WO2013164484A1 - Glucagon-like-peptide-2 (glp-2) analogues - Google Patents

Glucagon-like-peptide-2 (glp-2) analogues Download PDF

Info

Publication number
WO2013164484A1
WO2013164484A1 PCT/EP2013/059320 EP2013059320W WO2013164484A1 WO 2013164484 A1 WO2013164484 A1 WO 2013164484A1 EP 2013059320 W EP2013059320 W EP 2013059320W WO 2013164484 A1 WO2013164484 A1 WO 2013164484A1
Authority
WO
WIPO (PCT)
Prior art keywords
ser
absent
glp
lys
pro
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/059320
Other languages
English (en)
French (fr)
Inventor
Rasmus JUST
Kirsten Lindegaard BOVBJERG
Ditte Riber
Wayne Shaun RUSSELL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zealand Pharma AS
Original Assignee
Zealand Pharma AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2014013319A priority Critical patent/MX356958B/es
Priority to EA201491934A priority patent/EA028929B1/ru
Priority to BR112014027345A priority patent/BR112014027345A2/pt
Priority to CA2872315A priority patent/CA2872315A1/en
Priority to US14/398,297 priority patent/US9453064B2/en
Priority to CN201380029907.4A priority patent/CN104540850B/zh
Priority to HK15108935.4A priority patent/HK1208238B/en
Priority to EP13721953.1A priority patent/EP2844670B1/en
Priority to JP2015509462A priority patent/JP6298044B2/ja
Application filed by Zealand Pharma AS filed Critical Zealand Pharma AS
Priority to KR1020147033951A priority patent/KR20150006052A/ko
Priority to AU2013255752A priority patent/AU2013255752B2/en
Publication of WO2013164484A1 publication Critical patent/WO2013164484A1/en
Anticipated expiration legal-status Critical
Priority to IN9782DEN2014 priority patent/IN2014DN09782A/en
Priority to US15/238,126 priority patent/US9969787B2/en
Priority to US15/950,235 priority patent/US10253080B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/22Urine; Urinary tract, e.g. kidney or bladder; Intraglomerular mesangial cells; Renal mesenchymal cells; Adrenal gland
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/48Reproductive organs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/48Reproductive organs
    • A61K35/54Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/56Materials from animals other than mammals
    • A61K35/63Arthropods
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/56Materials from animals other than mammals
    • A61K35/63Arthropods
    • A61K35/64Insects, e.g. bees, wasps or fleas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/12Antidiarrhoeals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/24Antidepressants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to glucagon-like-peptide-2 (GLP-2) analogues with altered GLP-1 activity and their medical use, for example in the prophylaxis, treatment or ameliorating of diseases and conditions such as metabolic endotoxemia, diabetes, obesity, and the metabolic syndrome.
  • GLP-2 glucagon-like-peptide-2
  • LPS lipopolysaccharide
  • ME metabolic endotoxemia
  • Human GLP-2 is a 33-amino ⁇ acid peptide derived from specific
  • proglucagon in the enteroendocrine L cells of the intestine and in specific regions of the brainstem. It is co-secreted together with glucagon-like peptide 1 (GLP-1 ), oxyntomodulin,. and glicenfin, in response to nutrient ingestion.
  • GLP-1 glucagon-like peptide 1
  • oxyntomodulin oxyntomodulin
  • glicenfin in response to nutrient ingestion.
  • GLP-2 induces significant growth of the small intestinal mucosal epithelium via the stimulation of stem cell proliferation in the crypts and inhibition of apoptosis in the villi (Drucker et al., Proc Natl Acad Sci U S A 93:791 1-7916 (1996)). GLP-2 also has growth effects on the colon. Furthermore, GLP-2 inhibits gastric emptying and gastric acid secretion (Wojdemann et al., J Clin Endocrinol etab.
  • GLP-2 binds to a single G protein-coupled receptor belonging to the class II glucagon secretin family.
  • the GLP-2 receptor is expressed in the small intestine, colon and stomach, which also are sites that are known to be responsive to GLP-2 (Yusta et al., Gastroenterology 1 19:744-755 (2000)).
  • the target ceil type for GLP-2 receptor stimulation in the gastrointestinal tract remains unclear, and the downstream intracellular mediators coupled to the GLP-2 receptor are poorly understood.
  • GLP-2 has been shown to prevent or reduce mucosal epithelial damage in a wide number of preclinical models of gut injury, including chemotherapy-induced enteritis, ischemia-reperfusion injury, dextran sulfate-induced colitis and genetic models of inflammatory bowel disease (Sinclair and Drucker Physiology 2005: 357- 65).
  • GLP-2 is secreted as a 33 amino acid peptide with the following sequence His-Aia-Asp-G!y-Ser-Phe-Ser-Asp-Glu- et-Asn-Thr-iie-Leu-Asp-Asn-Leu-Ala-Aia- Arg-Asp-Phe-lle ⁇ Asn-Trp-Leu ⁇ lle ⁇ Gin-Thr » Lys-lle-Thr-Asp (SEQ ID NO: 1 ) It is rapidly cieaved by the enzyme DPP V at the alanine (Ala) at position 2 reiative to the N- terminus to form an inactive human GLP-2 peptide (3-33).
  • GLP-2 anaiogues are described, e.g., in US Patent Nos. 5,789,379; 5,994,500; 6,184,201 ; 6,184,208; International Publication Nos. WO 97/39031 ; WO 01/41779; WO 02/06651 1 and DaCambra et al. (Biochemistry 2000, 39, 8888-8894). All references cited herein are expressly incorporated by reference in their entirety.
  • the present invention concerns GLP-2 analogues comprising one or more substitutions in comparison to wild-type GLP-2 and which may have the property of an altered, preferably increased GLP-1 activity, e.g., as assessed In in vitro efficacy assays.
  • GLP-1 activity for example, can be measured by determining EC50 values at the GLP-1 receptor lower than for native GLP-2.
  • GLP-2 analogues of the invention comprise one or more substitutions at an amino acid position corresponding to one or more of positions 2, 3, 5, 7, 8, 9, 10, 11 , 12, 14, 15, 16, 19, 20, 21 , 24, 27 and/or 28 of the wild-type GLP-2 sequence in combination with Gin, Lys or Glu in position 17.
  • GLP-2 analogues of the invention comprise one or more substitutions at an amino acid position corresponding to one or more of positions 2, 3, 5, 7, 8, 9, 10, 1 1 , 12, 15, 18, 20, 21 , 24, 27 and/or 28 of the wild-type GLP-2 sequence in combination with Gin, Lys or Glu in position 17.
  • GLP-2 analogues of the invention comprise a conservative or non-conservative substitutions at position 2 and/or a substitution or deletion of one or more of amino acids corresponding to an amino acid of positions 28 to 33 of the wild-type GLP-2 sequence.
  • the GLP-2 analogues of the present invention optionally comprise lipophilic substituents conjugated to one or more of positions 12, 14, 18, 17, 19, 20, 24, 27, 28 and 32.
  • the GLP-2 analogues of the present invention optionally comprise lipophilic substituents conjugated to one or more of positions 12, 18, 17, 20, 24, 27, 28 and 32.
  • a GLP-2 analogue is represented by the general Formula I:
  • R 1 is hydrogen, C - a!kyl (e.g. methyl), acetyl, formy!, benzoyl or tnfluoroacetyl;
  • X9 is Glu or Asp
  • X10 is Met, Val, Leu or Tyr
  • X11 is Asn, Ser or Ala
  • X12 is Thr, Ser or Lys
  • X13 is He, Leu, Val, Tyr, Phe or Gin
  • X14 is Leu or Met
  • X15 is Asp or Glu
  • X16 is Asn, Gin, Gly, Ser, Ala, Glu or Lys;
  • X17 is Gin, Lys, Arg, His or Glu
  • X19 is Ala or Val
  • X20 is Arg, Lys or His
  • X21 is Asp, Glu or Leu
  • X24 is Asn, Ala, Giu or Lys
  • X27 is ile, Leu, Val, Giu or Lys:
  • X28 is Gin, Asn, Lys, Ser, Y1 or absent;
  • X29 is Thr, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is He, Pro or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • Y1 is Giy-Gly ⁇ Pro ⁇ Ser ⁇ Ser ⁇ Gly-Aia-Pro-Pro-Ser, or Lys-Asn-Gly-Gly ⁇ Pro-Ser-Ser- Gly-Ala-Pro-Pro-Pro-Ser;
  • R 2 is NH 2 or OH; with the proviso that the GLP-2 analogue of Formula I is not
  • HGDGSFSDEMNTILDGQAARDFSNWUQTKITD (SEQ ID HO 3)
  • HGDGSFSDEMNTILDSQAARDFINWLIQTK (SEQ ID HO 5)
  • X31 may also be Y1.
  • X28 may also be Gly.
  • X29 may also be Ala, [0016J Additionally, Y1 may be present between X33 and R 2 , Thus, a position X34 may be envisaged, where X34 is Y1 or is absent.
  • a GLP-2 analogue is a GLP-2 analogue according to Formula I or a pharmaceutically acceptable salt or solvate thereof, wherein:
  • R 1 is hydrogen
  • X2 is Gly, Ala or Aib
  • X3 is Giu, Gin or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X8 is Asp, Giu or Ser
  • X9 is Giu or Asp
  • X10 is Met, Va!, Leu or Tyr
  • X1 1 is Asn, Ser, or Ala
  • X12 is Thr or Lys; X14 is Leu or Met
  • X15 is Asp or Giu
  • X16 is Asn, Gin, Gly, Ser, Ala, Giu or Lys;
  • X17 is Gin or Lys
  • X19 is Ala or Vai
  • X20 is Arg, Lys or His
  • X21 is Asp, Giu or Leu
  • X24 is Asn, A!a, Giu or Lys
  • X27 is He, Leu, Val or Lys:
  • X28 is Gin, Asn, Y1 or absent
  • X29 is Thr, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is He, Pro, Y1 or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • Y1 is ⁇ Gly-Gly ⁇ Pro ⁇ Ser ⁇ Ser ⁇ Gly ⁇ Aia-Pro-Pro-Pro ⁇ Ser;
  • R 2 is NH 2 or OH; with the proviso that the GLP-2 analogue of Formula I is not HGDGSFSDEMNTILDGQAA DFINWLIQTKITD;
  • X13 may be He, Leu, Val, Tyr, Phe or Gin,
  • X28 may also be Gly
  • X29 may also be Ala
  • Y1 may be present between X33 and R 2 .
  • X14 of Formula I is Leu, [0021] In some embodiments X14 of Formula I is Met.
  • X17 of Formula I is Gin.
  • X17 of Formula I is Lys
  • X17 of Formula I is Giu.
  • X19 of Formula I is Ala
  • X19 of Formula I is VaL
  • X16 of Formula I is Gly and X17 of Formula I is Gin.
  • X18 of Formula I is Gly and X17 of Formula I is Lys.
  • X18 of Formula I is Gly and X17 is of Formula I is Glu.
  • X2 of Formula I is Alb
  • X18 of Formula I is Gly
  • X17 of Formula I is Gin.
  • X2 of Formula I is Aib
  • X16 of Formula I is Gly
  • X17 of Formula I is Lys.
  • X2 of Formula I is Aib
  • X16 of Formula I is Gly
  • X17 of Formula I is Glu.
  • X2 of Formula I is Gly, X16 of Formula I is Gly and X17 of Formula I is Gin.
  • X2 of Formula I is Gly, X16 of Formula I is Gly and X17 of Formula a is Lys.
  • X2 of Formula I is Gly
  • X18 of Formula I is Gly
  • X17 of Formula I is Glu
  • a GLP-2 analogue is represented by the general Formula la:
  • R is hydrogen, C alkyl (e.g. methyl), acetyl, formyl, benzoyl or thfiuoroacefyi;
  • X2 is Giy, Ala or Aib;
  • X3 is G!u, G!n or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X8 is Asp, Glu or Ser
  • X9 is Glu or Asp
  • X10 is IV!et, Val, Leu or Tyr
  • X11 is Asn or Ser
  • X12 is Thr, Ser or Lys
  • X13 is He, Leu, Val, Tyr, Phe or Gin
  • X15 is Asp or Glu:
  • X16 is Asn, Gin, Giy, Ser, Ala, Glu or Lys;
  • X17 is Gin, Lys, Arg, His or Glu
  • X20 is Arg, Lys or His
  • X21 is Asp, Glu or Leu;
  • X24 is Asn, Ala, Glu or Lys
  • X27 is He, Leu, Val, Glu or Lys:
  • X28 is Gin, Asn, Lys, Ser, Y1 or absent;
  • X29 is Thr, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is He, Pro or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • Y1 is Gly-Gly-Pro-Ser-Ser-Giy-Ala-Pro-Pro-Ser, or Lys-Asn-Gly-Gly-Pro-Ser-Ser- Gly ⁇ Ala-Pro-Pro-Pro-Ser;
  • R is NH 2 or OH; with the proviso that the GLP-2 analogue of Formula la is not
  • X31 may also be Y1 ,
  • Y1 may be present between X33 and R 2 , thus, a position X34 may be envisaged, where X34 is Y1 or is absent.
  • a GLP-2 analogue is a GLP-2 analogue according to Formula la or a pharmaceutically acceptable salt or solvate thereof, wherein;
  • R 1 is hydrogen
  • X2 is Gly, Ala or Aib
  • X3 is Glu, G!n or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X8 is Asp, Glu or Ser
  • X9 is Glu or Asp
  • X10 is Met, Vat, Leu or Tyr
  • X11 is Asn or Ser
  • X12 is Thr or Lys
  • X15 is Asp or Glu
  • X16 is Asn, Gin, Gly, Ser, Ala, Glu or Lys;
  • X17 is Gin or Lys
  • X20 is Arg, Lys or His
  • X21 is Asp, Giu or Leu
  • X24 is Asn, Ala, Glu or Lys
  • X27 is He, Leu, Val or Lys:
  • X28 is Gin, Asn, Y1 or absent
  • X29 is Thr, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is He, Pro, Y1 or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • Y1 is ⁇ Gly-Gly ⁇ Pro ⁇ Ser ⁇ Ser-Gly-Aia-Pro-Pro ⁇ Pro ⁇ Ser;
  • R 2 is NH 2 or OH; with the proviso that the analogue of Formula la is not
  • X13 may be He, Leu, Va!, Tyr, Phe or G!n
  • X28 may also be Gly
  • X29 may also be Ala
  • Y1 may be present between X33 and R 2 .
  • X17 of Formula !a is Gin
  • X17 of Formula la is Lys.
  • X17 of Formula la is Giu. [0 ⁇ 46] In some embodiments, X16 of Formula la is Gly and X17 of Formula la is Gin.
  • X18 of Formula !a is Gly and X17 of Formula la is Lys.
  • X16 of Formula la is Gly and X17 of Formula la is Glu.
  • X2 of Formula la is Aib
  • X18 of Formula la is Gly
  • X17 of Formula la is Gin.
  • X2 of Formula la is Aib
  • X18 of Formula la is Gly and X17 of Formula la is Lys.
  • X2 of Formula la is Aib
  • X16 of Formula la is Gly and X17 of Formula la is Glu.
  • X2 of Formula la is Gly
  • X16 of Formula la is Gly
  • X17 of Formula la is Gin.
  • X2 of Formula la is Gly
  • X18 of Formula la is Gly
  • X17 of Formula la is Lys.
  • X2 of Formula la is Gly
  • X16 of Formula la is Gly
  • X17 of Formula la is Glu.
  • X8-X9-X10-X1 1 may be Ser-Glu-Leu-A!a.
  • positions X28 to X33 may be selected from certain amino acid residues, or may be Y1 , or may be absent. It is intended that the GLP-2 analogue contains no more than one Y1 moiety, and that if present, Y1 forms the C-terminai part of the molecule. Thus, if any of positions is X28 to X33 is Y1 , all downstream positions are absent; i.e. those positions X29 to X33 (or X34) downstream of that Y1 are absent). Sn this context, positions "downstream" of a given position are those located C4erminal of that position.
  • positions X28 to X33 are absent, then all positions downstream of that position are also absent (except that Y1 may be present).
  • position XN is present (where is an integer between 28 and 33) then position X(N ⁇ 1 ) is also present.
  • the GLP-2 analogue may be represented by the genera! Formula II;
  • R 1 His-X2-X3-Gly-X5 ⁇ Phe-X7-Ser ⁇ Glu ⁇ Leu-Ala ⁇ X12 ⁇ X13 ⁇ X14 ⁇ X15-X16-X17- Ala-X19-X20-X21 -Phe-lle-X24 ⁇ Trp-Leu-X27 ⁇ X28-X29-X30-X31 -X32-X33-X34- R 2 (II) (SEQ ID NO 7) or a pharmaceutically acceptable salt or solvate thereof,
  • R 1 is hydrogen, C -4 alkyl (e.g. methyl), acetyl, formyi, benzoyl or trifluoroacetyl;
  • X2 is Gly, Ala or Aib
  • X3 is Glu, Gin or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X12 is Thr, Ser or Lys
  • X13 is He, Leu, Val, Tyr, Phe or Gin
  • X14 is Leu or Met
  • X15 is Asp or Glu
  • X16 is Gly, Ser, Ala, Glu or Lys
  • X17 is Gin or Lys; X19 is Ala or Val;
  • X20 is Arg, Lys or His
  • X21 is Asp, G!u or Leu;
  • X24 is Asn, Ala, Giu or Lys
  • X27 is He, Leu, Val, Glu or Lys:
  • X28 is Gin, Asn, Lys, Ser, Gly, Y1 c )r absent;
  • X29 is Thr, Ala, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is lie, Pro, Y1 or absent
  • X32 is Thr, Y1 or absent
  • .X33 is Asp, Asn, Y1 or absent;
  • X34 is Y1 or absent
  • Y1 is Gly-Gly ⁇ Pro ⁇ Ser-Ser-Gly ⁇ Ala-Pro-Pro ⁇ Pro ⁇ Ser, or Lys-Asn-Giy-Gly-Pro-Ser-Ser- Gly-Ala-Pro-Pro-Pro-Ser; and
  • R 2 is H 2 or OH; wherein the GLP-2 analogue contains no more than one Y1 ; if any of X28 to X33 is Y1 , those positions X29 to X34 downstream of that Y1 are absent; if any of X28 to X33 is absent, those positions X29 to X33 downstream of that posits are also absent.
  • X18 of Formula ⁇ is Gly, Ser or Ala.
  • X17 of Formula H may be Lys, or X17 of Formula II may be Gin,
  • X2 of Formula U may be Gly or Ala.
  • X16 of Formula !l is Gly and X17 of Formula II is Gin.
  • X16 of Formula is G!y and X17 of Formula II is Lys.
  • X2 of Formula II is Gly, X18 of Formula II is Gly and X17 of Formula il is Gin.
  • X2 of Formula il is Giy, X18 of Formula II is Gly and X17 of Formula II is Lys.
  • X2 of Formula H is Aib
  • X16 of Formula l is Gly and X17 of Formu!a II is Gin.
  • X2 of Formula il is Aib
  • X16 of Formula IS is Giy
  • X17 of Formula II is Lys.
  • R 1 Is hydrogen, Ci_ 4 aSkyl (e.g. methyl), acetyl, formyl, benzoyl or trifluoroaceiyl;
  • X2 is Gly or Aib
  • X3 is Glu or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X12 is Thr, Ser or Lys
  • X13 is He, Leu, Val, Tyr, Phe or Gin
  • X14 is Leu or Met
  • X15 is Asp or Giu
  • X16 is Gly, Ser or Ala
  • X17 is Gin or Lys
  • X19 is Ala or Val
  • X20 is Arg, Lys or His
  • X21 is Asp, Glu or Leu;
  • X24 is Asn, Ala, Giu or Lys
  • X27 is lie, Leu, Val, Giu or Lys:
  • X28 is Gin, Asn, Lys, Ser, Gly, Y1 or absent;
  • X29 is Thr, Ala, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is He, Pro, Y1 or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • X34 is Y1 or absent
  • Y1 is Gly-Gly ⁇ Pro ⁇ Ser-Ser-Gly ⁇ Ala ⁇ Pro ⁇ Pro ⁇ Pro ⁇ Ser, or Lys-Asn-Gly-Gly-Pro-Ser-Ser- Gly-Ala-Pro-Pro-Pro-Ser; and R 2 is NH 2 or OH; wherein the GLP-2 analogue contains no more than one Y1 ; if any of X28 to X33 is Y1 , those positions X29 to X34 downstream of that Y1 are absent; if any of X28 to X33 is absent, those positions X29 to X33 downstream of that position are also absent.
  • X16 is G!y and X17 is G!n.
  • X16 is Gly and X17 is Lys
  • X2 is Gly
  • X16 is Gly and X17 is Gin
  • X2 is Gly
  • X16 is Giy
  • X17 is Lys.
  • X2 is Aib
  • X16 is Gly
  • X17 is Gin.
  • X2 is Aib
  • X18 is Gly
  • X17 is Lys
  • a GLP-2 analogue is represented by the genera! Formula ⁇ :
  • R 1 is hydrogen, 0 1-4 alkyl (e.g. methyl), acetyl, formyl, benzoyl or trifluoroacety!;
  • X3 is Glu.or Asp
  • X5 is Ser or Thr
  • X7 is Ser or Thr
  • X12 is Thr, Ser or Lys
  • X13 is lie, Tyr, or Gin
  • X15 is Asp or Glu
  • X1 is Gin or Lys; X19 is Ala or Val;
  • X20 is Arg, Lys or His
  • X21 is Asp, Glu or Leu;
  • X24 is Asn, Ala, Giu;
  • X27 is lie, Leu.Glu or Lys:
  • X28 is Gin, Lys, Ser, Gly, Y1 or absent;
  • X29 is Thr, Ala, Y1 or absent
  • X30 is Lys, Y1 or absent
  • X31 is lie, Pro, Y1 or absent
  • X32 is Thr, Y1 or absent
  • X33 is Asp, Asn, Y1 or absent
  • X34 is Y1 or absent
  • Y1 is Gly ⁇ Gly-Pro-Ser-Ser-Gly ⁇ Ala ⁇ Pro ⁇ Pro-Pro-Ser, or Lys-Asn-Gly ⁇ Gly ⁇ Pro ⁇ Ser ⁇ Ser ⁇ Gly ⁇ Ala ⁇ Pro ⁇ Pro-Pro-Ser;
  • R 2 is NH 2 or OH; wherein the GLP-2 analogue contains no more than one Y1 ; if any of X28 to X33 is Y1 , those positions X29 to X34 downstream of that Y1 are absent; if any of X28 to X33 is absent, those positions X29 to X33 downstream of that position are also absent.
  • the amino acid sequence of the GLP-2 analogue has not more than 5 amino changes, e.g. not more than 4, not more than 3, not more than 2 or not more than 1 change from the amino acid sequence HGDGSFSSELATILDGKAARDF! WLIQTKITD or HGDGSFSSELAT!LDGQAARDFIAWLIQTKITD.
  • a GLP-2 analogue of the invention is represented by any one of the foilowing sequences:
  • HGDGSFSDEMNTILDNKAARDFINWLIQTKITD (SEG ID NO 9)
  • HGDGSFSDEMNTILDGQAARDFINWLIQTK (SEG ID NO 10)
  • HGEGTFTSDLSTILENKAARDFIEWLIQTKSTD (SEQ ID MO 15)
  • HGDGSFSDEMNTILDGQAARDFINWLIQTK (SEQ ID NO 19)
  • HGEGSFSSDLSTILEGKAARDFIEWLIGTKITD (SEQ SD NO 20) or a pharmaceutically acceptable salt or solvate thereof.
  • the GLP-2 analogue of the invention may be a compound R'-Z-R 2 wherein R 1 and R 2 are as defined In the generic formulae and Z is a peptide sequence selected from those listed above.
  • a GLP-2 analogue of the invention comprises lipophilic substituent conjugated to an amino acid at a position corresponding or more of positions 12, 14, 16, 17,19, 20, 24, 27, 28 and 32 of native GLP-2.
  • a GLP-2 analogue of the invention comprises a lipophilic substituent conjugated to an amino acid at a position corresponding to one or more of positions 12, 16, 17, 20, 24, 27, 28 and 32 of native GLP-2.
  • a GLP-2 analogue of the invention may be used in a therapy.
  • the invention provides a pharmaceutical composition comprising a GLP-2 analogue of the invention, or a salt or derivative thereof, in admixture with a carrier, in some embodiments, the pharmaceutical composition may comprise a GLP-2 analogue that is a pharmaceutically acceptable acid addition salt. In some embodiments, the pharmaceutical composition is formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of a GLP-2 analogue of the invention. [0082] In some embodiments, the invention provides for the use of a GLP-2 analogue of the invention for the preparation of a medicament for the treatment and/or prevention of low grade inflammation.
  • the invention provides for the use of a GLP-2 analogue of the invention for the preparation of a medicament for the treatment and/or prevention of low grade inflammation related to diabetes (which may be type I or type ⁇ diabetes, but particularly type ⁇ ).
  • low grade inflammation related to diabetes which may be type I or type ⁇ diabetes, but particularly type ⁇ .
  • the low grade diabetes which may be type I or type ⁇ diabetes, but particularly type ⁇ .
  • the inflammation is local or systemic low grade inflammation.
  • the low grade inflammation includes the metabolic syndrome, obesity (e.g. abdominal obesity), diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, Alzheimer, arthritis, hypertension, dyslipidaemia and stroke, gastro-intestinal disorders in the upper gastrointestinal tract of the oesophagus, the stomach, duodenum, the small intestine, colon and rectum including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-EHison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short- bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (e.g., Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemia sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and
  • the invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention
  • the invention provides an expression vector comprising a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention in combination with control sequences to direct the expression of the GLP-2 analogue.
  • the invention provides a host cell transformed with the expression vector.
  • the invention provides a method of producing a GLP- 2 analogue of the invention, the method comprising culturing host ceils expressing the GLP-2 analogue under conditions suitable for expression and purifying the GLP-2 analogue thus produced.
  • a nucleic acid molecule of the invention, an expression vector of the invention, or a host cell of the invention may be used in a therapy.
  • the invention provides for the use of a nucleic acid molecule of the invention, an expression vector of the invention, or a host cell of the invention in the preparation of a medicament for the treatment and/or prevention of low grade inflammation.
  • the low grade inflammation is local or systemic, and can include, for example, metabolic syndrome (broadest definition), obesity (e.g.
  • abdominal obesity diabetes
  • cardiovascular diseases gastrointestinal inflammation, depression, Alzheimer's disease, arthritis, hypertension, dyslipidaemia and stroke
  • gastro-intestinal disorders in the upper gastrointestinal tract of the oesophagus, the stomach, duodenum, the small intestine, colon and rectum including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Eilison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue,
  • aetiology e.g., peptic ulcers, Zollinger-Eilison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens
  • digestion disorders malabsorption syndromes, short-bowel syndrome
  • hypogammaglobulinemic sprue and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
  • the invention provides a method of treating a gastrointestinal-related disorder (e.g., stomach or bowel) in a patient in need thereof by administering an effective amount a GLP-2 analogue of the invention, a nucleic acid molecule of the invention, an expression vector of the invention, or a host cell of the invention.
  • a gastrointestinal-related disorder e.g., stomach or bowel
  • the gastrointestinal related disorder is low grade inflammation.
  • the low grad inflammation may be local or systemic, and may include the metabolic syndrome, obesity (e.g.
  • abdominal obesity diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, aizheimer, arthritis, hypertension, dyslipidaemia and stroke, gastrointestinal disorders in the upper gastrointestinal tract of the oesophagus, the stomach, duodenum, the small intestine, colon, or rectum, including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Eilison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (e.g., Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
  • aetiology e.g., peptic ulcers, Zollinger
  • the invention provides a therapeutic kit comprising a cancer chemotherapy drug and a GLP-2 analogue of the invention, a nucleic acid molecule of the invention, an expression vector of the invention or a host cell of the invention, each optionally in combination with a pharmaceutically acceptable carrier.
  • Figure 1 shows the effects of GLP-1 and GLP-2 on physiological pathways, (Adapted from Cans et al., Pharmacology and Therapeutics 130 (2011 ⁇ 202-212.)
  • Figure 2 shows the effects of Compound 12 or vehicle administration on the orai glucose tolerance test (OGTT). One hour before glucose challenge, baseline measurements were taken and Compound 12/vehicle was administered.
  • A Blood glucose levels during the experimental period
  • B AUG of blood glucose
  • Figure 3 shows the effects of Compound 7 or vehicle administration on intestinal wet weight. Animais were treated with compound 7 or vehicle once daily, for four days and on day 5 the small intestine was removed and weighed.
  • Figure 4 shows effects of two weeks administration of test compound 7 or vehicle administration on intestinal weight.
  • A Small intestinal wet weight
  • B Large intestinal wet weight.
  • Figure 5 shows effects of two weeks administration of test compound 7 or vehicle administration on glucose homeostasis. Animals were fasted overnight, and blood drawn for analysis of (A) fasting blood glucose (B) fasting plasma insulin and (C) homeostafic model assessment-insulin resistance (HOMA-IR).
  • A fasting blood glucose
  • B fasting plasma insulin
  • C homeostafic model assessment-insulin resistance
  • patient may be used interchangeably and refer to either a human or a non-human animal. These terms include mammals such as humans, primates, livestock animals (e.g., bovines, porcines), companion animals (e.g., canines, felines) and rodents (e.g., mice and rats).
  • livestock animals e.g., bovines, porcines
  • companion animals e.g., canines, felines
  • rodents e.g., mice and rats.
  • solvate in the context of the present invention refers to a complex of defined stoichiometry formed between a solute (in casu, a peptide conjugate or pharmaceutically acceptable salt thereof according to the invention) and a solvent.
  • the solvent in this connection may, for example, be water, ethanoi or another pharmaceutically acceptable, typically small-molecular organic species, such as, but not limited to, acetic acid or lactic acid.
  • a solvate is normally referred to as a hydrate.
  • agonist refers to a substance (ligand) that activates the receptor type in question.
  • ligand a substance that activates the receptor type in question.
  • a-amino acids such as sarcosine (Sar), norleucine (Nle) and o aminoisobutyric acid (Aib). All amino acid residues in peptides of the invention are preferably of the L-configuration. However, D-configuration amino acids may also be present.
  • sequences disclosed herein are sequences incorporating an "Hy-" moiety at the amino terminus (N-terminus) of the sequence, and either an a -OH" moiety or an “TMNH 2 " moiety at the carboxy terminus ⁇ C-terminus) of the sequence.
  • an "Hy-" moiety at the N-terminus of the sequence in question indicates a hydrogen atom [e.g., R 1 - Hy- in formulas I and la; corresponding to the presence of a free primary or secondary amino group at the H- terminus], while an !!
  • TM H 2 or an "TM H 2 " moiety at the C-ferminus of the sequence indicates a hydroxy group [e.g., R 2 - OH in formulas I and la; corresponding to the presence of a carboxy (COOH) group at the C-terminus] or an amino group [e.g., R 2 HH 2 in formulas I and la; corresponding to the presence of an amido (CONH 2 ) group at the C-terminus], respectively.
  • a C-termsnal "TM OH" moiety may be substituted for a C-termina! "-NH 2 " moiety, and vice-versa.
  • a “conservative substitution” means that an amino acid residue belonging to a certain position of the native human GLP-2 peptide sequence has been exchanged with an amino acid residue belonging to the same group (I, II, HI, IV, V, 1 , 2, 3) as defined in the following table:
  • a “non-conservative" substitution as used herein means any substitution other than a conservative substitution of an amino acid residue of the native human GLP-2 sequence, e.g., substitution with a non-protein non-natural amino acid (Sar, NIe, Aib) or substituting with an amino acid which does not belong to the same group,
  • a compound of the invention has at least one GLP-2 and one GLP-1 biological activity. Exemplary activities include reducing the permeability of the intestine and altering inflammation in the intestine.
  • a GLP-2 analogue of the invention has at least 60% amino acid sequence identity to wild-type GLP-2 (1-33) having the sequenceHis-Ala- Asp ⁇ Gly-Ser-Phe-Ser ⁇ Asp-Glu-iv1et-Asn-Thr-lle-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp- Phe-ISe-Asn-Trp-Leu-ISe-Gln-Thr-Lys-lle-Thr-Asp.
  • a GLP-2 analogue of the invention may have from between about 50% to 88% sequence identity, e.g., between about 60% - 80% and in certain embodiments, at least 63%, 66%, or 69% sequence identity.
  • Percent ⁇ %) amino acid sequence identity with respect to the GLP-2 polypeptide sequences is defined as the percentage of amino acid residues in a candidate sequence that are identical to the amino acid residues in the wild-type
  • Sequence alignment can be carried out by the skilled person using techniques well known in the art for example using publicly available software such as BLAST, BLAST2 or Align software. For examples, see Altschul et al., ethods in Enzymology 266:480-480 (1998) A Pearson et al., Genomics-46: 24-36, 1997, and the alignment program on the website at molbioLsoton.ac.uk/compute/align.
  • percent sequence identities used herein and in accordance with the present invention may be determined using these programs with their default settings. More generally, the skilled worker can readily determine appropriate parameters for determining alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a GLP-2 analogue of the invention comprises more than one substitution (i.e., more than one substitution relative to the wild type GLP-2 sequence given above) at positions X2, X3, X5, X7, X8, X9, X10, X1 1 , X12, X13.X14, X15, X16, X17, X19, X2Q, X21 , X24, X27, X28, X29, X3Q, X31 , X32 and X33.
  • a GLP-2 analogue of the invention comprises more than one substitution (i.e., more than one substitution relative to the wild type GLP-2 sequence given above) at positions X2, X3, X5 contour X7, X8, X9, X10, X1 1 , X12, X13, X15, X16, X17, X20, X21 , X24, X27, X28, X29, X30 s X31 , X32 and X33.
  • amino acid residues in positions X28, X29, X30, X31 , X32 and X33 are optionally deleted.
  • a polar or charged residue e.g., Gin, Lys or Giu
  • a polar or charged amino acid in position 17 may alter the receptor selectsvsty of GLP-2 peptides or analogues thereof, resulting in dual agonistic peptides activating both the GLP-1 and GLP-2 receptors.
  • a small amino acid residue e.g., Gly, Ser or Ala
  • a GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32.
  • a GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 12, 16, 17, 20, 24, 27, 28 and 32.
  • the GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 16, 17, 20 and 24.
  • Exemplary compounds of the invention (derived from Formula I, Formula la or Formula II) are described below, wherein said compounds may be modified ai the N-terminus and C-terminus as described for R 1 and R 2 and including a
  • Hy-H-Aib-DGSFSDEMNTILDNQAARDFINWLIQTKITD-OH Hy-HGDGSFSDEIvlNTILD KAARDFSNWLfQTKSTD-OH;
  • Compound 2 Hy-HGDGSFSDEyNTILDGQAARDFINWLIQTK-NH 2 ;
  • Hy-H-Aib-DGSFSDELNTILDGKAARDFINWLIQTK-NH 2 (Compound 10 ⁇ Hy-HGDGSFSSELATILDGQAARDFIAWLIQTKITD-OH; (Compound 1 1 ⁇
  • the present invention provides the use of GLP-2 analogues of the Invention for the preparation of a medicament for the treatment and/or prevention of gastrointestinal inflammation, e.g., low level gastrointestinal inflammation related to diabetes, [0124]
  • the present invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue as defined herein.
  • the present invention provides an expression vector comprising the above nucleic acid sequence, optionally in combination with sequences to direct its expression, and host cells transformed with the expression vectors.
  • the host cells are capable of expressing and secreting the GLP-2 analogue.
  • the present invention provides a method of producing the GLP-2 analogue, the method comprising culturing the host cells under conditions suitable for expressing the GLP-2 analogue and purifying the GLP-2 analogue thus produced.
  • the invention further provides a nucleic acid of the invention, an expression vector of the invention, or a host ceil capable of expressing and secreting a GLP-2 analogue of the invention, for use in therapy.
  • the nucleic acid, expression vector and host cells may be used for treatment of any of the disorders described herein which may be treated with the GLP-2 analogues themselves.
  • References to a therapeutic composition comprising a GLP-2 analogue of the invention, or administration of a GLP-2 analogue of the invention should therefore be construed to encompass administration of a nucleic acid, expression vector or host ceil of the invention except where the context demands otherwise.
  • the present invention provides the use of a nucleic acid molecule, an expression vector, or a host cell as defined herein, in the preparation of a medicament for the treatment and/or prevention of gastrointestinal inflammation.
  • the present invention provides a method of treating a low level gastrointestinal inflammation related to diabetes
  • the present invention provides a method of treating or preventing low levei gastrointestinal inflammation related to diabetes in a patient in need thereof, the method comprising administering an effective amount a nucleic acid, expression vector or host cell of the invention.
  • the GLP-2 analogues of the invention have one or more amino acid substitutions, deletions, inversions, or additions compared to native GLP- 2.
  • This definition also includes the synonym terms GLP-2 mimetics and/or GLP-2 agonists.
  • an analogue of the present invention may additionally have a chemical modification of one or more of its amino acid side groups, a-carbon atoms, terminal amino group, or terminal carboxylic acid group, A chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties.
  • Modifications at amino acid side groups include, without limitation, acylation of lysine ⁇ -amino groups, -alkylation of arginine, histidine, or lysine, alkylation of glutamic or aspartic carboxylic acid groups, and deamidation of giutamine or asparagine.
  • Modifications of the N-terminal amino group includes, without limitation, des-amino, N-lower alkyl, N-di-iower alkyi, and N-acyl modifications.
  • Modifications of the C-terminal carboxy group include, without limitation, amide, lower alkyl amide, dia!kyl amide, and lower alkyl ester modifications.
  • a lower alkyl is C r C 4 alkyl.
  • one or more functional groups in side chains or terminal groups may be protected by protective groups known to the skilled worker.
  • the alpha-carbon of an amino acid may be mono- or di- methylated.
  • an oxidatively stable Met-replacement amino acid means one which is selected among the group consisting of Met(O) (methionine sulfoxide), Met(0) 2 (methionine sulfone), Val, Sle, Ser and preferably Sle, Leu, Vai, Lys or Ser.
  • One or more of the amino acid side chains in a compound employed in the context of the invention may be conjugated to a lipophilic subsiituent Z 1 .
  • a lipophilic subsiituent binds albumin in the blood stream, thus shielding the compounds employed in the context of the invention from enzymatic degradation,, which can enhance the half-life of the compounds.
  • the lipophilic substituent may also modulate the potency of the compound, e.g.. with respect to the GLP-2 receptor and/or the GLP-1 receptor.
  • only one amino acid side chain is conjugated to a lipophilic substituent.
  • two amino acid side chains are each conjugated to a lipophilic substituent.
  • three or even more amino acid side chains are each conjugated to a lipophiiic substituent.
  • the lipophiiic substituent Z may be covIERly bonded to an atom in the amino acid side chain, or alternatively may be conjugated to the amino acid side chain by one or more spacers Z 2 .
  • conjugated is used here to describe the covalent attachment of one identifiable chemical moiety to another, and the structural relationship between such moieties. It should not be taken to imply any particular method of synthesis.
  • the one or more spacers Z 2 when present, are used to provide a spacing between the compound and the lipophilic moiety.
  • a lipophilic substituent may be attached to an amino acid side chain or to a spacer via an ester, a sulphonyl ester, a thioester, an amide or a sulphonamsde.
  • a lipophilic substituent may include an acyl group, a sulphonyl group, an N atom, an O atom or an S atom which forms part of the ester, sulphonyl ester, thioester, amide or sulphonamide.
  • an acyl group in the lipophilic substituent forms part of an amide or ester with the amino acid side chain or the spacer.
  • the lipophilic substituent may include a hydrocarbon chain having 10 to 24 carbon (C) atoms, e.g. 10 to 22 C atoms, e.g. 10 to 20 C atoms. Preferably. ⁇ it has at least 11 C atoms, and preferably it has 18 C atoms or fewer.
  • the hydrocarbon chain may contain 12, 13, 14, 15, 18, 17 or 18 carbon atoms.
  • the hydrocarbon chain may be linear or branched and may be saturated or unsaturated.
  • the hydrocarbon chain is preferably substituted with a moiety which forms part of the attachment to the amino acid side chain or the spacer, for example an acyl group, a sulphonyl group, an N atom, an O atom or an S atom.
  • the hydrocarbon chain is substituted with an acyl group, and accordingly the hydrocarbon chain may be part of an aikanoyl group, for example a dodecanoyl, 2-butyloctanoyl, tetradecanoyl, hexadecanoyl, heptadecanoyl, octadecanoyl or eicosanoyl group.
  • the lipophilic substituent Z 1 may be conjugated to the amino acid side chain by one or more spacers Z 2 , When present, the spacer is attached to the lipophilic substituent and to the amino acid side chain.
  • the spacer may be attached to the lipophilic substituent and to the amino acid side chain independently by an ester, a sulphonyl ester, a thioester, an amide or a suiphonamide. Accordingly, it may include two moieties independently selected from acyl, sulphonyl, an N atom, an O atom or an S atom.
  • the spacer may consist of a linear CM 0 hydrocarbon chain or more preferably a linear C 1 .5 hydrocarbon chain. Furthermore the spacer can be substituted with one or more substituents selected from Ci-6 aikyl, 0 1-6 alkyl amine, alkyl hydroxy and C 1-8 a!kyl carboxy.
  • the spacer may be, for example, a residue of any naturally occurring or unnatural amino acid.
  • the spacer may be a residue of Gly, Pro, Ala, Val, Leu, lie, Met, Cys, Phe, Tyr, Trp, His, Lys, Arg, Gin, Asn, ct-Giu, y-G!u, ⁇ -Lys, Asp, Ser, Thr, Gaba, Alb, ⁇ -Ala (i.e., 3 ⁇ amsnopropanoyi), 4 aminobutanoyi, 5- aminopentanoy!, 8 ⁇ aminohexanoyl, 7 ⁇ aminoheptanoyf, 8-aminooctanoyi, 9 ⁇ aminononanoy!, 10-aminodecanoyi or 8 ⁇ amino-3.6-dioxaoctanoyl.
  • the spacer is a residue of Glu, ⁇ -Glu, ⁇ -Lys, ⁇ -Ala (i.e., 3- aminopropanoyl), 4-aminobutanoyl, 8- aminooctanoy! or 8-amino-3,8-dioxaoctanoyl.
  • ⁇ -Glu and isoGlu are used interchangeabiy.
  • the amino acid side chain to which the lipophilic substituent is conjugated may be a side chain of a Glu, Lys, Ser, Cys, Dbu, Dpr or Orn residue. For example, it may be a side chain of a Lys, Glu or Cys residue.
  • the amino acid side chain includes an carboxy, hydroxyl, thiol, amide or amine group, for forming an ester, a sulphonyl ester, a thioester, an amide, or a suiphonamide with the spacer or lipophilic substituent.
  • the side chain of a Lys residue is covalently attached to a y-Glu spacer (Z 2 ) via an amide linkage.
  • a hexadecanoyl group (Z 1 ) is covalently attached to the ⁇ -Glu spacer via an amide linkage.
  • ⁇ -Glu can also be referred to as isoGlu, and a hexadecanoyl group as a palmitoyl group.
  • the notation is equivalent to the notations (isoGiu(Paim)) or ⁇ isoGlu(Paimitoyl ⁇ ) as used for example in
  • a GLP2- analogue of the invention has a lipophilic substituent as described above conjugated to an amino acid at one or more of positions corresponding to positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32 of native GLP-2.
  • a GLP2- analogue of the invention has a lipophilic substituent as described above conjugated to an amino acid at one or more of positions corresponding to positions 12, 16, 17, 20, 24, 27, 28 and 32 of native GLP- 2.
  • the peptides of the invention might also be provided in the form of a salt or other derivative.
  • Salts include pharmaceutically acceptable salts such as acid addition salts and basic salts. Examples of acid addition salts include hydrochloride salts, citrate salts, lactate salts, malate salts and acetate salts.
  • Examples of basic salts include salts where the cation is selected from alkali metals, such as sodium and potassium, alkaline earth metals, such as calcium, and ammonium ions *N(R 3 ) 3 (R 4 ⁇ , where R 3 and R 4 independently designates optionally substituted C-i. 6 ⁇ aikyl, optionally substituted C 2 .6-alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • alkali metals such as sodium and potassium
  • alkaline earth metals such as calcium
  • ammonium ions *N(R 3 ) 3 (R 4 ⁇ where R 3 and R 4 independently designates optionally substituted C-i. 6 ⁇ aikyl, optionally substituted C 2 .6-alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • R 3 and R 4 independently designates optionally substituted C-i. 6 ⁇ aikyl, optionally substituted C 2 .6-alken
  • GLP-2 analogues of the invention include coordination complexes with metal ions such as Mn 2 * and Zn 2+ , esters such as in vivo hydrolysable esters, free acids or bases, hydrates, prodrugs or lipids.
  • Esters can be formed between hydroxy! or carboxylic acid groups present in the compound and an appropriate carboxylic acid or aicohol reaction partner, using techniques well known in the art.
  • Derivatives which are prodrugs of the compounds are convertible in vivo or in vitro into one of the parent compounds.
  • prodrug form of the compound typically, at least one of the biological activities of compound will be reduced in the prodrug form of the compound, and can be activated by conversion of the prodrug to release the compound or a metabolite of it.
  • prodrugs include the use of protecting groups which may be removed in situ releasing active compound or serve to inhibit clearance of the drug in vivo,
  • GLP-2 analogues having an ECSO value of 1 nM or below, and preferably below 1 nM, are defined as GLP-2 agonists.
  • the present invention includes the following peptides further described in the experiments_beiow. Synthesis of GLP-2 analogues
  • the GLP-2 analogues may be synthesized in a number of ways including, for example, a method comprising:
  • nucleic acid fragments encoding the peptides of the invention are important chemical products.
  • a further aspect of the present invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention, where the peptide preferably is comprised of naturally occurring amino acids.
  • the nucleic acid fragments of the invention may be either DNA or RNA fragments.
  • the nucleic acid fragments of the invention will normally be inserted in suitable vectors to form cloning or expression vectors carrying the nucleic acid fragments of the invention.
  • suitable vectors to form cloning or expression vectors carrying the nucleic acid fragments of the invention.
  • Such novel vectors are also part of the invention. Details concerning the construction of these vectors of the invention will be discussed in context of transformed cells and microorganisms below.
  • the vectors can, depending on purpose and type of application, be in the form of plasmids, phages, cosmids, mini-chromosomes, or viruses, but naked DHA which is only expressed transiently in certain ceils also is an important vector.
  • Preferred cloning and expression vectors (plasmid vectors) of the invention are capable of autonomous replication, thereby enabling high copy-numbers for the purposes of high-level expression or high-level replication for subsequent cloning.
  • the general outline of a vector of the invention comprises the following features in the 5'to 3' direction and in operable linkage: a promoter for driving expression of fhe nucleic acid fragment of the invention, optionally a nucleic acid sequence encoding a leader peptide enabling secretion (to the extracellular phase or, where applicable, into the periplasma) of or a leader peptide for multiple use e.g. combined secretion, purification tag and enzymatic trimming to correct peptide or integration into fhe membrane of the polypeptide fragment, the nucleic acid fragment encoding the peptide of the invention, and optionally a nucleic acid sequence encoding a terminator.
  • a promoter for driving expression of fhe nucleic acid fragment of the invention optionally a nucleic acid sequence encoding a leader peptide enabling secretion (to the extracellular phase or, where applicable, into the periplasma) of or a leader peptide for multiple use e.g. combined secret
  • the vectors of the invention may be used to transform host cells to produce a GLP-2 analogue of the invention.
  • Such transformed cells which are also part of the invention, can be cuitured ceils or cell lines used for propagation of the nucleic acid fragments and vectors of the invention, or used for recombinant production of the peptides of the invention.
  • Preferred transformed cells of the invention are micro-organisms such as bacteria including, for example, bacteria from the genera Escherichia (e.g., E. coll), Bacillus (e.g., Bacillus subtilis), Salmonella, or Mycobacterium (preferably nonpathogenic, e.g., M. bovis BCG) ⁇ , yeasts (such as Saccbaromyces cerevisiae), and protozoans.
  • the transformed cells may be derived from a multicellular organism, e.g., fungal celis, insect cells, plant cells, or mammalian cells (e.g., cells derived from a human).
  • the transformed cell is capable of replicating a nucleic acid fragment of the invention.
  • Cells expressing a nucleic fragment of the invention are preferred useful embodiments of the invention. They can be used for small-scale or large-scale preparation of the peptides of the invention.
  • celis When producing a peptide of the invention by means of transformed cells, it is convenient, although not essential, for celis to either export the expression product into the culture medium or carry the expression product on the surface of the transformed cell.
  • plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell, are used in connection with a host.
  • the vector ordinarily carries a replication site, as well as marking sequences, which are capable of providing phenotypic selection in transformed cells.
  • E. coli may typically be transformed using pBR322 (although numerous other useful plasmids exist), a plasmid derived from an E. coli species (see, e.g., Bolivar et al., 1977).
  • the pBR322 plasmid contains genes for ampicillin and tetracycline resistance and, thus, provides easy means for identifying transformed cells.
  • the pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, promoters, which can be used by the prokaryotic microorganism for expression.
  • promoters most commonly used in prokaryotic recombinant D A construction include the befa-lactamase ⁇ penicillinase ⁇ and lactose promoter systems (Chang et al., 1978; Itakura et a!., 1977; Goeddei el ai., 1979) and a tryptophan (trp) promoter system (Goeddei et al., 1979; EP 0 038 778 A), While these are the most commonly used, other microbial promoters have been discovered and utilized, and details concerning their nucleotide sequences have been published, enabling a skilled worker to ligate them functionally with plasmid vectors (Siebwenlist et al., 1980).
  • eukaryotic microbes such as yeast cultures may also be used.
  • a promoter also should be capable of driving expression. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among eukaryotic microorganisms, although a number of other strains are commonly available. For example, Pichia stiptis and
  • Schizosaccharomyces pombe also may be used.
  • the plasmid YRp7 for example, is commonly used (Stinchcomb et ai., 1979;
  • This plasmid already contains the trp I gene which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan (for example ATCC No. 44076 or PEP4-1 ) (Jones, 1977, The presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
  • Suitable promoting sequences in yeast vectors include the promoters for 3 ⁇ phosphoglycerate kinase (Hitzman et ai., 1980) or other glycolytic enzymes (Hess et al., 1968; Holland et al., 1978), such as enolase, glyceraldehyde-3 ⁇ phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose- 8-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase,
  • triosephosphate isomerase phosphoglucose isomerase
  • glucokinase glucokinase.
  • the termination sequences associated with these genes are also ligated into the expression vector 3' of the sequence desired to be expressed to provide polyadenyiation of the mRNA and termination.
  • Other promoters which have the additional advantage of transcription controlled by growth conditions ⁇ , are the promoter region for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, and the aforementioned glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization. Any plasmid vector containing a yeast-compatible promoter, origin of replication and termination sequences is suitable.
  • cultures of cells derived from multicellular organisms may also be used as hosts.
  • any such cell culture is workable, whether from vertebrate or invertebrate culture.
  • interest has been greatest in vertebrate cells, and propagation of vertebrate in culture (tissue culture) has become a routine procedure in recent years (Tissue Culture, 1973).
  • useful host ceil lines are VERO and HeLa cells, Chinese hamster ovary (CHQ) cell lines, and W138, BHK, COS-7 293, Spodoptera frugiperda (SF) cells
  • Expression vectors for such cells ordinarily include (if necessary) an origin of replication, a promoter located in front of the gene to be expressed, along with any necessary ribosome binding sites, RNA splice sites, polyadenylation site, and transcriptional terminator sequences.
  • control functions on the expression vectors are often provided by viral material.
  • promoters are derived from polyoma, Adenovirus 2, and most frequently Simian Virus 40 (SV40).
  • the early and late promoters of SV40 virus are particularly useful because both are obtained easily from the virus as a fragment, which also contains the SV40 viral origin of replication (Fiers et a!., 1978).
  • Smaller or larger SV40 fragments may also be used, provided there is included the approximately 250 bp sequence extending from the Hindlll site toward the Bgll site located in the viral origin of replication.
  • promoter or control sequences normally associated with the desired gene sequence provided such control sequences are compatible with the host cell systems.
  • An origin of replication may be provided either by construction of the vector to include an exogenous origin, such as may be derived from SV40 or another virus (e.g., Polyoma, Adenovirus, VSV, and BPV), or it may be provided by the host cell chromosomal replication mechanism. If the vector is integrated into the host cell chromosome, the latter is often sufficient.
  • analogues as fusion proteins, either by fusing the peptide to a fusion partner that can serve as an affinity tag (for ease of purification) and/or by having muitiple repeats of the peptide.
  • affinity tag for ease of purification
  • muitiple repeats of the peptide require presence of a suitable cleavage site for a peptidase.
  • the skiiled worker wiii know how to tailor the underlying genetic constructs.
  • the peptides of the invention can be purified by methods generally known in the art, including multi-step chromatography (e.g., ion- exchange, size-exclusion, and affinity chromatographic techniques).
  • peptides comprised of naturally occurring amino acids can be prepared in vitro in ceil free systems. This is especially expedient in cases where the peptides could be toxic for putative host cells.
  • the present invention also contemplates use of cell-free in vitro translation/expression in order to prepare the peptides of the invention.
  • peptide fragments are prepared using at least 2 separate steps or methods, followed by joining (e.g., ligating) the fragments to obtain the final peptide product.
  • the GLP-2 analogues of the invention have activity at both the GLP-1 and GLP-2 receptors.
  • EC 5 o values may be used as a numerical measure of agonist potency at a given receptor.
  • An EC 50 value is a measure of the concentration of a compound required to achieve half of that compound's maximal activity in a particular assay.
  • a compound having an EC 50 at a particular receptor which is lower than the EC 50 of a reference compound in the same assay may be considered to have higher potency at that receptor than the reference compound.
  • the GLP-2 analogues of the invention typically have higher activity at the GLP-1 receptor (e.g. the human GLP-1 receptor) than wild type human GLP-2 (hGLP- 2).
  • the GLP-2 analogues will have a lower EC 50 than wild type human GLP-2 or [Giy2] ⁇ hGLP-2 (i.e. human GLP-2 having glycine at position 2. also known as tedug!utide).
  • the ratio of the GLP-2 analogue's EC 50 to the EC 50 of hGLP-2 or [Gly2]- hGLP-2 is therefore typically less than 1 , It may, for example, be less than 0,5 or less than 0, 1 , or less than 0.01 , [0173]
  • the EC 50 at the GLP-1 receptor may be below 100 n , below 50nM, below 10ny, or more preferably below 1 ,0 nM, below 0.9 nM, below 0,8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0,1 nM, below 0,09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 n , below 0.01 nM, below
  • the GLP-2 analogues of the invention retain GLP-2 activity, although their potency at the GLP-2 receptor need not be the same as that of hGLP-2 or [Gly2] ⁇ hGLP-2. They may have lower potency as long as adequate levels of GLP-2 activity are retained. In any given assay for GLP-2 activity, the GLP-2 analogues may have a lower or higher EC 5Q than wild type human GLP-2 or [Gly2]-hGLP-2.
  • the ratio of the GLP-2 analogue's EC S0 to the EC 50 of hGLP-2 or [Gly2]-hGLP-2 in the same assay may, for example, be less than 200, less than 100, less than 10, less than 5, less than 1 , less than 0.1 , less than 0.5 or less than 0, 1.
  • the analogue of the invention may also be desirable to compare the ratio of EC 50 values at the GLP-2 and GLP-1 receptors for the analogue of the invention and for hGLP-2 or [Gly2]- hGLP ⁇ 2.
  • the analogue of the invention has an EC 50 [GLP-2] / EC S0 [GLP ⁇ 1 ] which is higher than the equivalent ratio for hGLP-2 or [Gly2]-hGLP-2 in the same assays, for example, the ratio for the analogue of the invention may be at least 2, at least 5 or at !east 10 times greater than that for hGLP-2 or [Gly2]-hGLP-2.
  • the GLP-2 analogues of the present invention, or salts or derivatives thereof may be formulated as pharmaceutical compositions prepared for storage or administration, and which comprise a therapeutically effective amount of a GLP-2 peptide of the present invention, or a salt or derivative thereof, in a pharmaceutically acceptable carrier.
  • the therapeutically effective amount of a compound of the present invention will depend on the route of administration, the type of mammal being treated, and the physical characteristics of the specific mammal under consideration. These factors and their relationship to determining this amount are well known to skilled
  • This amount and the method of administration can be tailored to achieve optimal efficacy so as to deliver the peptide to the large intestine, but will depend on such factors as weight, diet, concurrent medication and other factors, well known those skilled in the medical arts,
  • a pharmaceutical composition wherein a GLP-2 analogue of the invention, or a salt thereof, is present in an amount effective to treat or prevent stomach and bowel-reiated disorders.
  • salts of the compounds of the invention having an acidic moiety can be formed using organic and inorganic bases.
  • Suitable salts formed with bases include metal salts, such as alkali metal or alkaline earth metal salts, for example sodium, potassium, or magnesium salts; ammonia sails and organic amine salts, such as those formed with morphoiine, thiomorpholine, piperidine, pyrrolidine, a mono-, di- or t -iower alkylamine ⁇ e.g., ethyl-tert-butyl-, diethyl-, diisopropyl-, trietbyk, tributyl- or dimethylpropyiamine), or a mono-, di- or trihydroxy lower alkylamine (e.g., mono-, di ⁇ or triethanolamine).
  • metal salts such as alkali metal or alkaline earth metal salts, for example sodium, potassium, or magnesium salts
  • ammonia sails such as those formed with morph
  • salts can be formed using organic and inorganic acids.
  • salts can be formed from the following acids: acetic, propionic, lactic, citric, tartaric, succinic, fumaric, maleic, malonic, mandeiic, malic, phfhalic, hydrochloric,
  • Amino acid addition salts can also be formed with amino acids such as lysine, glycine, and phenylalanine.
  • a "therapeutically effective amount" of the peptides or pharmaceutical compositions of the present invention will vary depending upon the age, weight and mammalian species treated, the particular compounds employed, the particular mode of administration and the desired effects and the therapeutic indication. Because these factors and their relationship to determining this amount are well known, the determination of therapeutically effective dosage levels, the amount necessary to achieve the desired result of preventing and/or treating the intestine and stomach related diseases described herein, as well as other medical indications disclosed herein, will be within the skill of the skilled person.
  • a therapeutically effective amount is one which reduces symptoms of a given condition or pathology, and preferably which normalizes physiological responses in an individual with the condition or pathology. Reduction of symptoms or normalization of physiological responses can be determined using methods routine in the art and may vary with a given condition or pathology.
  • a therapeutically effective amount of one or more GLP-2 analogues of the invention or a pharmaceutical composition comprising one or more GLP-2 analogues of the invention is an amount which restores a measurable physiological parameter to substantially the same value (preferably to within 30%, more preferably to within 20%, and still more preferably, to within 10% of the value) of the parameter in an individual without the condition or pathology.
  • administration of the compounds or pharmaceutical composition of the present invention is commenced at lower dosage levels, with dosage levels being increased until the desired effect of
  • preventing/treating the relevant medical indication such as intestine and stomach related diseases is achieved. This may define a therapeutically effective amount.
  • a pharmaceutically effective amount for the peptides of the present invention, alone or as part of a pharmaceutical
  • compositions such doses may be between about 0.01 mg/kg and 100 mg/kg body weight, such as between about 0.01 mg/kg and 10 mg/kg body weight, for example between 10-100 micrograms/kg body weight.
  • a GLP-2 analogue of the invention may be formulated with a carrier that is pharmaceutically acceptable and is appropriate for delivering the peptide by the chosen route of administration.
  • peripheral parenteral routes include intravenous, intramuscular,
  • the present pharmaceutical composition comprises a GLP-2 analogue of the invention, or a salt or derivative thereof and a pharmaceutically acceptable carrier.
  • Suitable pharmaceutically acceptable carriers are those used conventionally with peptide-based drugs, such as diluents, excipients and the like.
  • Pharmaceutically acceptable carriers for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, IvSack Publishing Co. (A. R. Gennaro edit. 1985). For example, steriie saline and phosphate-buffered saline at slightly acidic or physiological pH may be used. Suitable pH buffering agents may be phosphate, citrate, acetate,
  • TRiS tris/hydroxymethyl)aminometbane
  • TAPS N ⁇ Tris(hydroxymethyl)methylTM3 ⁇ aminopropanesuiphonic acid
  • ammonium bicarbonate diethanolamine
  • histidine which is a preferred buffer, arginine, lysine, or acetate or mixtures thereof.
  • Preferred buffer ranges in certain embodiments are pH 4-8, pH 6.5-8, and more preferably pH 7-7.5.
  • propylparaben, phenol, benzyl alcohol, sodium benzoate, benzoic acid, benzyl- benzoate, sorbic acid, propanoic acid, esters of p-hydroxybenzoic acid may be provided in the pharmaceutical composition.
  • Stabilizers preventing oxidation, deamidation, isomerisation, racemisation, cyclisation, peptide hydrolysis, such as e.g. ascorbic acid, methionine, tryptophane, EDTA, asparagine, lysine, arginine, glutamine and glycine may be provided in the pharmaceutical composition.
  • Stabilizers preventing oxidation, deamidation, isomerisation, racemisation, cyclisation, peptide hydrolysis, such as e.g. ascorbic acid, methionine, tryptophane, EDTA, asparagine, lysine, arginine, glutamine and glycine may be provided in the pharmaceutical composition.
  • preventing aggregation, fibrillation and precipitation such as Sodium dodecy! sulphate, polyethylene glycol, carboxymethyl cellulose, cyciodextrine may aisojDe provided in the pharmaceutical composition.
  • Organic modifiers for solubilization or preventing aggregation such as ethanol, acetic acid or acetate and salts thereof may be provided in the pharmaceutical composition.
  • Isotonicity makers such as salts e.g. sodium chloride or most preferred carbohydrates e.g. dextrose, mannitol, lactose, trehalose, sucrose or mixtures thereof may be provided in the pharmaceutical composition.
  • Detergents such as Tween 20, Tween 80, SDS, Poioxamers e.g. Pluronic F-88, Pluronic F-127, may be provided in a pharmaceutical composition of the invention.
  • Dyes and flavoring agents also may be provided in the pharmaceutical composition.
  • a pharmaceutically acceptable acid addition salt of a GLP-2 analogue of the invention is provided for. Suspending agents also may be used.
  • Organic modifiers such as ethanoi, tertiary-buthanol, 2-propanol, ethanol, glycerol, and polyethylene glycol may be provided in a pharmaceutical formulation for lyophilization of a iyophilized product.
  • Bulking agents and isotonicity makers such as salt e.g. sodium chloride, carbohydrates e.g. dextrose, mannitol, lactose, trehalose, sucrose or mixtures thereof, amino acids (e.g., glycine and glutamate), or excipients such as cysteine, lecithin or human serum albumin, or mixtures thereof, may be provided in the pharmaceutical composition for lyophilization.
  • the pharmaceutical compositions of the present invention may be formulated and used as tablets, capsules or elixirs for oral administration;
  • suppositories for rectal administration preferably sterile solutions or sterile powder or suspensions for injectable administration; and the like.
  • the dose and method of administration may be tailored to achieve optimal efficacy, but will depend on factors such as weight, diet, concurrent medication, which are recognizable to the skilled worker.
  • injectable pharmaceutical compositions can be prepared in conventional forms, either as aqueous solutions or suspensions;
  • Diluents for reconstitution of the lyophilized product may be, for example, chosen from the buffers listed above, or selected from water, saline, dextrose, mannitol, lactose, trehalose, sucrose, lecithin, albumin, sodium glufamate, cysteine hydrochlorides or water for injection with the addition of detergents T such as Tween 20, Tween 80, poloxamers (e.g., pluronic F-68 or pluronic F-127), polyethylene glycol, and/or with the addition of preservatives such as para-, meta-, and oriho- cresoi, methyl- and propylparaben, phenol, benzyl alcohol, sodium benzoate, benzoic acid, benzyl-benzoate, sorbic acid, propanoic acid, esters of p-hydroxybenzoic acid, and/or with addition of an organic modifier such as ethanol, acitic acid, citric acid,
  • the injectable pharmaceutical compositions may contain minor amounts of non-toxic auxiliary substances, such as wetting agents, or pH buffering agents.
  • Absorption enhancing preparations e.g., liposomes, detergents and organic acids also may be utilized.
  • the compounds are formulated for administration by infusion, e.g., when used as liquid nutritional supplements for patients on total parenteral nutrition therapy (for example neonatals, or patients suffering from cachexia or anorexia), or by injection, for example subcutaneously, intraperitoneal or intravenously, and are accordingly utilized as aqueous solutions in sterile and pyrogen-free form and optionally buffered to physiologically tolerable pH, e.g., a slightly acidic or physiological pH.
  • Formulation for intramuscular administration may be based on solutions or suspensions in plant oil, e.g. canola oil, corn oil or soy bean oil. These oil based formulations may be stabilized by antioxidantSi e.g. BHA (butylated hydroxianisoie) and BHT (butylated hydroxytoluene).
  • the GLP-2 analogues of the invention may be administered in a vehicle, such as distilled water or in saline, phosphate buffered saline, 5% dextrose solutions or oils.
  • a vehicle such as distilled water or in saline, phosphate buffered saline, 5% dextrose solutions or oils.
  • the soiubility of a GLP-2 analogue of the invention may be enhanced, if desired, by incorporating a solubility enhancer, such as a detergents and/or emulsifier.
  • the aqueous carrier or vehicle can be supplemented for injectable use with an amount of gelatin that serves to depot the GLP-2 analogue at or near the site of injection, to provide a slow release to the desired site of action.
  • Alternative gelling agents such as hyaluronic acid, may also be useful as depot agents.
  • the peptide compounds of the present invention may be used alone-,- or in combination with compounds having an anti-inflammatory effect. Without being bound by theory, such a combination treatment may reinforce the beneficial treatment effects of the peptide analogues of the invention.
  • the therapeutic dosing and regimen most appropriate for patient treatment will , of course ⁇ vary with the disease or condition to be treated, and according to the patient's weight and other parameters. Without wishing to be bound by any particular theory, it is expected that doses, in the microgram/kg or mg/kg range, and shorter or longer duration or frequency of treatment may produce therapeutically useful results, such as a statistically significant increase,, particularly in small bowel mass.
  • the therapeutic regimen may include the administration of maintenance doses appropriate for preventing tissue regression that occurs following cessation of initial treatment.
  • the dosage sizes and dosing regimen most appropriate for human use may be guided by the results obtained by the present invention, and may be confirmed in properly designed clinical trials.
  • An effective dosage and treatment protocol may be determined by conventional means, starting with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Numerous factors may be taken into consideration by a clinician when determining an optimal dosage for a given subject. Such
  • a human dose of a GLP-2 peptide according to the invention may in one embodiment be from about 10 microgram/kg body weight/day to about 10 mg/kg/day, preferably from about 50 microgram/kg/day to about 5 mg/kg/day, and most preferably about 100 microgram/kg/day to 1 mg/kg/day.
  • GLP-2 analogues of the present invention are useful as a
  • Low grade inflammation may include, but is not limited to: metabolic syndrome, obesity (e.g. abdominal obesity), diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, alzheimer, arthritis, hypertension, dys!ipidaemia and stroke.
  • Gastrointestinal disorders include the disorders of the upper gastrointestinal tract of the oesophagus, may be treated by administering an effective amount of a GLP-2 analogue of the invention, or a salt thereof as described herein.
  • Stomach and intestinal-related disorders include ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Eilison
  • Particular conditions that may be treated with a GLP-2 analogue of the invention include the various forms of sprue including celiac sprue which results from a toxic reaction to alpha-gliadin from heat and may be a result of gluten-induced enteropathy or celiac disease, and is marked by a significant loss of villae of the small bowel; tropical sprue which results from infection and is marked by partial flattening of the villae; hypogammagiobulinemic sprue which is observed commonly in patients with common variable immunodeficiency or hypogammaglobulinemia and is marked by significant decrease in villus height.
  • the therapeutic efficacy of the GLP-2 analogue treatment may be monitored by enteric biopsy to examine the villus morphology, by biochemical assessment of nutrient absorption, by non invasive determination of intestinal permeability, by patient weight gain, or by amelioration of the symptoms associated with these conditions.
  • stomach related disorders including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens),
  • aetiology e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens
  • GLP-2 analogues of the invention include in addition to the above mentioned radiation enteritis, infectious or post-infectious enteritis, and small intestinal damage due to cancer-chemotherapeutic or toxic agents.
  • the GLP-2 analogues may also be used for the treatment of malnutrition, for example cachexia and anorexia.
  • a particular embodiment of the invention is concerned with using the present peptides for the prevention and/or treatment of intestinal damage and dysfunction.
  • the stem cells of the small intestinal mucosa are particularly susceptible to the cytotoxic effects of chemotherapy due to their rapid rate of proliferation (Keefe et aL, Gut 2000; 47: 632-7).
  • Administration of the present GLP-2 peptide agonists may enhance trophic effect in the intestinal crypts and rapidly provide new cells to replace the damaged intestinal epithelium following chemotherapy and/or radiation therapy,
  • a goal to be achieved by administering the GLP-2 analogues of the invention is to reduce morbidity related to gastrointestinal damage of patients undergoing
  • Concomitant prophylactic or therapeutic treatment may be provided in accordance with the present invention to patients undergoing or about to undergo radiation therapy.
  • Gastrointestinal mucositis after anti-cancer chemotherapy is an increasing problem that is essentially untreatable once established, although it gradually remits.
  • Studies conducted with the commonly used cytostatic cancer drugs 5-FU and irinotecan have demonstrated that effective chemotherapy with these drugs predominantly affects structural integrity and function of the small intestine , , , while the colon is less sensitive and mainly responds with increased mucus formation (Gibson et aL, J Gastroenterol Hepatol. 18(9): 1095-1100, 2003; Tamaki et aL, J Int Med Res. 31 (1 ):6-16, 2003).
  • the invention describes a method of treating DPP-IV (dipeptidylpeptidase-IV) mediated conditions by administering to a patient in need thereof an effective amount of a GLP-2 analogue, or a salt thereof.
  • DPP-IV dipeptidylpeptidase-IV
  • Such diseases include conditions in which the DPP-IV enzyme is over expressed.
  • the pharmaceutical composition may in one embodiment be formulated to cause slow release of said GLP-2 analogue, or a salt or derivative thereof as described above.
  • the present peptides may be employed in a method of treating neo-natals by administering an effective amount of a GLP-2 analogue, or a salt thereof, of the invention. Complications with feeding neonatals due to the lack of development of the intestine may be overcome by using the peptide agonists of the invention.
  • the invention describes a method of treating DPP-IV (dipeptidylpeptidase-IV) mediated conditions by administering to a patient in need thereof an effective amount of a GLP-2 analogue, or a salt thereof, of the invention.
  • diseases include conditions in which the DPP-IV enzyme is over expressed.
  • Peptides were synthesized batahwise in a polyethylene vessei equipped with a polypropylene filter for filtration using 9-fluorenylmefhyloxycarbonyl (Fmoc) as N-a- amino protecting group and suitable common protection groups for side-chain functionalities.
  • Fmoc 9-fluorenylmefhyloxycarbonyl
  • an Fmoc-amino acid in DMF/DCM (2:1 ; 0.2 M; 5 ml) was added to the resin in a CEM Discover microwave unit together with COMU/DMF (0.5 M 2 ml) and DIPEA/DIVfF (2.0 ; 1 ml).
  • the coupling mixture was heated to 75°C for 5 min while nitrogen was bubbled through the mixture.
  • the resin was then washed with NMP (4 x 10 ml).
  • piperidine/DMF (20%; 10 mi) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40°C).
  • the reaction vessel was drained and a second portion of piperidine/DMF (20%; 10 ml) was added and heated (75°C; 3 min.) again.
  • the resin was then washed with DMF (8 x 10 ml).
  • Fmoc-Lys(ivDde)-OH or alternatively another amino acid with an orthogonal side chain protective group is introduced at the position of the acyiation.
  • the N- terminal of the peptide backbone is then Boc-protecied using Boc20 or alternatively by using a Boc-protected amino acid in the last coupling.
  • the orthogonal side chain protective group is selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 x 15 min.
  • the unprotected lysine side chain is first coupled with Fmoc-G!u-OtBu or another spacer amino acid, which is deprotected with piperidine and acylated with a lipophilic moiety using the peptide coupling methodology as described above.
  • Abbreviations employed are as follows: ivDde: 1- ⁇ 4,4-dimethy!-2,8-dioxocyclohexy1idene)3-methyl ⁇ buiyl
  • TIS triisopropylsilane
  • Fmoc-protected amino acids were purchased from Advanced ChemTech (ACT) in suitable side-chain protected forms.
  • Coupling reagent diisopropylcarbodiimide was purchased from Riede! de-Haen, Germany,
  • Diisopropylethylamine (D!EA) was purchased from Aldrich, Germany, piperidine and pyridine from Riedel-de Haen, Frankfurt, Germany.
  • Ethandithioi was purchased from Riedel-de Haen, Frankfurt, Germany.
  • 3,4-dihydro-3-hydroxy-4-oxo- 1 ,2,3-benzotriazine (Dhbt-OH), 1-hydroxybenzotriazole (HOBt) (HOAt) were obtained from Fiuka, Switzerland. Coupling procedures
  • the amino acids were coupled as in situ generated HObt or HOAi esters made from appropriate N ⁇ a ⁇ protected amino acids and HObt or HOAt by means of DIG in DMF. Acylations were checked by the ninhydrin test performed at 80 °C in order to prevent Fmoc deprotection during the test (Larsen, B, D. and Holm. A., Int. J. Peptide Protein Res. 43, 1994, 1-9).
  • Buffer system Buffers: A: 0,1 % TFA in MQV; B: 0,085% TFA, 10% QV, 90% MeC . Gradient: 0-37 min. 0-40% B
  • the peptides were dissolved in super gradient methanol (Labscan, Dublin, Ireland), mi!li-Q water (Millipore, Bedford i MA) and formic acid (Merck, Damsfadt, Germany) (50:50:0,1 v/v/v) to give concentrations between 1 and 10 mg/rnL
  • the peptide solutions (20 mi) were analysed in positive polarity mode by ESI-TOF-ivIS using a LCT mass spectrometer (Micromass, Manchester, UK) accuracy of +/- 0.1 m/z, [02271
  • the peptide product was collected and the identity of the peptide was confirmed by ES-MS. This procedure was used for the synthesis of all peptides exemplified further below.
  • a cAMP AlphaScreen® assay from Perkin Elmer was used to quantitate a cAMP response to a GLP-2 analogue.
  • Tedug!utide was the reference compound in this assay and has an EC 50 of approximately 0.01 nM.
  • Test compounds inducing an increase in the intracellular level of cAMP were tested in this assay, and the response normalized relative to a positive and negative control to calculate the EC 50 and maximal response from the concentration response curve. The results are listed in Table 2.
  • the DNA encoding the GLP-1-R was amplified by PGR using primers encoding terminal restriction sites for subcioning.
  • the 5'-end primers additionally encoded a near Kozak consensus sequence to ensure efficient translation,
  • the fidelity of the DNA encoding the GLP-1-R was confirmed by DNA sequencing.
  • the PCR products encoding the GLP-1-R were subcioned info a mammalian expression vector containing a neomycin (G418) resistance marker,
  • the mammalian expression vectors encoding the GLP-1-R were transfected into HEK293 ceils by a standard calcium phosphate transfection method.
  • the hGLP2 ⁇ R was purchased from fv RC-geneservice, Babraham,
  • primers for subcloning were obtained from DNA- Technology, Risskov, Denmark.
  • the 5' and 3 ! primers used for the PCR reaction include terminal restriction sites for cloning and the context of the 5' primer is modified to a Kozak consensus without changing the sequence of the product encoded by the GRP.
  • a standard PCR reaction was run using Image clone 5363415 (1 1924-117) as a template with the above mentioned primers and Polymerase Herculase II Fusion in a total vol. of 50 ⁇ .
  • the generated PCR product was purified using GFX PCR and Gel band purification kit, digested with restriction enzymes and cloned into the
  • HEK293 cells were transfected using the Lipofectamine PLUS transfection method. The day before transfection, HEK293 cells were seeded in two T75 flasks at a density of 2x10 6 cells / T75 flask in cell culturing medium without antibiotics. On the day of transfection, cells were washed with 1 DPBS and medium was replaced with Optimem to a voiume of 5 mL / T75 flask before addition of Lipofectamine-piasmid complexes were added gently and drop wise to the cells in T75 flasks and replaced with growth medium after 3 hours and again to growth medium supplemented with 500Mg/mL G418 after 24 hours. After 4 weeks in G418 selection, colonies were picked and tested in a functional assay. One colony was selected for use in compound profiling.
  • Exendin-4 (ZP24) was used as reference compound for GLP1 receptor activation and Teduglutide (ZP1559) as reference compound for GLP2 receptor activation, .
  • Data from test compounds eliciting an increase in the intracellular level of cAIVP were normalized relative to the positive and negative control (vehicle) to calculate the EC 50 and maximal response from the concentration response curve. The results are listed in Table 2.
  • mice Normal chow-fed C57BL/8J male mice were used. The mice were kept in standard housing conditions (light-, temperature-, and humidity-controlled room (12:12 h light-dark cycle, with lights on at 06.00-18.00 h; 24 °C; 50% relative humidity)), and each dosing group consisted of 10 animals.
  • Test compound increased intestinal weight in a dose dependant manner ( Figure 3).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Endocrinology (AREA)
  • Diabetes (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Developmental Biology & Embryology (AREA)
  • Insects & Arthropods (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Virology (AREA)
  • Biotechnology (AREA)
  • Reproductive Health (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Cardiology (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Heart & Thoracic Surgery (AREA)
PCT/EP2013/059320 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (glp-2) analogues Ceased WO2013164484A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
JP2015509462A JP6298044B2 (ja) 2012-05-03 2013-05-03 グルカゴン様ペプチド−2(glp−2)類似体
BR112014027345A BR112014027345A2 (pt) 2012-05-03 2013-05-03 análogos de peptídeo 2 semelhante ao glucagon (glp-2)
CA2872315A CA2872315A1 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (glp-2) analogues
US14/398,297 US9453064B2 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (GLP-2) analogues
CN201380029907.4A CN104540850B (zh) 2012-05-03 2013-05-03 胰高血糖素样肽2(glp-2)类似物
HK15108935.4A HK1208238B (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (glp-2) analogues
EP13721953.1A EP2844670B1 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (glp-2) analogues
MX2014013319A MX356958B (es) 2012-05-03 2013-05-03 Análogos de péptido-2 tipo glucagón (glp-2).
KR1020147033951A KR20150006052A (ko) 2012-05-03 2013-05-03 글루카곤-유사 펩타이드-2 (glp-2) 유사체
EA201491934A EA028929B1 (ru) 2012-05-03 2013-05-03 Аналоги глюкагоноподобного пептида-2 (glp-2)
AU2013255752A AU2013255752B2 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (GLP-2) analogues
IN9782DEN2014 IN2014DN09782A (https=) 2012-05-03 2014-11-19
US15/238,126 US9969787B2 (en) 2012-05-03 2016-08-16 Glucagon-like-peptide-2 (GLP-2) analogues
US15/950,235 US10253080B2 (en) 2012-05-03 2018-04-11 Glucagon-like-peptide-2 (GLP-2) analogues

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261642447P 2012-05-03 2012-05-03
US61/642,447 2012-05-03
US201361785852P 2013-03-14 2013-03-14
US61/785,852 2013-03-14

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/398,297 A-371-Of-International US9453064B2 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (GLP-2) analogues
US15/238,126 Continuation US9969787B2 (en) 2012-05-03 2016-08-16 Glucagon-like-peptide-2 (GLP-2) analogues

Publications (1)

Publication Number Publication Date
WO2013164484A1 true WO2013164484A1 (en) 2013-11-07

Family

ID=48428462

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/059320 Ceased WO2013164484A1 (en) 2012-05-03 2013-05-03 Glucagon-like-peptide-2 (glp-2) analogues

Country Status (13)

Country Link
US (3) US9453064B2 (https=)
EP (1) EP2844670B1 (https=)
JP (1) JP6298044B2 (https=)
KR (1) KR20150006052A (https=)
CN (1) CN104540850B (https=)
AU (1) AU2013255752B2 (https=)
BR (1) BR112014027345A2 (https=)
CA (1) CA2872315A1 (https=)
EA (1) EA028929B1 (https=)
IN (1) IN2014DN09782A (https=)
MX (1) MX356958B (https=)
TR (1) TR201802689T4 (https=)
WO (1) WO2013164484A1 (https=)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015086729A1 (en) * 2013-12-13 2015-06-18 Sanofi Dual glp-1/gip receptor agonists
WO2015086731A1 (en) * 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists
WO2016066818A1 (en) * 2014-10-31 2016-05-06 Gubra Aps Compositions and peptides having dual glp-1r and glp-2r agonist activity
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
WO2018104561A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018104558A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018104559A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Glp-1/glp-2 dual agonists
WO2018104560A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Glp-1/glp-2 dual agonists
WO2018103868A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018229252A1 (en) * 2017-06-16 2018-12-20 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
WO2020020904A1 (en) 2018-07-23 2020-01-30 Zealand Pharma A/S Therapeutic uses of glp-2 agonists
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
WO2020249778A1 (en) 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
WO2021174048A1 (en) 2020-02-28 2021-09-02 Kallyope, Inc. Gpr40 agonists
US11279702B2 (en) 2020-05-19 2022-03-22 Kallyope, Inc. AMPK activators
US11407768B2 (en) 2020-06-26 2022-08-09 Kallyope, Inc. AMPK activators
US11512065B2 (en) 2019-10-07 2022-11-29 Kallyope, Inc. GPR119 agonists
RU2785662C2 (ru) * 2017-06-16 2022-12-12 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)
WO2024061919A1 (en) 2022-09-19 2024-03-28 Zealand Pharma A/S Combination therapy

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101573376B (zh) 2006-11-08 2013-11-06 西兰制药公司 选择性胰高血糖素样肽-2(glp-2)类似物
CN104540850B (zh) 2012-05-03 2018-05-18 西兰制药公司 胰高血糖素样肽2(glp-2)类似物
IN2015DN00544A (https=) 2012-07-23 2015-06-26 Zealand Pharma As
PL3057984T3 (pl) 2013-10-17 2018-12-31 Zealand Pharma A/S Acylowane analogi glukagonu
US9988429B2 (en) 2013-10-17 2018-06-05 Zealand Pharma A/S Glucagon analogues
CN105829339B (zh) 2013-11-06 2021-03-12 西兰制药公司 胰高血糖素-glp-1-gip三重激动剂化合物
WO2015067715A2 (en) 2013-11-06 2015-05-14 Zealand Pharma A/S Gip-glp-1 dual agonist compounds and methods
KR102620911B1 (ko) 2014-10-29 2024-01-05 질랜드 파마 에이/에스 Gip 효능제 화합물 및 방법
DK3283507T3 (da) 2015-04-16 2020-01-02 Zealand Pharma As Acyleret glucagonanalog
CN108697768B (zh) 2015-12-23 2022-07-22 约翰霍普金斯大学 长效glp-1r激动剂作为神经系统病状和神经退行性病状的治疗方法
JP6700150B2 (ja) * 2016-10-03 2020-05-27 東京エレクトロン株式会社 パーティクル捕集装置、パーティクル捕集方法、およびパーティクル捕集システム
GB201710822D0 (en) * 2017-07-05 2017-08-16 Zealand Pharma As Methods and medical uses relating to the treatment of hypoglycaemia
WO2019090209A1 (en) 2017-11-06 2019-05-09 Shire-Nps Pharmaceuticals, Inc. Glp-2 analogs and peptibodies for administration before during, or after surgery
CA3129576A1 (en) 2019-02-11 2020-08-20 Opko Biologics Ltd. Long-acting glp-2 analogs
CN111329995B (zh) * 2020-02-18 2022-11-11 河南中医药大学 Glp-2类似物在制备防治pd药物中的应用及防治pd的药物
WO2021201654A1 (ko) * 2020-04-03 2021-10-07 한미약품 주식회사 Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물
BR112022025141A2 (pt) 2020-06-09 2023-04-25 Vectivbio Ag Fabricação, formulação e dosagem de apraglutida
CN116478269A (zh) * 2023-04-28 2023-07-25 成都奥达生物科技有限公司 一种长效替度鲁肽化合物
CN118146350B (zh) * 2024-03-13 2024-10-22 北京泽勤生物医药有限公司 Glp-2肽类似物的制备方法及应用

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0036776A2 (en) 1980-03-24 1981-09-30 Genentech, Inc. A method of creating an expression plasmid
WO1997039031A1 (en) 1996-04-12 1997-10-23 1149336 Ontario Inc. Glucagon-like peptide-2 analogs
WO1998008871A1 (en) 1996-08-30 1998-03-05 Novo Nordisk A/S Glp-1 derivatives
WO1998011125A1 (en) 1996-09-09 1998-03-19 Zealand Pharmaceuticals A/S Improved solid-phase peptide synthesis and agent for use in such synthesis
US5789379A (en) 1995-04-14 1998-08-04 Allelix Biopharmaceutical Inc. Glucagon-like peptide-2 analogs
US5994500A (en) 1996-07-19 1999-11-30 1149336 Ontario Inc. Antagonists of intestinotrophic GLP-2 peptides
WO2000055119A1 (en) 1999-03-17 2000-09-21 Novo Nordisk A/S Method for acylating peptides and novel acylating agents
WO2000055184A1 (en) 1999-03-15 2000-09-21 Novo Nordisk A/S Ion exchange chromatography of proteins and peptides with an organic modifier in the elution step
US6184208B1 (en) 1994-06-29 2001-02-06 Immunotech Developments Inc. Peptide, a method for its preparation and a pharmaceutical composition containing the peptide
US6184201B1 (en) 1995-04-14 2001-02-06 Nps Allelix Corp. Intestinotrophic glucagon-like peptide-2 analogs
WO2001041779A2 (en) 1999-12-08 2001-06-14 1149336 Ontario Inc. Combined use of glp-2 receptor agonist and chemotherapeutic agent in treatment
WO2002066511A2 (en) 2001-02-16 2002-08-29 Conjuchem Inc. Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders
WO2010070251A1 (en) * 2008-12-15 2010-06-24 Zealand Pharma A/S Glucagon analogues
WO2011160630A2 (en) * 2010-06-23 2011-12-29 Zealand Pharma A/S Glucagon analogues
WO2012158965A2 (en) * 2011-05-18 2012-11-22 Mederis Diabetes, Llc Improved peptide pharmaceuticals for insulin resistance

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2961045B2 (ja) 1993-02-24 1999-10-12 日清製粉株式会社 腸管粘膜増強促進剤
US5834428A (en) 1995-04-14 1998-11-10 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use
US5990077A (en) 1995-04-14 1999-11-23 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use
US5912229A (en) 1996-03-01 1999-06-15 Novo Nordisk Als Use of a pharmaceutical composition comprising an appetite-suppressing peptide
DE69740176D1 (de) 1996-03-01 2011-05-26 Novo Nordisk As Appetithemmendes Peptid, Zusammensetzung und Verwendung
US20020025933A1 (en) 1996-08-30 2002-02-28 Knudsen Liselotte Bjerre GLP-2 derivatives
US5952301A (en) 1996-12-10 1999-09-14 1149336 Ontario Inc. Compositions and methods for enhancing intestinal function
CA2236519C (en) 1997-05-02 2011-09-13 1149336 Ontario Inc. Methods of enhancing functioning of the large intestine
CA2289652C (en) 1997-05-16 2012-02-28 1149336 Ontario Inc. Methods of enhancing functioning of the upper gastrointestinal tract
US6051557A (en) 1997-05-16 2000-04-18 1149336 Ontario Inc. Methods of enhancing functioning of the upper gastrointestinal tract
EP2583675A1 (en) 1998-02-02 2013-04-24 Trustees Of Tufts College Use of dipeptidylpeptidase inhibitors to regulate glucose metabolism
NZ506839A (en) 1998-03-09 2003-05-30 Zealand Pharma As Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis
AU7421598A (en) 1998-05-11 1999-11-29 1149336 Ontario Inc. Methods of enhancing functioning of the large intestine
EP1076066A1 (en) 1999-07-12 2001-02-14 Zealand Pharmaceuticals A/S Peptides for lowering blood glucose levels
US7371721B2 (en) 2000-09-18 2008-05-13 Sanos Bioscience A/S Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes
EP1970072A1 (en) 2000-09-18 2008-09-17 Sanos Bioscience A/S Use of GLP-2 peptides for the treatment of hyperparathyroidism
US7186683B2 (en) 2000-09-18 2007-03-06 Sanos Bioscience A/S Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders
WO2002066062A2 (en) 2001-02-01 2002-08-29 Drucker Daniel J Enhancement of glp-2 activity
AU2002308706A1 (en) 2001-06-01 2002-12-16 Eli Lilly And Company Glp-1 formulations with protracted time action
WO2004035624A2 (en) 2002-10-14 2004-04-29 Novo Nordisk A/S Glucagon - like peptide - 2 variants
CN1705681A (zh) * 2002-10-14 2005-12-07 诺沃挪第克公司 Glp-2化合物、制剂及其用途
CA2502324A1 (en) * 2002-10-14 2004-04-29 Lars Thim Glucagon - like peptide - 2 variants
BR122019021416A2 (https=) 2003-09-19 2019-12-21
WO2005082404A2 (en) * 2004-02-27 2005-09-09 Novo Nordisk A/S Glp-2 derivatives modified by lipophilic substituents
EP1809318B1 (en) 2004-11-01 2013-06-12 NPS Pharmaceuticals, Inc. Treatment of short bowel syndrome patients with colon-in-continuity
UA95235C2 (en) 2005-05-04 2011-07-25 Зииланд Фарма А/С Glucagon-like-peptide-2 (glp-2) analogues
CN101573376B (zh) 2006-11-08 2013-11-06 西兰制药公司 选择性胰高血糖素样肽-2(glp-2)类似物
CN104540850B (zh) 2012-05-03 2018-05-18 西兰制药公司 胰高血糖素样肽2(glp-2)类似物

Patent Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0036776A2 (en) 1980-03-24 1981-09-30 Genentech, Inc. A method of creating an expression plasmid
US6184208B1 (en) 1994-06-29 2001-02-06 Immunotech Developments Inc. Peptide, a method for its preparation and a pharmaceutical composition containing the peptide
US5789379A (en) 1995-04-14 1998-08-04 Allelix Biopharmaceutical Inc. Glucagon-like peptide-2 analogs
US6184201B1 (en) 1995-04-14 2001-02-06 Nps Allelix Corp. Intestinotrophic glucagon-like peptide-2 analogs
WO1997039031A1 (en) 1996-04-12 1997-10-23 1149336 Ontario Inc. Glucagon-like peptide-2 analogs
US5994500A (en) 1996-07-19 1999-11-30 1149336 Ontario Inc. Antagonists of intestinotrophic GLP-2 peptides
WO1998008871A1 (en) 1996-08-30 1998-03-05 Novo Nordisk A/S Glp-1 derivatives
WO1998011125A1 (en) 1996-09-09 1998-03-19 Zealand Pharmaceuticals A/S Improved solid-phase peptide synthesis and agent for use in such synthesis
WO2000055184A1 (en) 1999-03-15 2000-09-21 Novo Nordisk A/S Ion exchange chromatography of proteins and peptides with an organic modifier in the elution step
WO2000055119A1 (en) 1999-03-17 2000-09-21 Novo Nordisk A/S Method for acylating peptides and novel acylating agents
WO2001041779A2 (en) 1999-12-08 2001-06-14 1149336 Ontario Inc. Combined use of glp-2 receptor agonist and chemotherapeutic agent in treatment
WO2002066511A2 (en) 2001-02-16 2002-08-29 Conjuchem Inc. Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders
WO2010070251A1 (en) * 2008-12-15 2010-06-24 Zealand Pharma A/S Glucagon analogues
WO2011160630A2 (en) * 2010-06-23 2011-12-29 Zealand Pharma A/S Glucagon analogues
WO2012158965A2 (en) * 2011-05-18 2012-11-22 Mederis Diabetes, Llc Improved peptide pharmaceuticals for insulin resistance

Non-Patent Citations (28)

* Cited by examiner, † Cited by third party
Title
A. R. GENNARO: "Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING CO.
ALFONSO R. GENNARO: "Remington's Pharmaceutical Sciences ,17th edition.", 1985, MARK PUBLISHING COMPANY
ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 2, no. 66, 1996, pages 460 - 480
B. A. MOORE ET AL: "GLP-2 Receptor Agonism Ameliorates Inflammation and Gastrointestinal Stasis in Murine Postoperative Ileus", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 333, no. 2, 1 May 2010 (2010-05-01), pages 574 - 583, XP055073554, ISSN: 0022-3565, DOI: 10.1124/jpet.109.161497 *
BRUN ET AL., AM J PHYSIOL GASTROINTEST LIVER PHYSIO, vol. 292, 5 October 2006 (2006-10-05), pages G518 - G525
CANI ET AL., DIABETES, vol. 57, June 2008 (2008-06-01), pages 1470 - 1481
CANI ET AL., PHARMACOLOGY AND THERAPEUTICS, vol. 130, 2011, pages 202 - 212
CHANG, J MED SCI, vol. 31, no. 5, 2011, pages 191 - 209
CHEESEMAN, AM J PHYSIOL., 1997, pages 1965 - 71
DACAMBRA ET AL., BIOCHEMISTRY, vol. 39, 2000, pages 8888 - 8894
DACAMBRA M P ET AL: "Structural determinants for activity of glucagon-like peptide-2", BIOCHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 39, no. 30, 1 August 2000 (2000-08-01), pages 8888 - 8894, XP002293748, ISSN: 0006-2960, DOI: 10.1021/BI000497P *
DRUCKER, PROC NATL ACAD SCI USA, vol. 93, 1996, pages 7911 - 7916
FIELDS, GB ET AL.: "Synthetic Peptides", 2002, article "Principles and practice of solid-phase peptide synthesis"
GIBSON ET AL., J GASTROENTEROL HEPATOL., vol. 18, no. 9, 2003, pages 1095 - 1100
GUAN ET AL., ASTROENTEROLOGY, vol. 125, 2003, pages 136147
KEEFE ET AL., GUT, vol. 47, 2000, pages 632 - 7
KNUDSEN ET AL., J. MED CHEM., vol. 43, 2000, pages 1664 - 1669
LARSEN, B. D.; HOLM, A., INT. J. PEPTIDE PROTEIN RES., vol. 43, 1994, pages 1 - 9
MADSEN ET AL., J. MED. CHEM., vol. 50, 2007, pages 6126 - 32
MEIER ET AL., GASTROENTEROLOGY, vol. 130, 2006, pages 44 - 54
MI JIN MOON ET AL: "Tyr(1) and Ile(7) of Glucose-Dependent Insulinotropic Polypeptide (GIP) Confer Differential Ligand Selectivity toward GIP and Glucagon-like Peptide-1 Receptors", MOLECULES AND CELLS, SEOUL, KR, vol. 30, no. 2, 31 August 2010 (2010-08-31), pages 149 - 154, XP002662065, ISSN: 1016-8478, [retrieved on 20100819], DOI: 10.1007/S10059-010-0100-5 *
PEARSON ET AL., GENOMICS, vol. 46, 1997, pages 24 - 36
SINCLAIR; DRUCKER, PHYSIOLOGY, 2005, pages 357 - 65
SINDAIR; DRUCKER, PHYSIOLOGY, 2005, pages 357 - 65
TAMAKI ET AL., J INT MED RES., vol. 31, no. 1, 2003, pages 6 - 16
TAVARES ET AL., AM. J. PHYSIOL. ENDOCRINOL. METAB., vol. 278, 2000, pages E134 - E139
WOJDEMANN ET AL., J CLIN ENDOCRINOL METAB., vol. 84, 1999, pages 2513 - 2517
YUSTA ET AL., GASTROENTEROLOGY, vol. 119, 2000, pages 744 - 755

Cited By (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
WO2015086731A1 (en) * 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
WO2015086729A1 (en) * 2013-12-13 2015-06-18 Sanofi Dual glp-1/gip receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
WO2016066818A1 (en) * 2014-10-31 2016-05-06 Gubra Aps Compositions and peptides having dual glp-1r and glp-2r agonist activity
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
WO2018104560A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Glp-1/glp-2 dual agonists
WO2018103868A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
EP4424320A3 (en) * 2016-12-09 2025-06-11 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018104559A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Glp-1/glp-2 dual agonists
KR20190091335A (ko) * 2016-12-09 2019-08-05 질랜드 파마 에이/에스 아실화 glp-1/glp-2 이중 효능제
CN110099922A (zh) * 2016-12-09 2019-08-06 西兰制药公司 Glp-1/glp-2双重激动剂
EP4424320A2 (en) 2016-12-09 2024-09-04 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
KR102502040B1 (ko) 2016-12-09 2023-02-24 질랜드 파마 에이/에스 아실화 glp-1/glp-2 이중 효능제
WO2018104558A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018104561A1 (en) 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
US11395847B2 (en) 2016-12-09 2022-07-26 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US11130793B2 (en) 2016-12-09 2021-09-28 Zealand Pharma A/S GLP-1/GLP-2 dual agonists
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
AU2017371516B2 (en) * 2016-12-09 2021-05-13 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
AU2017373901B2 (en) * 2016-12-09 2021-06-03 Zealand Pharma A/S GLP-1/GLP-2 dual agonists
RU2753193C2 (ru) * 2016-12-09 2021-08-12 Зилэнд Фарма А/С Ацилированные двойные агонисты glp-1/glp-2
AU2017371516C1 (en) * 2016-12-09 2021-09-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
RU2756011C2 (ru) * 2016-12-09 2021-09-24 Зилэнд Фарма А/С Glp-1/glp-2 двойные агонисты
EP3881861A1 (en) * 2017-06-16 2021-09-22 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
IL271245B1 (en) * 2017-06-16 2023-06-01 Zealand Pharma As Dosing regimen for administration of glucagon-like peptide analog (glp-2) 2
US12297251B1 (en) 2017-06-16 2025-05-13 Zealand Pharma A/S Injection pen for subcutaneous administration of a peptide
EP4424362A3 (en) * 2017-06-16 2024-11-27 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
WO2018229252A1 (en) * 2017-06-16 2018-12-20 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
IL271245B2 (en) * 2017-06-16 2023-10-01 Zealand Pharma As Dosing regimen for administration of glucagon-like peptide analog (GLP-2) 2
RU2785662C2 (ru) * 2017-06-16 2022-12-12 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)
CN111032072A (zh) * 2017-06-16 2020-04-17 西兰制药公司 用于施用胰高血糖素样肽2(glp-2)类似物的剂量方案
RU2785662C9 (ru) * 2017-06-16 2023-05-10 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)
WO2020020904A1 (en) 2018-07-23 2020-01-30 Zealand Pharma A/S Therapeutic uses of glp-2 agonists
US12576025B2 (en) 2019-06-14 2026-03-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual GLP1/2 agonist
WO2020249778A1 (en) 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
WO2020249782A1 (en) 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
US11512065B2 (en) 2019-10-07 2022-11-29 Kallyope, Inc. GPR119 agonists
WO2021174048A1 (en) 2020-02-28 2021-09-02 Kallyope, Inc. Gpr40 agonists
US12264171B2 (en) 2020-02-28 2025-04-01 Kallyope, Inc. GPR40 agonists
US11851429B2 (en) 2020-05-19 2023-12-26 Kallyope, Inc. AMPK activators
US11279702B2 (en) 2020-05-19 2022-03-22 Kallyope, Inc. AMPK activators
US11407768B2 (en) 2020-06-26 2022-08-09 Kallyope, Inc. AMPK activators
WO2024061919A1 (en) 2022-09-19 2024-03-28 Zealand Pharma A/S Combination therapy

Also Published As

Publication number Publication date
AU2013255752A1 (en) 2014-12-18
HK1208238A1 (en) 2016-02-26
MX2014013319A (es) 2015-07-06
EP2844670B1 (en) 2017-12-06
US9453064B2 (en) 2016-09-27
US20180298077A1 (en) 2018-10-18
IN2014DN09782A (https=) 2015-07-31
MX356958B (es) 2018-06-20
CA2872315A1 (en) 2013-11-07
CN104540850A (zh) 2015-04-22
US20160355563A1 (en) 2016-12-08
JP6298044B2 (ja) 2018-03-20
BR112014027345A2 (pt) 2019-09-03
EP2844670A1 (en) 2015-03-11
US9969787B2 (en) 2018-05-15
TR201802689T4 (tr) 2018-03-21
EA028929B1 (ru) 2018-01-31
KR20150006052A (ko) 2015-01-15
US20150125431A1 (en) 2015-05-07
US10253080B2 (en) 2019-04-09
EA201491934A1 (ru) 2015-07-30
CN104540850B (zh) 2018-05-18
JP2015517299A (ja) 2015-06-22
AU2013255752B2 (en) 2017-11-09

Similar Documents

Publication Publication Date Title
US10253080B2 (en) Glucagon-like-peptide-2 (GLP-2) analogues
US11111285B2 (en) Glucagon-GLP-1-GIP triple agonist compounds
US11008375B2 (en) GIP-GLP-1 dual agonist compounds and methods
IL266219B1 (en) Acetyl-modified dual glp–1/glp–2 agonists
US20150376257A1 (en) Glucagon analogues
WO2018104558A1 (en) Acylated glp-1/glp-2 dual agonists
NZ576260A (en) GLUCAGON-LIKE-PEPTIDE-2 (GLP-2) ANALOGUES comprising one of more substitutions as compared to h[Gly2]GLP-2
WO2018103868A1 (en) Acylated glp-1/glp-2 dual agonists
HK1208238B (en) Glucagon-like-peptide-2 (glp-2) analogues

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13721953

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2015509462

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2872315

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14398297

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/013319

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 201491934

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2013721953

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20147033951

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013255752

Country of ref document: AU

Date of ref document: 20130503

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014027345

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014027345

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20141031