |
| KR20157003822A KR20150036593A (ko) | 2012-07-24 | 2013-07-24 | 뎅기열 바이러스 감염 예방용 백신 조성물 |
| HK16100914.5A HK1212905A1 (zh) | 2012-07-24 | 2013-07-24 | 用於防止登革热病毒感染的疫苗组合物 |
| EP13740025.5A EP2877207A1 (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
| PH12014502875A PH12014502875A1 (en) | 2012-07-24 | 2014-12-23 | Vaccine compositions for prevention against dengue virus infection |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12305908.1 | 2012-07-24 | ||
| EP12305908 | 2012-07-24 | ||
| EP12305911 | 2012-07-25 | ||
| EP12305911.5 | 2012-07-25 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014016362A1 true WO2014016362A1 (en) | 2014-01-30 |
Family
ID=48856641
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/065669 Ceased WO2014016362A1 (en) | 2012-07-24 | 2013-07-24 | Vaccine compositions for prevention against dengue virus infection |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US20150265695A1 (enExample) |
| EP (1) | EP2877207A1 (enExample) |
| JP (1) | JP2015524422A (enExample) |
| KR (1) | KR20150036593A (enExample) |
| CN (1) | CN104812408A (enExample) |
| AU (1) | AU2013295016A1 (enExample) |
| BR (1) | BR112015001313A2 (enExample) |
| CA (1) | CA2878599A1 (enExample) |
| GT (1) | GT201500005A (enExample) |
| HK (1) | HK1212905A1 (enExample) |
| MX (1) | MX2015000446A (enExample) |
| PE (1) | PE20150356A1 (enExample) |
| PH (1) | PH12014502875A1 (enExample) |
| SG (1) | SG11201500439RA (enExample) |
| WO (1) | WO2014016362A1 (enExample) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016034629A1 (en) * | 2014-09-02 | 2016-03-10 | Sanofi Pasteur | Vaccine compositions against dengue virus diseases |
| WO2016106107A3 (en) * | 2014-12-22 | 2016-08-18 | Merck Sharp & Dohme Corp. | Dengue virus vaccine compositions and methods of use thereof |
| EP3010536A4 (en) * | 2013-06-21 | 2016-11-30 | Merck Sharp & Dohme | DENGUE VIRUS VACCINE COMPOSITIONS AND METHODS FOR USE THEREOF |
| US20170087244A1 (en) * | 2015-09-29 | 2017-03-30 | Merial, Inc. | Canine Parvovirus (CPV) Virus-like Particle (VLP) Vaccines and uses thereof |
| US10105434B2 (en) | 2015-08-03 | 2018-10-23 | The United States Of America As Represented By The Secretary Of The Navy | Immune enhancing recombinant dengue protein |
| US10857222B2 (en) | 2015-07-03 | 2020-12-08 | Sanofi Pasteur | Concomitant dengue and yellow fever vaccination |
| US11464815B2 (en) | 2018-09-05 | 2022-10-11 | Takeda Vaccines, Inc. | Dengue vaccine unit dose and administration thereof |
| US11590221B2 (en) | 2018-09-05 | 2023-02-28 | Takeda Vaccines, Inc. | Dengue vaccine unit dose and administration thereof |
| US11690903B2 (en) | 2017-10-05 | 2023-07-04 | Sanofi Pasteur | Compositions for booster vaccination against dengue |
| US11931399B2 (en) | 2013-03-15 | 2024-03-19 | Takeda Vaccines, Inc. | Compositions and methods for dengue virus chimeric constructions in vaccines |
| US12201683B2 (en) | 2018-09-05 | 2025-01-21 | Takeda Vaccines, Inc. | Methods for preventing dengue and hepatitis a |
| WO2025146159A1 (zh) * | 2024-01-05 | 2025-07-10 | 北京昌平实验室 | 针对寨卡/登革病毒的重组抗原、其疫苗组合物及其应用 |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11201701669PA (en) * | 2014-09-11 | 2017-04-27 | Vlp Therapeutics Llc | Flavivirus virus like particle |
| WO2018208741A1 (en) | 2017-05-08 | 2018-11-15 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Methods and compositions for the detection of flavivirus infections |
| EP3730620A4 (en) | 2017-12-21 | 2022-01-05 | Green Biomed, Inc. | Cross-immunizing antigen vaccine and method for preparation thereof |
| SG11202112328TA (en) * | 2019-05-15 | 2021-12-30 | Codagenix Inc | Attenuated yellow fever virus and uses thereof for the treatment of cancer |
Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0480982B1 (fr) | 1989-07-03 | 1993-10-20 | S.E.P.P.I.C., Societe D'exploitation De Produits Pour Les Industries Chimiques | Vaccins et vecteurs de principes actifs fluides contenant une huile metabolisable |
| EP0480981B1 (fr) | 1989-07-03 | 1993-10-20 | S.E.P.P.I.C., Societe D'exploitation De Produits Pour Les Industries Chimiques | Emulsions multiphasiques injectables |
| EP0399843B1 (en) | 1989-05-25 | 1994-07-13 | Chiron Corporation | Adjuvant formulation comprising a submicron oil droplet emulsion |
| WO1995017210A1 (en) | 1993-12-23 | 1995-06-29 | Smithkline Beecham Biologicals (S.A.) | Vaccines |
| WO1996040933A1 (en) | 1995-06-07 | 1996-12-19 | The Government Of The United States Of America, Represented By The Secretary Department Of Health And Human Services | Infectious dengue 2 virus pdk-53 as quadravalent vaccine |
| WO1998037911A1 (en) | 1997-02-28 | 1998-09-03 | Oravax, Inc. | Chimeric flavivirus vaccines |
| WO1998056414A1 (en) | 1997-06-11 | 1998-12-17 | Smithkline Beecham Biologicals S.A. | Oil in water vaccine compositions |
| WO1999011241A1 (en) | 1997-09-05 | 1999-03-11 | Smithkline Beecham Biologicals S.A. | Oil in water emulsions containing saponins |
| WO1999012565A1 (en) | 1997-09-05 | 1999-03-18 | Smithkline Beecham Biologicals S.A. | Vaccines |
| WO2000057909A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-2 virus vaccine |
| WO2000057904A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-3 virus vaccine |
| WO2000057908A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research, Department Of The Army | Attenuated dengue-1 virus vaccine |
| WO2000057910A1 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-4 virus vaccine |
| US6254873B1 (en) | 1995-04-17 | 2001-07-03 | The United States Of America As Represented By The Secretary Of The Army | Inactivated dengue virus vaccine |
| WO2001060847A2 (en) | 2000-02-16 | 2001-08-23 | The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services | Avirulent, immunogenic flavivirus chimeras |
| EP1159968A1 (fr) | 2000-05-30 | 2001-12-05 | Mahidol University | Souches atténuées du virus de la Dengue et leur utilisation dans une composition vaccinale |
| WO2002066621A1 (de) | 2001-02-21 | 2002-08-29 | Heinz Franz X | Attenuierte lebendimpfstoffe |
| WO2002081754A1 (en) * | 2001-04-04 | 2002-10-17 | The Governement Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention | Nucleic acid vaccines for prevention of flavivirus infection |
| WO2002095007A2 (en) | 2001-05-23 | 2002-11-28 | Dendreon San Diego Llc | Conjugates activated by cell surface proteases and therapeutic uses thereof |
| WO2002102828A2 (en) | 2001-06-01 | 2002-12-27 | Acambis, Inc. | Chimeric flavivirus vectors |
| WO2003010197A2 (en) | 2001-07-25 | 2003-02-06 | Genset S.A. | Gmg-1 polynucleotides and polypeptides and uses thereof |
| WO2003101397A2 (en) | 2002-05-31 | 2003-12-11 | Acambis, Inc. | Tetravalent dengue vaccines |
| WO2006134443A1 (en) | 2005-06-17 | 2006-12-21 | Sanofi Pasteur | Dengue serotype 2 attenuated strain |
| WO2006134433A1 (en) | 2005-06-17 | 2006-12-21 | Sanofi Pasteur | Dengue serotype 1 attenuated strain |
| WO2007006939A2 (fr) | 2005-07-07 | 2007-01-18 | Sanofi Pasteur | Emulsion immuno-adjuvante thermoreversible |
| WO2007021672A2 (en) | 2005-08-10 | 2007-02-22 | Acambis Inc. | Vaccination against dengue virus infection |
| WO2007080308A2 (fr) | 2006-01-13 | 2007-07-19 | Sanofi Pasteur | Emulsion huile dans eau thermoreversible |
| WO2008007021A1 (fr) | 2006-07-12 | 2008-01-17 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| WO2008047023A2 (fr) | 2006-10-04 | 2008-04-24 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| WO2008065315A1 (fr) | 2006-12-01 | 2008-06-05 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| EP1958959A2 (en) * | 2005-11-22 | 2008-08-20 | Centro De Ingenieria Genetica Y Biotecnologia (Cigb) | Methods and proteins for the prophylactic and/or therapeutic treatment of the four serotypes of dengue virus and other flaviviruses |
| WO2010003670A1 (en) | 2008-07-09 | 2010-01-14 | Sanofi Pasteur | Stabilizer and vaccine composition comprising one or more live attenuated flaviviruses |
| WO2011013097A2 (en) * | 2009-07-29 | 2011-02-03 | Bernd Helmut Adam Rehm | Polymer particles and uses thereof |
| WO2011138586A1 (en) | 2010-05-05 | 2011-11-10 | Imperial Innovations Limited | Dengue virus vaccine |
| WO2011146933A2 (en) * | 2010-05-21 | 2011-11-24 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Universal dengue virus sequences and methods of use |
| WO2012051491A1 (en) * | 2010-10-14 | 2012-04-19 | The United States Of America, As Represented By The Secretary National Institutes Of Health | Compositions and methods for controlling neurotropic viral pathogenesis by micro-rna targeting |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2003506039A (ja) * | 1999-08-02 | 2003-02-18 | ワイス | cDNAからの流行性耳下腺炎ウイルスのレスキュー |
| EP2319532A1 (en) * | 2002-05-03 | 2011-05-11 | The Government of the United States of America, represented by The Secretary, Department of Health and Human Services | Recombinant dengue virus containing a common 30 nucleotide deletion in the 3'-UTR of dengue types 3, or 4 |
| CA2918585C (en) * | 2003-09-17 | 2019-05-21 | Duke University | Consensus/ancestral immunogens |
| US7968102B2 (en) * | 2006-01-13 | 2011-06-28 | Sanofi Pasteur S.A. | Dengue chimeric viruses |
| CA2676775A1 (en) * | 2007-01-31 | 2008-09-25 | Sanofi Pasteur Biologics Co. | Flavivirus vaccine vector against influenza virus |
| BRPI0913012B1 (pt) * | 2008-04-30 | 2021-12-14 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention | Quimera de ácido nucleico, métodos para detectar um anticorpo do vírus da dengue em uma amostra de um paciente, e para produzir partículas virais que expressam proteínas prm e e do vírus da dengue, uso de vírus codificado pela quimera e flavivírus ou partícula viral quiméricos |
| WO2011062625A2 (en) * | 2009-11-18 | 2011-05-26 | The Board Of Regents Of The University Of Texas System | Physicochemical (pcp) based consensus sequences and uses thereof |
| AU2013295014B2 (en) * | 2012-07-24 | 2018-01-18 | Sanofi Pasteur | Vaccine compositions |
-
2013
- 2013-07-24 EP EP13740025.5A patent/EP2877207A1/en not_active Withdrawn
- 2013-07-24 PE PE2015000070A patent/PE20150356A1/es not_active Application Discontinuation
- 2013-07-24 KR KR20157003822A patent/KR20150036593A/ko not_active Withdrawn
- 2013-07-24 BR BR112015001313A patent/BR112015001313A2/pt not_active IP Right Cessation
- 2013-07-24 HK HK16100914.5A patent/HK1212905A1/zh unknown
- 2013-07-24 CN CN201380049741.2A patent/CN104812408A/zh active Pending
- 2013-07-24 US US14/416,492 patent/US20150265695A1/en not_active Abandoned
- 2013-07-24 MX MX2015000446A patent/MX2015000446A/es unknown
- 2013-07-24 CA CA2878599A patent/CA2878599A1/en not_active Abandoned
- 2013-07-24 JP JP2015523550A patent/JP2015524422A/ja active Pending
- 2013-07-24 SG SG11201500439RA patent/SG11201500439RA/en unknown
- 2013-07-24 WO PCT/EP2013/065669 patent/WO2014016362A1/en not_active Ceased
- 2013-07-24 AU AU2013295016A patent/AU2013295016A1/en not_active Abandoned
-
2014
- 2014-12-23 PH PH12014502875A patent/PH12014502875A1/en unknown
-
2015
- 2015-01-12 GT GT201500005A patent/GT201500005A/es unknown
Patent Citations (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0399843B1 (en) | 1989-05-25 | 1994-07-13 | Chiron Corporation | Adjuvant formulation comprising a submicron oil droplet emulsion |
| EP0480981B1 (fr) | 1989-07-03 | 1993-10-20 | S.E.P.P.I.C., Societe D'exploitation De Produits Pour Les Industries Chimiques | Emulsions multiphasiques injectables |
| US5422109A (en) | 1989-07-03 | 1995-06-06 | Societe D'exploitation De Produits Pour Les Industries Chimiques (S.E.P.P.I.C.) | Fluid vaccines and active principle vehicles containing a metabolizable oil |
| US5424067A (en) | 1989-07-03 | 1995-06-13 | Societe D'exploitation De Produits Pour Les Industries Chimiques (S.E.P.P.I.C.) | Injectable multi-phase emulsions |
| EP0480982B1 (fr) | 1989-07-03 | 1993-10-20 | S.E.P.P.I.C., Societe D'exploitation De Produits Pour Les Industries Chimiques | Vaccins et vecteurs de principes actifs fluides contenant une huile metabolisable |
| WO1995017210A1 (en) | 1993-12-23 | 1995-06-29 | Smithkline Beecham Biologicals (S.A.) | Vaccines |
| US6254873B1 (en) | 1995-04-17 | 2001-07-03 | The United States Of America As Represented By The Secretary Of The Army | Inactivated dengue virus vaccine |
| WO1996040933A1 (en) | 1995-06-07 | 1996-12-19 | The Government Of The United States Of America, Represented By The Secretary Department Of Health And Human Services | Infectious dengue 2 virus pdk-53 as quadravalent vaccine |
| WO1998037911A1 (en) | 1997-02-28 | 1998-09-03 | Oravax, Inc. | Chimeric flavivirus vaccines |
| WO1998056414A1 (en) | 1997-06-11 | 1998-12-17 | Smithkline Beecham Biologicals S.A. | Oil in water vaccine compositions |
| WO1999012565A1 (en) | 1997-09-05 | 1999-03-18 | Smithkline Beecham Biologicals S.A. | Vaccines |
| WO1999011241A1 (en) | 1997-09-05 | 1999-03-11 | Smithkline Beecham Biologicals S.A. | Oil in water emulsions containing saponins |
| WO2000057909A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-2 virus vaccine |
| WO2000057904A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-3 virus vaccine |
| WO2000057908A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research, Department Of The Army | Attenuated dengue-1 virus vaccine |
| WO2000057910A1 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-4 virus vaccine |
| WO2001060847A2 (en) | 2000-02-16 | 2001-08-23 | The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services | Avirulent, immunogenic flavivirus chimeras |
| EP1159968A1 (fr) | 2000-05-30 | 2001-12-05 | Mahidol University | Souches atténuées du virus de la Dengue et leur utilisation dans une composition vaccinale |
| WO2002066621A1 (de) | 2001-02-21 | 2002-08-29 | Heinz Franz X | Attenuierte lebendimpfstoffe |
| WO2002081754A1 (en) * | 2001-04-04 | 2002-10-17 | The Governement Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention | Nucleic acid vaccines for prevention of flavivirus infection |
| WO2002095007A2 (en) | 2001-05-23 | 2002-11-28 | Dendreon San Diego Llc | Conjugates activated by cell surface proteases and therapeutic uses thereof |
| WO2002102828A2 (en) | 2001-06-01 | 2002-12-27 | Acambis, Inc. | Chimeric flavivirus vectors |
| WO2003010197A2 (en) | 2001-07-25 | 2003-02-06 | Genset S.A. | Gmg-1 polynucleotides and polypeptides and uses thereof |
| WO2003101397A2 (en) | 2002-05-31 | 2003-12-11 | Acambis, Inc. | Tetravalent dengue vaccines |
| WO2006134443A1 (en) | 2005-06-17 | 2006-12-21 | Sanofi Pasteur | Dengue serotype 2 attenuated strain |
| WO2006134433A1 (en) | 2005-06-17 | 2006-12-21 | Sanofi Pasteur | Dengue serotype 1 attenuated strain |
| WO2007006939A2 (fr) | 2005-07-07 | 2007-01-18 | Sanofi Pasteur | Emulsion immuno-adjuvante thermoreversible |
| WO2007021672A2 (en) | 2005-08-10 | 2007-02-22 | Acambis Inc. | Vaccination against dengue virus infection |
| EP1958959A2 (en) * | 2005-11-22 | 2008-08-20 | Centro De Ingenieria Genetica Y Biotecnologia (Cigb) | Methods and proteins for the prophylactic and/or therapeutic treatment of the four serotypes of dengue virus and other flaviviruses |
| WO2007080308A2 (fr) | 2006-01-13 | 2007-07-19 | Sanofi Pasteur | Emulsion huile dans eau thermoreversible |
| WO2008007021A1 (fr) | 2006-07-12 | 2008-01-17 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| WO2008047023A2 (fr) | 2006-10-04 | 2008-04-24 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| WO2008065315A1 (fr) | 2006-12-01 | 2008-06-05 | Sanofi Pasteur | Methode d'immunisation contre les 4 serotypes de la dengue |
| WO2010003670A1 (en) | 2008-07-09 | 2010-01-14 | Sanofi Pasteur | Stabilizer and vaccine composition comprising one or more live attenuated flaviviruses |
| WO2011013097A2 (en) * | 2009-07-29 | 2011-02-03 | Bernd Helmut Adam Rehm | Polymer particles and uses thereof |
| WO2011138586A1 (en) | 2010-05-05 | 2011-11-10 | Imperial Innovations Limited | Dengue virus vaccine |
| WO2011146933A2 (en) * | 2010-05-21 | 2011-11-24 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Universal dengue virus sequences and methods of use |
| WO2012051491A1 (en) * | 2010-10-14 | 2012-04-19 | The United States Of America, As Represented By The Secretary National Institutes Of Health | Compositions and methods for controlling neurotropic viral pathogenesis by micro-rna targeting |
Non-Patent Citations (54)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING CO. |
| "World Health Organization. Dengue hemorrhagic fever: Diagnosis, treatment, prevention and control", 1997, WHO |
| ALAN L. ROTHMAN, NATURE REVIEWS IMMUNOLOGY, vol. 11, 2011, pages 532 - 543 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL, S. F.; GISH, W.; MILLER, W.; MYERS, E. W.; LIPMAN, D. J.: "Basic local alignment search tool", J MOL BIOL, vol. 215, no. 3, 1990, pages 403 - 410 |
| BHAMARAPRAVATI N ET AL: "Live attenuated tetravalent dengue vaccine", VACCINE, ELSEVIER LTD, GB, vol. 18, 1 January 2000 (2000-01-01), pages 44 - 47, XP002160013, ISSN: 0264-410X, DOI: 10.1016/S0264-410X(00)00040-2 * |
| BLOK,J. ET AL., VIROLOGY, vol. 187, no. 2, 1992, pages 573 - 590 |
| BRESLOW NE; DAY NE: "The Design and Analysis of Cohort Studies. International Agency for Research on Cancer", vol. II, SCIENTIFIC PUBLICATION NO. 82, article "Statistical Methods in Cancer Research" |
| BRUNO GUY: "Development of Sanofi Pasteur tetravalent dengue vaccine", vol. 6, no. 9, 1 September 2010 (2010-09-01), pages 696 - 705, XP055046419, Retrieved from the Internet <URL:http://www.orphanresearch.com/journals/vaccines/GuyHV6-9.pdf> [retrieved on 20121203], DOI: DOI: 10.4161.hv.6.9.12739 * |
| CALLAHAN ET AL., J. CLIN. MICROBIOL., vol. 39, 2001, pages 4119 |
| CHAMBERS ET AL., J. VIROLOGY, vol. 73, no. 4, 1999, pages 3095 - 3101 |
| CLEMENTS D E ET AL: "Development of a recombinant tetravalent dengue virus vaccine: Immunogenicity and efficacy studies in mice and monkeys", VACCINE, ELSEVIER LTD, GB, vol. 28, no. 15, 24 March 2010 (2010-03-24), pages 2705 - 2715, XP026946252, ISSN: 0264-410X, [retrieved on 20100308], DOI: 10.1016/J.VACCINE.2010.01.022 * |
| EDGAR, R. C.: "MUSCLE: multiple sequence alignment with high accuracy and high throughput", NUCLEIC ACIDS RES, vol. 32, no. 5, 2004, pages 1792 - 1797 |
| ENDY ET AL., J. INFECT. DIS., vol. 189, no. 6, 2004, pages 990 - 1000 |
| GALLER ET AL., VACCINES, vol. 16, no. 9/10, 1998, pages 1024 - 1028 |
| GUBLER ET AL.: "Epidemiology of arthropod- borne viral disease", 1988, CRC PRESS, pages: 223 - 60 |
| GUBLER, TRENDS IN MICROBIOLOGY, vol. 10, 2002, pages 100 - 103 |
| GUIRAKHOO ET AL., J. VIROL., vol. 74, 2000, pages 5477 |
| GUIRAKHOO ET AL., J. VIROL., vol. 75, no. 16, 2001, pages 7290 |
| GUIRAKHOO ET AL., J. VIROL., vol. 78, no. 9, 2004, pages 4761 |
| GUIRAKHOO ET AL., VIROL., vol. 298, 20 June 2002 (2002-06-20), pages 146 |
| GUIRAKHOO F ET AL., J VIROL, vol. 74, 2000, pages 5477 - 85 |
| GUIRAKHOO F ET AL., J. VIROL., vol. 75, 2001, pages 7290 - 304 |
| GUNTHER ET AL., VACCINE, vol. 29, 2011, pages 3895 |
| GUY B ET AL., AM J TROP MED HYG., vol. 80, no. 2, 2009, pages 302 - 11 |
| GUY B. ET AL., AM. J. TROP. MED. HYG., vol. 80, no. 2, 2009, pages 302 - 11 |
| GUY ET AL., HUM. VACCINES, vol. 6, no. 9, 2010, pages 696 |
| GUY ET AL., VACCINE, vol. 28, 2010, pages 632 |
| GUY ET AL., VACCINE, vol. 29, no. 42, 2011, pages 7229 - 41 |
| HANG ET AL., PLOS NEGL TROP DIS., vol. 4, no. 7, 20 July 2010 (2010-07-20), pages E757 |
| HANG ET AL., PLOS NTD, vol. 4, no. 7, pages E757 |
| JORGE E OSORIO ET AL: "Development of DENVax: A chimeric dengue-2 PDK-53-based tetravalent vaccine for protection against dengue fever", VACCINE, vol. 29, no. 42, 2011 - 21 July 2011 (2011-07-21), pages 7251 - 7260, XP028285284, ISSN: 0264-410X, [retrieved on 20110711], DOI: 10.1016/J.VACCINE.2011.07.020 * |
| KAUTNER ET AL., J. OF PEDIATRICS, vol. 131, 1997, pages 516 - 524 |
| LIBRATY ET AL., PLOS MEDICINE, vol. 6, no. 10, 2009 |
| MALAVIGE ET AL., POSTGRAD MED. J., vol. 80, 2004, pages 588 - 601 |
| MEULEN ET AL., TROP. MED. INT. HEALTH, vol. 5, 2000, pages 325 - 9 |
| MEYERS ET AL., COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17 |
| MODIS, Y. ET AL., PROC NATL ACAD SCI U S A, vol. 100, no. 12, 2003, pages 6986 - 6991 |
| MORRISON D ET AL., J INFECT DIS., vol. 201, no. 3, 2010, pages 370 - 7 |
| NEEDLEMAN ET AL., J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| POO ET AL., PEDIATR INFECT DIS J, vol. 30, 2011, pages E9 |
| RICE ET AL., SCIENCE, vol. 229, 1985, pages 726 - 733 |
| RIGAU-PEREZ ET AL., LANCET, vol. 352, 1998, pages 971 - 977 |
| ROTHMAN; ENNIS, VIROLOGY, vol. 257, 1999, pages 1 - 6 |
| RUMYANTSEV AA ET AL., VACCINE, vol. 29, no. 32, 18 July 2011 (2011-07-18), pages 5184 - 94 |
| SABIN, AM. J. TROP. MED. HYG., vol. 1, 1952, pages 30 - 50 |
| SHUO ZHANG ET AL: "Vaccination with dengue virus-like particles induces humoral and cellular immune responses in mice", VIROLOGY JOURNAL, BIOMED CENTRAL, LONDON, GB, vol. 8, no. 1, 30 June 2011 (2011-06-30), pages 333, XP021103960, ISSN: 1743-422X, DOI: 10.1186/1743-422X-8-333 * |
| SRIKIATKACHORN ET AL., CLIN. INFECT. DIS., vol. 53, no. 6, 2011, pages 563 |
| TATUSOVA ET AL., FEMS MICROBIOL. LETT., vol. 174, 1999, pages 247 - 250 |
| THEILER M.; SMITH H.H., J.EXP.MED., vol. 65, 1937, pages 767 - 786 |
| TWIDDY S S ET AL: "Phylogenetic Relationships and Differential Selection Pressures among Genotypes of Dengue-2 Virus", VIROLOGY, ACADEMIC PRESS,ORLANDO, US, vol. 298, no. 1, 20 June 2002 (2002-06-20), pages 63 - 72, XP004469470, ISSN: 0042-6822, DOI: 10.1006/VIRO.2002.1447 * |
| VAUGHN ET AL., J. INF. DIS., vol. 181, 2000, pages 2 - 9 |
| VAUGHN ET AL., J. INFECT. DIS., vol. 176, 1997, pages 322 - 30 |
| ZHANG ET AL., J. VIROL., vol. 30, no. 8, 2011, pages 333 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12186363B2 (en) | 2013-03-15 | 2025-01-07 | Takeda Vaccines, Inc. | Compositions and methods for dengue virus chimeric constructions in vaccines |
| US11931399B2 (en) | 2013-03-15 | 2024-03-19 | Takeda Vaccines, Inc. | Compositions and methods for dengue virus chimeric constructions in vaccines |
| EP3010536A4 (en) * | 2013-06-21 | 2016-11-30 | Merck Sharp & Dohme | DENGUE VIRUS VACCINE COMPOSITIONS AND METHODS FOR USE THEREOF |
| US9861692B2 (en) | 2013-06-21 | 2018-01-09 | Merck Sharp & Dohme Corp. | Dengue virus vaccine compositions and methods of use thereof |
| WO2016034629A1 (en) * | 2014-09-02 | 2016-03-10 | Sanofi Pasteur | Vaccine compositions against dengue virus diseases |
| TWI852899B (zh) * | 2014-09-02 | 2024-08-21 | 法商賽諾菲巴斯德公司 | 疫苗組合物 |
| CN106999564A (zh) * | 2014-09-02 | 2017-08-01 | 赛诺菲巴斯德有限公司 | 针对登革热病毒疾病的疫苗组合物 |
| US10946087B2 (en) | 2014-09-02 | 2021-03-16 | Sanofi Pasteur | Vaccine compositions against dengue virus diseases |
| US10449243B2 (en) | 2014-12-22 | 2019-10-22 | Merck Sharp & Dohme Corp. | Dengue virus vaccine compositions and methods of use thereof |
| WO2016106107A3 (en) * | 2014-12-22 | 2016-08-18 | Merck Sharp & Dohme Corp. | Dengue virus vaccine compositions and methods of use thereof |
| CN106999568A (zh) * | 2014-12-22 | 2017-08-01 | 默沙东公司 | 登革病毒疫苗组合物及其使用方法 |
| JP2018502080A (ja) * | 2014-12-22 | 2018-01-25 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | デングウイルスワクチン組成物およびその使用方法 |
| US10857222B2 (en) | 2015-07-03 | 2020-12-08 | Sanofi Pasteur | Concomitant dengue and yellow fever vaccination |
| US10105434B2 (en) | 2015-08-03 | 2018-10-23 | The United States Of America As Represented By The Secretary Of The Navy | Immune enhancing recombinant dengue protein |
| US10716843B2 (en) | 2015-08-03 | 2020-07-21 | The United States Of America As Represented By The Secretary Of The Navy | Immune enhancing recombinant dengue protein |
| US20170087244A1 (en) * | 2015-09-29 | 2017-03-30 | Merial, Inc. | Canine Parvovirus (CPV) Virus-like Particle (VLP) Vaccines and uses thereof |
| US10537632B2 (en) | 2015-09-29 | 2020-01-21 | Boehringer Ingelheim Animal Health USA Inc. | Canine parvovirus (CPV) virus-like particle (VLP) vaccines and uses thereof |
| US10080798B2 (en) * | 2015-09-29 | 2018-09-25 | Merial Inc. | Canine parvovirus (CPV) virus-like particle (VLP) vaccines and uses thereof |
| JP2018529718A (ja) * | 2015-09-29 | 2018-10-11 | メリアル インコーポレイテッド | イヌパルボウイルス(cpv)ウイルス様粒子(vlp)ワクチン及びその使用 |
| AU2016332037B2 (en) * | 2015-09-29 | 2019-06-27 | Boehringer Ingelheim Animal Health USA Inc. | Canine parvovirus (CPV) virus-like particle (VLP) vaccines and uses thereof |
| US11690903B2 (en) | 2017-10-05 | 2023-07-04 | Sanofi Pasteur | Compositions for booster vaccination against dengue |
| US11464815B2 (en) | 2018-09-05 | 2022-10-11 | Takeda Vaccines, Inc. | Dengue vaccine unit dose and administration thereof |
| US11590221B2 (en) | 2018-09-05 | 2023-02-28 | Takeda Vaccines, Inc. | Dengue vaccine unit dose and administration thereof |
| US12201683B2 (en) | 2018-09-05 | 2025-01-21 | Takeda Vaccines, Inc. | Methods for preventing dengue and hepatitis a |
| WO2025146159A1 (zh) * | 2024-01-05 | 2025-07-10 | 北京昌平实验室 | 针对寨卡/登革病毒的重组抗原、其疫苗组合物及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2878599A1 (en) | 2014-01-30 |
| CN104812408A (zh) | 2015-07-29 |
| MX2015000446A (es) | 2015-03-12 |
| PH12014502875A1 (en) | 2015-02-23 |
| GT201500005A (es) | 2015-10-13 |
| EP2877207A1 (en) | 2015-06-03 |
| BR112015001313A2 (pt) | 2017-08-01 |
| JP2015524422A (ja) | 2015-08-24 |
| SG11201500439RA (en) | 2015-02-27 |
| HK1212905A1 (zh) | 2016-06-24 |
| AU2013295016A1 (en) | 2015-01-29 |
| KR20150036593A (ko) | 2015-04-07 |
| PE20150356A1 (es) | 2015-03-20 |
| US20150265695A1 (en) | 2015-09-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2877208B1 (en) | Vaccine compositions for the prevention of dengue virus infection | |
| US20150265695A1 (en) | Vaccine compositions for prevention against dengue virus infection | |
| US10946087B2 (en) | Vaccine compositions against dengue virus diseases | |
| JP5227172B2 (ja) | デングウイルス感染に対するワクチン接種 | |
| US20230338504A1 (en) | Compositions for Booster Vaccination Against Dengue | |
| WO2014083194A1 (en) | Methods for inducing antibodies | |
| CA2878682C (en) | Vaccine compositions for use in a method of protecting a human subject against dengue disease | |
| HK1212906B (en) | Vaccine compositions | |
| BR112015001145B1 (pt) | Composição de vacina para uso em um método de proteção de um indivíduo humano contra a doença da dengue, kit compreendendo a mesma e seu uso | |
| HK1242193A1 (en) | Vaccine compositions against dengue virus diseases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13740025 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2878599 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/000446 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IDP00201500301 Country of ref document: ID |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 000070-2015 Country of ref document: PE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14416492 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2015523550 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2013295016 Country of ref document: AU Date of ref document: 20130724 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15026430 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 20157003822 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013740025 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015001313 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015001313 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150121 |