WO2013119579A1 - Detection of intracellular binding events by measuring protein abundance - Google Patents

Detection of intracellular binding events by measuring protein abundance Download PDF

Info

Publication number
WO2013119579A1
WO2013119579A1 PCT/US2013/024789 US2013024789W WO2013119579A1 WO 2013119579 A1 WO2013119579 A1 WO 2013119579A1 US 2013024789 W US2013024789 W US 2013024789W WO 2013119579 A1 WO2013119579 A1 WO 2013119579A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
binding
cell
fragment
compound
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/024789
Other languages
English (en)
French (fr)
Other versions
WO2013119579A8 (en
Inventor
William Raab
Thomas S. Wehrman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
DISCOVERYX Corp
Original Assignee
DISCOVERYX Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by DISCOVERYX Corp filed Critical DISCOVERYX Corp
Priority to EP18156334.7A priority Critical patent/EP3367096B1/en
Priority to EP13746491.3A priority patent/EP2812695A4/en
Priority to CA2863774A priority patent/CA2863774C/en
Priority to JP2014555836A priority patent/JP6141327B2/ja
Publication of WO2013119579A1 publication Critical patent/WO2013119579A1/en
Publication of WO2013119579A8 publication Critical patent/WO2013119579A8/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56966Animal cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/536Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase
    • G01N33/542Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase with steric inhibition or signal modification, e.g. fluorescent quenching

Definitions

  • the present invention relates generally to methods which monitor binding of a compound to a target of interest inside a mammalian cell by increasing the stability of the target of interest and therefore its abundance, or number of molecules, in a cell. Further, the invention also relates to screening small molecules as inhibitors of target-compound binding in a cell.
  • Binding between and among various molecules such as proteins is central to biological processes essential for normal cell functioning.
  • Cellular pathways such as signal transduction, apoptosis, cell and growth proliferation, gene regulation, require a series of interactions and bindings between and among specific proteins.
  • proteins assume their functional shape or confirmation through synchronized protein folding.
  • the correct protein folding is essential for proteins to carry out their desired functions and expression. Proteins which do not undergo folding or do not fold in the requisite manner will have a short half-life in a cell and will be discarded by the cell as the degradation system of the cell will recognize it as an improper protein. Properly folded proteins will have a longer half-life and participate in binding events or other required cellular functions.
  • stability of proteins is essential for protein expression and functioning in a cell, which is achieved through correct structure and participating in binding events leading to complex formation.
  • Protein binding occurs through special characteristic sequences or surfaces which are known as interacting interfaces. E.g. in case of protein-protein interactions these interfaces are known as 'hotspots' and constitute tight fitting regions which are generally characterized by complementary pockets scattered through the central region of the interface and enriched in structurally conserved residues (Hubbard and Argos Cavities and packing at protein interfaces. Protein Sci 1994; 3: 2194-2206). These pockets are classified as "complementary” (Binkowski et al, Inferring functional relationships of proteins from local sequence and spatial surface patterns J. Mol Biol 2003; 332: 505-526) because there is a large
  • Modulators bind to regulatory sites distinct from the active site (hotspots) on the protein, resulting in conformational changes that may profoundly influence protein function and is a classical control mechanism of protein behavior. As described above, proteins are in native state as they undergo allosteric modulation.
  • Protein kinases which participate in the process of phosphorylation, whereby they transfer phosphate groups from high-energy donor molecules, such as ATP to specific substrates.
  • Protein phosphorylation is one of the most significant signal transduction mechanisms by which intercellular signals regulate crucial intracellular processes such as ion transport, cellular proliferation, and hormone responses.
  • Kinases are the key regulators of cell function that constitute one of the largest and most functionally diverse gene families. They direct the activity, localization and overall function of many proteins and almost all cellular processes. Protein kinases can be regulated by activator proteins, inhibitor proteins, ligand binding to regulatory subunits, cofactors and phosphorylation by other proteins or by themselves (autophosphorylation).
  • kinases are prominent in signal transduction and co-ordination of complex functions such as the cell cycle. Thus, it makes kinases a potential target class for therapeutic interventions in many disease states such as cancer, diabetes, inflammation, and arthritis and represent as much as thirty percent of all protein targets under investigation by pharmaceutical companies. A number of methods have been developed and used to study cellular binding events.
  • enzyme fragment complementation using beta- galactosidase ( ⁇ -gal) is based on the complementation of enzyme fragments to form an active enzyme See, e.g., Ullman et al., /. Mol. Biol.24:339-43 (1967); Ullman et al., /. Mol.
  • the present invention concerns an assay whereby a target peptide to be assayed is fused to a labeling peptide and expressed as a fusion protein in a eukaryotic cell, preferably a mammalian cell. As the target peptide binds a test compound it forms a complex and is stabilized, thus changing the amount of fusion protein in a cell, i.e. the abundance of the fusion protein (and the target peptide component thereof) in the cell.
  • the labeling peptide component can be a fragment of ⁇ galactosidase, for example an enzyme donor (ED), such as a proprietary ED termed a ProLabel (PL) peptide.
  • ED enzyme donor
  • PL ProLabel
  • the labeling peptide/tag can be other than an ED.
  • the present invention comprises a method to assess binding of a compound to a binding site on target peptide in a cell, comprising: (a) providing in the cell a fusion protein comprising (i) the target peptide and (ii) a labeling peptide, wherein the target peptide comprises a destabilizing mutation; (b) incubating a mixture of the cell and the compound for a period sufficient to allow binding of the compound to the binding site of the target peptide and to allow for stabilization of the fusion protein by the binding, then (c) combining the mixture from step (b) with a label that detects an amount of the labeling peptide remaining on the fusion protein after incubating, wherein a change in the amount of labeling peptide detected indicates binding to the target peptide.
  • the compound which may be a test compound being evaluated for its binding effect, may be a small molecule, a peptide, or a full-length protein.
  • the compound may be a pharmacological agent or it may be a native ligand for the target peptide. In this situation, one may add a test compound that binds to the native ligand and modulates its binding to the target peptide.
  • the present invention comprises a method for measuring binding of a compound to a binding site on a target peptide, as stated above, and the binding site may be one of (a) an ATP binding site, (b) a bromodomain sequence, (c) a catalytically (enzymatic) active site or (d) an allosteric site.
  • the present invention comprises a method wherein the labeling peptide is selected from the group consisting of (a) an enzyme donor fragment of ⁇ - galactosidase, (b) a peptide having a binding epitope for a secondary label.
  • the present invention comprises a method wherein the labeling peptide is an ED having a sequence according to one of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3. In certain aspects, the present invention comprises a method wherein the EA has a sequence according to is SEQ ID NO: 4.
  • the present invention comprises the above-mentioned methods wherein the cell is a mammalian cell. In certain aspects, the present invention comprises the above-mentioned methods further comprising the step of carrying out steps (a) through (c) in the absence of the compound to provide a control for determining the change in the amount of labeling peptide detected.
  • the present invention comprises the above-mentioned methods wherein the target peptide comprises a mutation which is a truncation, said mutation being outside of the binding site.
  • the target peptide has been selected so that it has a relatively short half- life unless it is stabilized by binding to a compound.
  • the mutation may involve truncating the target peptide by removing a certain number of amino acids form either the amino terminus, the carboxy terminus or both terminii. The number of amino acids removed will depend on the target peptide being created. It may be for example, up to 5 -10 amino acids, 5-20 amino acids, 5-10 amino acids, etc., as long as the binding site is left in the target peptide.
  • Amino acids may be removed from a central domain, such as a domain needed for proper folding.
  • the present invention comprises a method wherein said target peptide comprises a mutation which is a deletion of at least ten percent of the sequence of the full length protein.
  • the native protein is 1000 amino acids long, at least 100 amino acids are removed.
  • the present invention comprises a method to assess a small molecule as an inhibitor of binding to a binding site on target peptide in a cell, comprising:
  • the present invention comprises the above-mentioned methods wherein said compound is one of a small molecule, a peptide, and a full-length protein.
  • the present invention comprises the above-mentioned methods wherein said small molecule is one of a drug candidate, a peptide, and a full-length protein.
  • the present invention comprises a method wherein said binding site is one of (a) an ATP binding site, (b) a bromodomain sequence, (c) a catalytic site or (d) an allosteric site.
  • the present invention comprises the above-mentioned methods wherein the labeling peptide is (a) an ED or (b) a binding epitope for a labeling peptide.
  • the ED may have according to one of SEQ ID NO: 1, SEQ ID NO:2, or SEQ ID NO:3.
  • the present invention comprises a method wherein the assay is carried out without adding a compound, in order to provide a control for said determining said change in the amount of labeling peptide.
  • kits for carrying out the above- mentioned methods will generally comprise an expression vactor for inserting a target of interest and already containing a labeling peptide.
  • the present invention comprises a kit to study the effect of introduction of compound into a cell comprising (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment; (b) compound, (c) EA fragment of ⁇ -galactosidase; and (d) a ⁇ - galactosidase substrate.
  • the present invention comprises a kit to study the effect of compound on mediating cellular interactions comprising (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment; (b) compound, (c) EA fragment of ⁇ -galactosidase; and (d) a ⁇ -galactosidase substrate.
  • the present invention comprises a kit to study effect of small molecule inhibitors on cellular interactions comprising (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment; (b) small molecule, (c) EA fragment of ⁇ - galactosidase; and (d) a ⁇ -galactosidase substrate.
  • the present invention comprises a kit to monitor interacting interface comprising (a) a cell comprising: a fusion protein comprising the variant sequence lengths of target and ED fragment of ⁇ -galactosidase fragment; (b) EA fragment of ⁇ -galactosidase; and (c) a ⁇ -galactosidase substrate.
  • the present invention comprises a kit comprising an expression construct encoding a fusion protein comprising a target and ED fragment of ⁇ -galactosidase.
  • Figure 1 is a schematic representation of an embodiment of the present assay showing how a fragment of a stable protein is unstable, stabilized by binding of a compound to binding site, and detected with increased abundance.
  • Figure 2 is a plasmid map of RPS-BLK (241-490) for expressing a BLK construct of amino acids 241-490.
  • Figure 3 is a graph showing fusion constructs (BLK-kinase-Prolabel) with varying sequence lengths of tyrosine-protein kinase BLK (“BLK”) participating in interactions with a small molecule, dasatinib.
  • Figure 4 is a graph showing the effect of various small molecules (dasatinib, PD 173955 and XL-2880) on abundance of a BLK-PL fusion.
  • Figure 5 is a plasmid map of an RPS-BCL2 DNA construct.
  • Figure 6 is a plasmid map of an RPN-pBEVI-PL DNA construct.
  • Figure 7A, 7B, and 7C is a series of three graphs showing the interaction of BCL-2 with fusion proteins;
  • Figure 7A shows data from PL-Bax
  • Figure 7B shows data from PL- Bim
  • Figure 7C shows data from PL-Bak.
  • Figure 8A is a graph showing the effect of kinase inhibitors (U0126 and PD0325901) on abundance of MEK-PL fusion interactions in HEK cells.
  • Figure 8B is a graph as in Figure 8 A, with CHO cells.
  • Figure 8C is a graph as in Figure 8A, with U20S cells.
  • Figure 9A is a graph showing the specificity of dasatinib, U0126 and PD035901 to MEK-PL.
  • Figure 9B is a graph as in Figure 9A, with BLK-PL fusions.
  • Figure 10 is a graph showing change in luminescence in a histone methylase G9a fragment when treated with UN06038, a selective chemical probe for G9a/GLP
  • Figure 11 is a graph showing fluorescence from a CYP 17 A -ED fusion, shows stabilization of that domain with Ketoconazole and Abiraterone.
  • truncation of a protein will affect its folding and unfolding, ultimately affecting its functionality. It has been now found that such instability, as well as other factors affecting protein stability within a cell, can be used to measure the effect of stabilization of such a protein. It is recognized that the unstable protein will be degraded by the cell until such time as it forms a complex and can be stabilized from further cellular processes. As binding of both natural compounds (e.g. proteins) and many test compounds occurs through specific binding sequences, certain truncated protein fragments containing the active or allosteric binding sequences can be stabilized through compound binding.
  • natural compounds e.g. proteins
  • a compound that binds at an active or allosteric site of a protein fragment will form a complex with the fragment and will change its half-life in a cell. This will lead to a greater number of protein molecules in the cell, or greater "protein abundance”.
  • Targeting native or naturally mutated human proteins with small molecule test compounds is an important part of drug development.
  • monitoring the stability of truncated, destabilized proteins, compounds that bind to the truncated fragments, estimating the interaction interfaces and screening small molecules as inhibitors of cellular binding complexes will have potential applications in drug development against a number of human disorders and represent aspects of the present invention.
  • a number of small molecules act by binding to the ATP site of the active
  • target peptides e.g. dasatinib, which noncovalently binds to BCR-Abl kinases.
  • synthetic or natural ATP-competitive molecules can then be tested for binding by measuring the increased stability, and thus residence time in the cell, that such binding causes.
  • An increased concentration of fusion protein bound to the target and carrying the PL will be measured by adding the EA, giving us an indication of the binding sequence which can further be characterized by known biophysical and biological approaches.
  • the present methods are carried out so as to measure the amount (e.g. concentration, or abundance) of a target peptide that remains in a cell after a predetermined time that is chosen to distinguish a target peptide, which is bound to an enzyme fragment for detection, that has bound a test compound and thus been stabilized against cellular turnover, from a target peptide that is not bound to the binding entity and is degraded by cellular machinery, such degradation also removing the enzyme fragment label.
  • concentration e.g. concentration, or abundance
  • a full length protein 102 containing an amino acid sequence or protein domain 104, that participates in binding is generally stable in a cell and has a consistent, measurable half life.
  • the binding sequence 104 e.g. a ligand binding site such as an ATP binding site, or a protein-protein interaction site such as an l helix of BAX, may be anywhere within the primary sequence of the protein. It may be a contiguous sequence in primary structure or it may exist as amino acids in proximity in tertiary structure.
  • the binding sequence will generally be on the surface of the protein.
  • the protein 102 is truncated as shown at 106, where truncation may occur from the N terminus, the C terminus, or, as shown here, both terminii.
  • the binding sequence 104 is still present in the truncated target peptide. Because of these alterations, the cell will degrade the truncated protein (peptide) more rapidly.
  • the truncated peptide 106 is fused with a small fragment of ⁇ -galactosidase (PL enzyme donor in this example) as shown at 108.
  • Binding of a compound 110 to the truncated peptide 108 will increase the stability of the truncated fragment, an effect which can then be estimated by incubating the sample with a complementing ⁇ -galactosidase fragment, an enzyme acceptor or EA, shown at 112.
  • the complementation of ED and EA results in an active enzyme (shown at 114) which will convert the substrate into a measurable product (shown at 116).
  • the test compound 110 itself may stabilize the truncated peptide, or, in certain embodiments, the test compound 110 mediates the binding of the truncated peptide to a cognate binding partner, and this binding to the binding partner stabilizes the truncated peptide.
  • the compound may increase or decrease such binding and affect stability of the truncated peptide rather than directly stabilizing the truncated peptide.
  • the ED label on the truncated peptide serves only for labeling and not for stabilization.
  • peptide refers to any polymer compound produced by amide formation between an a-carboxyl group of one amino acid and an a-amino group of another group.
  • BCL2 is used in its scientifically accepted sense to refer to a family of proteins whose members contain at least one of the four conserved a-helical motifs known as the Bcl-2 homology (BHI-4) domains.
  • BHI-4 conserved a-helical motifs
  • the family is further classified into functional groups, the antiaptotic and the pro-apoptotic members, as described in Szegezdi et al., "Bcl-2 family on guard at the ER.” Am J Physiol Cell Physiol, 2009; 296: C941 - C953.
  • BIM, BAK and BAX refer to members of the BCL2 family.
  • Multidomain proapoptotic BAX and BAK are essential effectors.
  • BLK B-lymphocyte kinase
  • NCBI reference sequence NP_001706 also known as tyro sine-protein kinase Blk [Homo sapiens]. Variants of this sequence are found in the protein tyrosine kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain.
  • PTK protein tyrosine kinase
  • Lck and Blk kinases Lck and Blk kinases
  • catalytic (c) domain The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein
  • MEK serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).
  • MEK is used in its scientifically accepted sense to refer to a protein kinase that phosphorylates the ERK gene product.
  • the MEK subfamily of protein kinases is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
  • the mitogen- activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals.
  • the pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK).
  • MAPK MAP kinase
  • MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the downstream targets,
  • ERK extracellular signal-regulated kinase 1 and ERK2, on specific threonine and tyrosine residues.
  • protein refers to polypeptides of specific sequence of more than about 50 residues. While all proteins are peptides, the term “peptide” generally refers to a fragment of a protein; the term “fusion protein” is used to refer to both fusion proteins and fusions with peptides, such as a fusion with a labeling peptide, e.g. an ED.
  • fusion protein refers to a protein created through genetic engineering from two or more proteins/peptides. In general, this is achieved by creating a "fusion gene", a nucleic acid that encodes the fusion protein. For example, a fusion gene that encodes a fusion protein may be made by removing the stop codon from a first DNA sequence encoding the first protein, then appending a DNA sequence encoding the second protein in frame. The resulting fusion gene sequence will then be expressed by a cell as a single fusion protein. Fusion proteins may include a linker (or "spacer") sequence which can promote appropriate folding and activity of each domain of the fusion protein. Fusion proteins may also include epitope tags for identification (e.g., in western blots,
  • Non-limiting examples of epitope tags in current use include: HA, myc, FLAG, and 6-HIS (SEQ ID NO: 19).
  • amino acid as used herein is intended to include not only the L-, D-and nonchiral forms of naturally occurring amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, valine), but also modified amino acids, amino acid analogs, and other chemical compounds which can be incorporated in conventional oligopeptide synthesis, e.g., 4-nitrophenylalanine, isoglutamic acid, isoglutamine, ⁇ -nicotinoyl-lysine, isonipecotic acid, tetrahydroisoquinoleic acid, a- aminoisobutyric acid, sarcosine, citrulline, cysteic acid, t-butylg
  • NH 2 refers to the free amino group present at the amino terminus of a polypeptide.
  • COOH refers to the free carboxy group present at the carboxy terminus of a polypeptide in keeping with standard polypeptide nomenclature, (J Biol. Chem. 243 (1969), 3352-59) is used.
  • vector refers to is a replicon, such a plasmid, phage or cosmid, to which another DNA segment may be attached so as to bring about the replication of the attached segment.
  • a cell has been "transformed” or “transfected” by exogenous or heterologous DNA when such DNA has been introduced inside the cell.
  • the transforming DNA may or may not be integral (covalently linked) into the genome of the cell.
  • the transforming DNA may be maintained on an episomal element such as a plasmid.
  • a stably transformed cell is one in which the transforming DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication.
  • a "cell line” is a clone of a primary cell that is capable of stable growth in vitro for many generations.
  • the term "expression system” refers to any suitable exogenous system for expressing the receptor components in the cell.
  • exogenous expression of receptor components by a cell as provided herein can result from the introduction of the nucleic acid sequences encoding the receptor component or a fusion protein comprising a receptor component in an expression vector.
  • fusion protein refers to a reporter component that is fused to a heterologous protein or protein fragment using recombinant technology.
  • target refers to various macromolecules present in a cell such as DNA, RNA, lipids, proteins and carbohydrates or their constituent monomers.
  • target peptide refers to a target peptide that has been modified by truncation or the like as described below, is labeled with a ⁇ -galactosidase fragment (preferably PL) and is being tested with a test compound, such as a small molecule, or another protein, or a combination of a small molecule and a protein partner.
  • exemplary target peptides include kinases, actins, chaperonins, hsp proteins, and polymerases, which have ATP binding sites, and G proteins and dynamin, which bind GTP.
  • small molecule is art-recognized and refers to a composition which has a molecular weight of less than 35 about 2000 amu, or less than about 1000 amu, and even less than about 500 amu.
  • Small molecules may be, for example, nucleic acids, peptides, polypeptides, peptide nucleic acids, peptidomimetics, carbohydrates, lipids or other organic (carbon containing) or inorganic molecules.
  • Many pharmaceutical companies have extensive libraries of chemical and/or biological mixtures, often fungal, bacterial, or algal extracts, which can be screened with any of the assays of the invention.
  • small organic molecule refers to a synthetic or purified natural small molecule that is often identified as being an organic or medicinal compound, and does not include molecules that contain nucleic acids, peptides or polypeptides.
  • binding refers to the binding of small molecules, proteins or compound to the known proteins in a cell.
  • binding partner or “member of a binding pair” refer to molecules that specifically bind other molecules to form a binding complex such as antibody-antigen, lectin-carbohydrate, nucleic acid-nucleic acid, biotin- avidin, etc.
  • the binding is predominantly mediated by non-covalent (e.g. ionic, hydrophobic, etc.) interactions and is between a small molecule and its target and/or two proteins that specifically bind to each other during a cellular process.
  • protein abundance is used as described herein, and in a commonly accepted sense, as described, e.g. in Ivanic J, Yu X, Wallqvist A, Reifman J (2009)
  • Protein abundance can be regarded as the number of protein or peptide molecules in a cell at a given time.
  • the term "destabilizing mutation” means a mutation in a peptide or protein sequence that causes an alteration in the stability of the peptide or protein in the cell, that is, the likelihood of its degradation or aggregation within a certain time period. Mutations may include amino acid deletions, additions or substitutions. The mutation generally will cause misfolding of the peptide or protein.
  • the stability of the peptide or protein in a cell may also refer to the duration of time that the protein is present in the cell before being removed or degraded by cellular machinery. Protein or peptide stability can be measured in vivo (i.e. in a cell) by a number of methods, such as disclosed e.g. in Ghaemmaghami et al., "A
  • a mutation is a destabilizing mutation can be determined by comparing the mutated protein to the non-mutated protein and observing that the mutated protein has a half- life in the cell that is at least 10% or more shorter than that of the non-mutated protein. In some cases, the half- life may be at least 20% or more shorter than that of the non-mutated protein or 30% or more shorter than that of the non-mutated protein. In some cases, the destabilizing mutation will result in a peptide having a half-life of less than 3 hrs inside of a cell.
  • the term "destabilizing mutation” refers to mutations which are truncations in which at least 5 amino acids are removed from either or both of the N terminal region or the C terminal region of a target peptide. Further, it may also refer to truncation from either or both of the N terminus or the C terminus which leads to the destabilization of the target peptide inside of a cell. As explained below, in the present method, the
  • destabilizing mutation is not to the binding site of the target peptide.
  • labeling peptide means a peptide having essentially no secondary structure (i.e. random coil) and which functions as a label for detection of a protein or protein fragment (e.g. target peptide) fused thereto and having essentially no effect on the stability of the target peptide to which it is fused.
  • the labeling peptide will generally be less than 100 amino acids in length. It may itself function as a label, or it may provide an epitope for antibody recognition. As explained below, the labeling peptide is selected so as not to affect the stability or half life of a fusion partner of the labeling peptide.
  • target peptide refers to a protein or protein fragment which is the target of binding modulated by a test compound in the present assay.
  • the target peptide will have a native site which provides a binding site for the test compound or that is a binding site for another cellular component wherein the test compound modulates.
  • the target peptide may have a catalytic site, a co-factor binding site, an allosteric regulatory site, etc.
  • the binding site may also be a binding site for a native ligand.
  • a native ligand is a cellular molecule that binds to the binding site of the target peptide as part of a cellular process.
  • test compound is used in a general sense to refer to a small molecule, macromolecule or other material that has a property of binding to a particular target peptide at a binding site.
  • the test compound is generally not normally found in the cell where it is tested at the concentration being tested.
  • the test compound may produce a positive test result of binding or a negative test result of not binding; binding may also be quantified, according to the present methods.
  • More than one test compound may be used, in that a test compound may be used as a reference compound known to bind to a specific site, such as a catalytic site, and ATP binding sire, etc. on a target peptide.
  • the test compound will in some cases bind non-covalently to the binding site; in some cases it will bind covalently to the binding site.
  • sample well means any fluid container, and includes wells in a microtiter plate, various test tubes (e.g. Eppendorf tubes), chambers in a microfluidic device, etc.
  • ED means an enzyme donor fragment for use in a ⁇ galactosidase enzyme fragment complementation assay. Examples of EDs are given below.
  • binding site refers to a sequence or cluster of residues on a target where the target binds to another molecule. Binding sites on proteins are well known and characterized. They are generally specific to a certain ligand or binding partner. They can be identified on a sequence basis by tools such as PPSearch, at EMBL-EBI. Exemplary binding sites are (a) nucleotide (e.g. ATP) binding site, (b) a bromodomain sequence, (c) a catalytic site or (d) an allosteric site.
  • nucleotide e.g. ATP binding site
  • the present presently disclosed methods and materials employ the wild- type E.coli ⁇ -galactosidase upon which the enzyme fragment
  • EFC complementation
  • the ⁇ -galactosidase enzymes and its fragments are required to have a number of characteristics.
  • the fragments are substantially inactive individually, in that there is little, if any, background with only one fragment present in the presence of substrate.
  • the fragments have sufficient affinity for each other, that in the absence of other binding, e.g. by entities fused to the fragments, the fragments will combine to provide an active enzyme.
  • the small fragment (“ED” or "PL”) may be designed artificially and will not interfere with the biological activity of the gene or protein to which it is fused.
  • ED will usually be at least about 37, usually at least about 40 amino acids, and usually not more than about 110, more usually not more than about 90.
  • the employed ⁇ -galactosidase complementation system is one that is made up of two or more ⁇ -galactosidase fragments or variants thereof.
  • the complementation system includes a first and second fragment of ⁇ - galactosidase (e.g., an a and ⁇ fragment).
  • the complementation system may include more than two ⁇ -galactosidase fragments, such as a first, second and third ⁇ -galactosidase fragments (e.g., an ⁇ , ⁇ and ⁇ fragment).
  • small fragment of ⁇ -gal (also the signal producing peptide) will be referred to as the enzyme donor (ED).
  • the signal producing peptide is one of a pair of fragments of an enzyme that is reconstituted when the two fragments, the enzyme donor ("ED") and the enzyme acceptor ("EA") complex together.
  • the ED will be a fragment of an enzyme that can be complemented with another fragment, the EA, to form an active enzyme.
  • the ED fragment of the fusion protein will complex with the EA fragment as a result of the affinity of the fragments for each other.
  • the complementing fragments are high affinity fragments.
  • High affinity components are generally two fragments of an enzyme with the fragments having sufficiently high affinity such that they can spontaneously bind to each other and reform a fully functional enzyme or enzyme subunit.
  • at least 5% of enzymatic activity of the native enzyme is achieved when mixed under appropriate conditions in solution, sometimes about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% of the enzymatic activity of the native enzyme. Determination of such activity can be performed using routine methods with the concentration at which the complemented enzyme and parental enzyme are compared typically being the same with a range of, e.g., between 10 ⁇ 3 to 10 ⁇ 6 M.
  • High affinity components permits monitoring of the presence, absence, or increase of the complementing fragments as they form a complex with the interacting partner. For example, if one complementing fragment is present in the fusion protein (fused to the target of interest) and forms a complex with the test compound then the incubation with the second fragment after lysis of the cell will result in detectable enzymatic activity, thus permitting the analysis of cellular interactions. Accordingly, if the amount of high affinity components increases in the assay system, then the amount of detectable enzymatic activity will increase
  • the fusion protein comprises a truncated fragment of target of interest and high affinity ED fragment, wherein the target of interest is a protein kinase and the truncated fragment consists of the ATP-binding sequence. In some embodiments, the truncated protein fragment consists of non ATP binding sequence.
  • the test compound can be an ATP-competitive molecule, allosteric modulators or a kinase binding molecule. In some embodiments, the fusion protein comprises a truncated fragment of target of interest and low affinity ED fragment.
  • indicator enzymes are also known to fulfill these criteria and additional enzymes may be developed in accordance with known technologies.
  • Indicator enzymes that fit these criteria include split luciferase, GFP, ribonuclease A (See, U.S. Pat. No. 4,378,428), where the smaller fragment may come from the amino or carboxy terminus or internally, ⁇ - lactamase WO 00/71702 and 01/94617 and Wehrman, et al., Proc. Natl. Acad. Sci. 2002, 99, 3469-74, or enzymes that have small peptide cofactors, such as adenovirus proteases (See, U.S. Pat. No. 5,935,840).
  • the a peptide employed is one that complements the ⁇ peptide robustly in mammalian cells.
  • the high affinity minimal a peptide permits sensitive, accurate analysis of cellular interaction events between various intracellular entities with only a minimum of interactions required for detection.
  • Exemplary high affinity a peptides(enzyme donors) include
  • SEQ ID NO. 4 Another applicable ED is termed enhanced prolabel, SEQ ID NO. 4 below:
  • the enzyme fragments can be coupled to the peptide target of interest using any suitable method.
  • the enzyme fragments and one or more targets of interest can be linked either directly or via a linker.
  • the linker is covalent.
  • the enzyme fragment and the target of interest are proteins, methods known in the art for linking peptides can be employed.
  • the enzyme fragment and the target of interest comprise a fusion protein that includes the enzyme fragment and the target being assayed.
  • aspects of the methods include the use of a reduced-affinity enzyme
  • Embodiments of the reduced-affinity enzyme complementation reporter systems are characterized by providing a high signal-to-noise ratio.
  • aspects of the method include the use of a first ⁇ -galactosidase fragment (also known as an enzyme donor or a fragment) that is a variant minimal N-terminal ⁇ -galactosidase peptide.
  • minimal N-terminal ⁇ -galactosidase peptide is meant that the peptide has an amino acid sequence that is found in the N-terminal region of a wild-type ⁇ -galactosidase protein, e.g., a sequence that starts within about 10 residues of the N-terminus, such as within about 5 residues of the N-terminus of a wild-type ⁇ -galactosidase protein.
  • first ⁇ - galactosidase fragments of this embodiment are minimal, they are, in certain embodiments, about 60 amino acids or less in length, such as about 55 amino acids in length or less, including about 50 amino acids or less in length, e.g., 49 amino acids or less in length, 48 amino acids or less in length, etc.
  • the second ⁇ -galactosidase fragment is a deletion mutant that is missing aa 11-41 of the wild type E. coli ⁇ -galactosidase protein (e.g., as described in Langley et al., Proc. Nat'l Acad. Sci. USA (1975) 72: 1254-1257), which fragment is known as the M15 acceptor or ⁇ fragment.
  • Other specific acceptors (i.e., co-fragments) of interest include, but are not limited to: the Ml 12 dimer, a deletion of amino acids 23-31 within ⁇ - galactosidase (Lin, Villarejo and Zabin, 1970, Biochem. Biophys. Res. Common.
  • ⁇ peptide sequence is set forth below (SEQ ID NO. 5) MGVITDSLAVVARTDRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVV PSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSA FHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIF RDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASG TAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAECDVGFRE VRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNH PLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERV
  • a range of methods are available to measure the enzyme activity of ⁇ -galactosidase which include live cell flow cytometry and histochemical staining with the chromogenic substrate 5-bromo-4-chloro-3-indolyl ⁇ -D-galactopyranoside (X-Gal). see e.g., Nolan et al., Proc. Natl. Acad. Sci., USA, 85: 2603-2607 (1988); and Lojda, Z., Enzyme Histochemistry: A laboratory Manual, Springer, Berlin, (1979).
  • ⁇ -gal activity as described in Mohler and Blau, Proc.Natl.Acad.Sci., 93: 12423-12427 (1996) may be used.
  • intracellular analyses may be conducted by fixing cells and staining with the indigogenic substrate X-gal.
  • Fixed cells also can be analyzed by assaying for ⁇ -gal activity by fluorescence histochemistry using an azo dye in combination with either X-gal or 5-bromo-6-chloro-3-indolyl ⁇ -D-galactopyranoside (5-6-X-Gal).
  • a combination of interest is the azo dye red violet LB (Sigma Chemicals, St.
  • Fluor-X-gal 5-6-X-Gal, referred to as Fluor-X-gal.
  • Fluor-X-gal 5-6-X-Gal
  • fluorescence micrographs can be obtained on a fluorescence dependent fluorescence to be visualized simultaneously with two or more other fluorescent signals.
  • Vital substrates for ⁇ -gal which can be used in living cells, are also encompassed by the presently disclosed methods and materials.
  • a fluorogenic substrate, resorufin ⁇ -galactosidase bis-aminopropyl polyethylene glycol 1900 (RGPEG) has been described.
  • Minden (1996) BioTechniques 20(1): 122-129. This compound can be delivered to cells by microinjection, electroporation or a variety of bulk-loading techniques.
  • FDG fluorescein di- ⁇ -D-galactopyranoside
  • FACS fluorescence-activated cell sorting
  • ⁇ -galactosidase may also be detected using a chemiluminescence assay. For example, cells containing ⁇ -galactosidase fusions are lysed (with or without contacting with a crosslinking agent) in a mixture of buffers containing Galacton Plus substrate from a
  • substrates that are suitable for spectrophotometric or fluoremetric analysis include, but are not limited to: p-aminophenyl- ⁇ -D-galactopyranoside; 4- methylumbel-liferyl- ⁇ -D-galactopyranoside; mapthyl-AS-Bl- ⁇ -D-galactopyranoside; 1- napthyl- ⁇ -D-galactopyranoside; 2-napthyl- ⁇ -D-galactopyranoside monohydrate; O- nitrophenyl- ⁇ -D-galactopyranoside; and phenyl- ⁇ -D-galactopyranoside, 5-bromo-4-chloro- 3-indolyl- ⁇ -D-galactopyranoside, resorufin ⁇ -D-galactopyranoside, 7-hydroxy-4- trifluoromethyl coumarin, ⁇ -notrostyryl- ⁇ -D-galact
  • Assay solutions can be designed and developed for a particular system.
  • the reporter systems disclosed herein can be used to conduct assays in solutions, such as buffered cell free solutions, cell interiors, solutions of cells, solutions of cell lysates and solutions of cell fractions, such as nuclear fractions, cytoplasmic fractions, mitochondrial fractions and membrane fractions.
  • Methods for preparing assay solutions such as enzyme assay solutions, cell extracts and cell suspensions, known in the art may be used.
  • physiologically compatible buffers such as phosphate buffered saline may be used. See for example, the series, Methods in Enzymology, Academic Press, New York.
  • the first and second reporter components are each fluorescent proteins and the detectable signal results from fluorescence resonance energy transfer (FRET).
  • FRET fluorescence resonance energy transfer
  • Luminescent proteins may also be employed.
  • the first complementing component is a luminescent protein and the second complementing component is fluorescent proteins and the detectable signal results from bioluminescence resonance energy transfer
  • any suitable fluorescent protein can be used including, but not limited to green, red, cyan and yellow fluorescent proteins.
  • the luminescent protein is a Renilla luciferase or a firefly luciferase.
  • nucleic acid sequence encoding SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5, a vector comprising the nucleic acid sequence, and a cell comprising the nucleic acid sequence or the vector.
  • a polypeptide encoded by the nucleic acid sequences provided herein is also provided herein. Specifically, provided herein is a polypeptide comprising the polypeptide encoded by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 SEQ ID NO: 4 or SEQ ID NO: 5.
  • the fusion gene constructs of the invention are introduced into cells to assay for cellular interactions.
  • the fusion gene constructs may also contain promoters and other transcriptional and/or translational regulatory sequences that are normally associated with the gene encoding the target of interest.
  • the fusion gene construct may be introduced into cells by any method of nucleic acid transfer known in the art, including, but not limited to, viral vectors, transformation, co-precipitation, electroporation, neutral or cationic liposome-mediated transfer, microinjection or gene gun.
  • Viral vectors of interest include, but not limited to: retroviruses, poxviruses, herpesviruses, adenoviruses, and adeno-associated viruses.
  • retroviral vectors are employed, which are capable of stable integration into the genome of the host cell.
  • retroviral constructs encoding integration and packaging signals, drug resistance markers and one or more fusion genes of interest are useful in the practice of certain embodiments of the invention.
  • Different fusion gene constructs encoding unique fusion protein may be present on separate nucleic acid molecules or on the same nucleic acid molecule.
  • the present fusion gene construct or fusion proteins may be introduced into cultured cells, animal cells in vivo, animal cells ex vivo, or any other type of cell in which it is desired to study cellular interactions. Any suitable expression system can be used to express the reporter components in situ.
  • Transformation may be achieved using viral vectors, calcium phosphate, DEAE-dextran, electroporation, cationic lipid reagents, or any other convenient technique known in the art.
  • the manner of transformation useful in the present invention are conventional and are exemplified in Current Protocols in Molecular Biology (Ausubel, F. M., et al., eds. 2000).
  • Exogenous expression of the receptor components can be transient, stable, or some combination thereof. Exogenous expression can be enhanced or maximized by co-expression with one or more additional proteins, e.g., HIV rev.
  • Exogenous expression can be achieved using constitutive promoters, e.g., SV40, CMV, and the like, and inducible promoters known in the art. Suitable promoters are those which will function in the cell of interest.
  • the expression vector is a retroviral vector.
  • the site of integration of the expression construct if integrated into a host chromosome, would affect the efficiency of transcription and, therefore, expression of the fusion protein.
  • homologous recombination to ensure that the site of integration provides for efficient transcription.
  • an insertion element into the genome, such as Cre-Lox at a site of efficient transcription, one can direct the expression construct to the same site. In any event, one will usually compare the enzyme activity from cells in a predetermined environment to cells in the environment being evaluated.
  • the gene encoding the fusion protein will be part of an expression construct.
  • the gene is positioned to be under transcriptional and translational regulatory regions functional in the cellular host.
  • the regulatory regions may be the native regulatory regions of the gene encoding the protein that forms the EC (expression construct), where the fusion protein may replace the native gene.
  • the site of the gene in an extrachromosomal element or in the chromosome may vary as to transcription level. Therefore, in many instances, the transcriptional initiation region will be selected to be operative in the cellular host, but may be from a virus or other source that will not significantly compete with the native transcriptional regulatory regions or may be associated with a different gene from the gene for the EC, which gene will not interfere significantly with the transcription of the fusion protein.
  • Vectors that may be used include viruses, plasmids, cosmids, phagemids, YAC, BAC and HAC.
  • Other components of the vector may include origins of replication for one or more hosts, expression constructs for selection, including antibiotic resistance, proteins providing for a signal, etc., integration sequences and enzymes providing for the integration, multiple cloning sites, expression regulatory sequences, expression construct for a protein of interest.
  • Commercially available vectors have many or all of these capabilities and may be used to advantage.
  • nucleotide sequence of the plasmid cloning vector pCMV-PL-Cl SEQ ID NO. 6
  • AAACTGCCCA CTTGGCAGTA CATCAAGTGT ATCATATGCC AAGTACGCCC
  • the DNA or RNA vectors may be introduced into a cell where the expression of the fusion protein can occur.
  • the host may be a primary cell, a cell line, a unicellular microorganism, or the like, where the cell may be modified having an expression construct integrated or transiently present in the cell expressing a secretable form of EA, expressing or over-expressing a protein that the cell does not normally express under the conditions of the assay, not expressing a protein that the cell normally expresses as a result of a knockout, transcription or translation inhibitor, or the like.
  • the vector will include the fusion gene under the transcriptional and translational control of a promoter, usually a promoter/enhancer region, optionally a replication initiation region to be replication competent, a marker for selection, and may include additional features, such as restriction sites, PCR initiation sites, an expression construct providing constitutive or inducible expression of EA, or the like.
  • a promoter usually a promoter/enhancer region
  • a replication initiation region to be replication competent
  • a marker for selection and may include additional features, such as restriction sites, PCR initiation sites, an expression construct providing constitutive or inducible expression of EA, or the like.
  • the vector may be introduced into the host cells by any convenient and efficient means, such as transfection, electroporation, lipofection, fusion, transformation, calcium precipitated DNA, etc.
  • the manner in which the vector is introduced into the host cells will be one of efficiency and convenience in light of the nature of the host cell and the vector and the literature has numerous directions for the introduction of a vector into a host cell and the selection of the host cells that have effectively received the vector.
  • expression constructs that allow for selection e.g. antibiotics
  • the cells may be grown in a selective medium, where only the cells comprising the vector will survive.
  • the detection of the levels of the target could be obtained through a variety of antibody based methods such as Alpha Screen®, FRET, TR-FRET and the like.
  • Alpha Screen® Technology is commercially available from BioTek Instruments, Inc.
  • AlphaScreen used mostly in high throughput screening, is a homogenous assay technology similar to TR-FRET, to some extent, which allows detection of molecular events such as binding.
  • Coated "Donor” and "Acceptor” beads are the basis of the AlphaScreen assay technology.
  • AlphaScreen a bead based assay, works through the interaction of the beads coming close to each other, resulting in a cascade of chemical reactions that act to produce a greatly amplified signal.
  • FRET and TR FRET are described, e.g. in US 2012/02191,
  • affinity tags such as an affinity tag, e.g. a tag derived from hemagglutinin (HA-tag; polyhistidine tag (His5-10 (SEQ ID NO: 20), preferably His6 (SEQ ID NO: 19); also referred to as His-tag), FLAG-tag), or a Myc-tag.
  • affinity tag e.g. a tag derived from hemagglutinin (HA-tag; polyhistidine tag (His5-10 (SEQ ID NO: 20), preferably His6 (SEQ ID NO: 19); also referred to as His-tag), FLAG-tag), or a Myc-tag.
  • HRP horse radish peroxidsase
  • a labeling peptide may also be a peptide having a binding epitope for an antibody, a peptide binding biotin, a peptide for attachment of FITC, etc.
  • the assay procedure employed is to use the intact cells, either viable or non-viable. Non-viability can be achieved by heat, antibiotics, toxins, etc., which induce mortality while leaving the cells intact.
  • the cells are grown in culture in an appropriate culture medium suitable for the cells and may be grown to confluence or subconfluence, e.g. 80%.
  • the fusion protein expression construct and other constructs, as appropriate, may be present in the cell, integrated into the genome or may be added transiently by the various methods for introducing DNA into a cell for functional translation. These methods are amply exemplified in the literature, as previously described.
  • cells in culture comprising the fusion protein can be separated from cells in which the construct is absent. Once the fusion protein is being expressed, the environment of the cells may be modified, as appropriate.
  • Embodiments of the invention can be used in a broad range of studies for monitoring various cellular/molecular binding events.
  • non-limiting examples of different applications of the methods of the invention are provided.
  • the presently disclosed systems and methods can be used to detect various interactions in a cell.
  • fusion protein comprising the target of interest and ED is introduced into the cell and a known compound is applied to the cells. If the compound promotes the target peptide-test compound complex formation, there will an increase in the concentration of fusion protein in cell. Lysing the cell and incubating it with EA will result in an active enzyme formation. The enzyme will act on the substrate and produce a detectable product which will indicate complex formation when compared to cells where the compound is not applied to the cells.
  • the methods and assays disclosed in the present application can be employed to determine the interacting interfaces through which proteins interact.
  • the point of contacts through which proteins interacts have specific characteristics and are known as "hotspots".
  • a fusion protein comprising target protein of different sequence lengths and ED is introduced into the cell.
  • a particular sequence length target comprising the interacting sequences will form a complex with its interacting counterpart whereas the sequence length target which does not comprise the interacting sequence will not be able to form a complex with its interacting counterpart.
  • the fusion protein forming a complex will be stabilized whereas the fusion protein which does not form a complex will be degraded in cell.
  • An increase in the concentration of stabilized fusion protein will be detected through complementation assay and thus will help in identifying the interacting sequences.
  • the methods disclosed can be used to screen small molecules that may act as inhibitors of known binding complexes.
  • Small molecule inhibitors are an emerging choice for drug discovery studies.
  • a fusion protein comprising a known target and ED is introduced into the cell.
  • the target peptide interacts with the test compound and forms a complex through protein-protein interactions. Treating the cells with small molecules will result in the destabilization of fusion protein and hence will be degraded which will result in a decrease in concentration of fusion protein which will then be detected using complementation assay.
  • binding sites may exit in the wild type protein for binding to cell signaling molecules, natural enzymatic substrates, accessary proteins, nucleotides, polynucleotides, etc.
  • transcription factors are known to regulate specific gene expression patterns in response to developmental and environmental stimuli. They form specialized multi-protein complexes to regulate gene expression and thus regulating cellular responses. Thus, directly inhibiting or activating the function of a transcription factor requires specific disruption or recruitment or protein-protein or protein-DNA interactions. Therefore, the methods disclosed in the present application can be used to screen small molecules that modulate these interactions and thus will have implications in various human cancers and to develop probes for understanding the role of transcription factors in various cancers.
  • Various transcription factors such as NFKB, JNK, STATl, STAT2, FOXO, Sox2, SP1, RXR, RAR, Myc, Max, MAPK, HNF4, VDR among others and their interactions can be studied with the disclosed methodology.
  • Heat shock protein -Hsp90 is one of the most abundant proteins in eukaryotic cell, comprising 1-2% of total proteins under non-stress conditions.
  • Hsp90 interacts with and stabilizes various kinases such as ErbB2, Src, Abl, Met tyrosine kinases, cyclin dependent serine kinases among others which are key members of malignant transformation. Further, Hsp90 is also necessary for the maturation of several transcription factors, like the nuclear hormone receptors and the hypoxia-inducible factor- 1. Thus, assays of Hsp90 inhibitor causing the release of the complex partner and subsequent degradation can be done using the presently disclosed methodology.
  • Apoptosis or programmed cell death, is a normal component of the development and health of multicellular organisms. Cells die in response to a variety of stimuli and during apoptosis they do so in a controlled, regulated fashion. This makes apoptosis distinct from another form of cell death called necrosis in which uncontrolled cell death leads to lysis of cells, inflammatory responses and, potentially, to serious health problems. Direct initiation of apoptotic mechanisms in mammals have been suggested through TNF-induced path and the Fas induced path.
  • kinases are of great significance, such as tyrosine kinases, the MAP kinases, the cyclin dependent kinases, GTP kinases, ser/thr kinases, Chkl and 2, etc and can be studied with the presently disclosed methodology.
  • neuronal proteins such as ⁇ -amyloid, TNF, prion, APP
  • transporters e.g. dopamine transporter
  • receptors such as NMDA receptors, AMDA receptors, dopamine receptors, channels, etc.
  • housekeeping proteins will be of interest, such as the proteins involved in the tricarboxylic acid cycle, the Krebs cycle, glycogenesis, etc.
  • the present methods and materials can be used to study diseases known to be caused by the degradation/destabilization of mutated proteins.
  • diseases known to be caused by the degradation/destabilization of mutated proteins.
  • LSD lysosomal storage disorder
  • genetic mutations may cause a lysosomal enzyme to be misfolded [Brooks, D.A. Nat. Chem. Biol. 3, 84-85 (2007)] thus rendering it unstable and unable to move within the cell and function.
  • the assay finds utility in diseases resulting from the mutated proteins like SOD1 (associated with ALS), p53 (associated with cancer).
  • SOD1 associated with ALS
  • p53 associated with cancer
  • Alanine glyoxylate aminotransferase associated with primary hyperoxaluria type 1
  • SMNl associated with spinal muscular atrophy
  • the present assay also finds utility in determining the half-life of mutated target peptide. Mutated peptide can be fused to a labeling peptide and a time-dependent activity can be detected in the presence and absence of binding partner to determine the half-life.
  • Methods for measuring protein half lives can be derived using the present methods, or other, different methods known in the art. See, e.g. Yewdell et al., "Out with the old, in with the new? Comparing methods for measuring protein degradation," Cell Biol Int 35:457 (2011)
  • the composition, methods and assays disclosed also find utility to study proteins with tandem repeats in the sequence. Proteins with tandem repeats have a variety of binding properties and are known to be involved in protein-protein interactions and thus the studies will have great implications in elucidating the nature of known and unknown interactions, sequences involved in the interactions, compounds specific for tandem repeat structures.
  • ATP-binding motif also called the Walker motif, is a structural protein motif that is frequently found in proteins that bind ATP or GTP. It can usually be identified from just the primary structure of a protein using a fingerprint sequence that characterizes proteins as ATP or GTP-binding (see GTP-Binding Proteins). Walker et al.
  • the A region has a stretch of small hydrophobic residues followed by [Gly/Ala]— X— X— Gly— X— Gly— Lys— Thr/Ser, where X is any residue.
  • the second region of sequence conservation also has a stretch of small hydrophobic residues, this time ending in a conserved aspartate residue.
  • the hydrophobic residues of the A- region form a buried b-strand, and the glycine-rich region forms a loop, called the P-loop, that interacts with the phosphate of the bound nucleotide.
  • the second conserved region codes for another hydrophobic b-strand, and the conserved aspartate is required for binding the magnesium ion that usually accompanies nucleotides bound to proteins.
  • transcription factors bind to nucleotide sequences through binding sites on those molecules.
  • An allosteric binding site is generally defined as a site other than the protein's active site. Allosteric modulation is the regulation of proteins or enzymes by the binding of an effector molecule at the allosteric site (a site other than the proteins active site).
  • a fusion protein is constructed with a mutated peptide having an amino acid sequence other than or in addition to the active binding site (i.e. an allosteric site) and introduced into the cell. Treating the cells with various molecules who participate in binding will help in identifying the allosteric modulators of known protein as they will bind to the proteins at the non-active site and will stabilize the proteins.
  • Allosteric sites can be drug targets, such as in the case of GPCRs. exemplified below is allosteric binding to MEKK. Allosteric JNK inhibitors are also known. Methods for identifying allosteric sites for inclusion in the present assay are described further in Patent Application WO/2003/087051, "Methods for Identifying allosteric sites”.
  • bromodomain sequences are described in detail in the examples below.
  • the bromodomain (BRD) which is the conserved structural module in chromatin- associated proteins and histone acetyltranferases, is the sole protein domain known to recognize acetyl- lysine residues on proteins. These sequences are known in the literature, and, e.g described in US 7,589,167 entitled "ZA loops of bromodomains.”
  • the catalytic site of an enzyme is the portion of the enzyme where the substrate is acted upon.
  • protein kinases are known to have a consensus pattern of about 10 amino acids in the catalytic site, as described in Prosite documentation PDOC 00100 (http (colon slash slash) prosite.expasy.org/PDOC00100).
  • a catalytic triad refers to the three amino acid residues found inside the active site of certain protease enzymes: serine (S), aspartate (D), and histidine (H). Further descriptions of catalytic sites on enzymes may be found at http (colon slash slash)www (dot)ebi. ac.uk/thornton-srv/databases/CSA/, the EMBL catalytic site atlas.
  • catalytic site of an enzyme is often found in a separate subunit.
  • the catalytic subunits of protein kinases are highly conserved, and several structures have been solved.
  • kits for use in practicing one or more of the above described applications.
  • kits at least include a cell that expresses, either constitutively or inducibly, fusion protein that include a target protein and a ⁇ -galactosidase fragment, as reviewed above.
  • kits include elements for making such cells, e.g., nucleic acids encoding fusion protein present on vectors and/or nucleic acids encoding ⁇ -galactosidase fragment to which proteins of interest can be fused using standard molecular biology techniques, as reviewed above.
  • the kits may further include one or more additional components which find use in practicing certain embodiments of the invention, including but not limited to enzyme substrate, cell growth media, etc.
  • the present kits include (a) a cell comprising: a first fusion protein comprising the target protein and ED fragment of ⁇ -galactosidase, (b) EA fragment of ⁇ -galactosidase and (c) ⁇ -galactosidase substrate.
  • the kit may include (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment;(b) EA fragment of ⁇ - galactosidase; and (c) a ⁇ -galactosidase substrate.
  • kits that include (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment; compound, (b) EA fragment of ⁇ - galactosidase; and (c) a ⁇ -galactosidase substrate. Also provided are kits that include (a) a cell comprising: a fusion protein comprising the target and ED fragment of ⁇ -galactosidase fragment; small molecule, (b) EA fragment of ⁇ -galactosidase; and (c) a ⁇ -galactosidase substrate.
  • kits that include (a) a cell comprising: a fusion protein comprising the variant sequence lengths of target and ED fragment of ⁇ -galactosidase fragment; (b) EA fragment of ⁇ -galactosidase; and (c) a ⁇ -galactosidase substrate.
  • kits comprising an expression construct encoding a fusion protein comprising a target peptide fused to an ED fragment of ⁇ -galactosidase.
  • the vector comprises a restriction site positioned on a vector such that when a protein coding sequence is inserted into the vector using the restriction site, the vector encodes a fusion protein of the target and the ⁇ -galactosidase fragment.
  • the kit further comprises a mammalian cell.
  • the subject kits may further include instructions for practicing the subject methods. These instructions may be present in the subject kit in a variety of forms, one or more of which may be present in the kit.
  • One form in which these instructions may be present is as printed information on a suitable medium or substrate, e.g., a piece or pieces of paper on which the information is printed, in the packaging of the kit, in a package insert etc.
  • Yet another means would be a computer readable medium, e.g., diskette, CD, etc., on which the information has been recorded.
  • Yet another means that may be present is a website address which may be used via the internet to access the information at a removed site. Any convenient means may be present in the kits.
  • Example 1 Use of binding assay to monitor interaction interfaces
  • kinases bind ATP and catalyze the transfer of phosphate to target proteins.
  • a general method of inhibiting kinase function is to apply a small molecule that blocks ATP binding to the target kinase. In this manner the compound is termed ATP-competitive.
  • the BLK (241-490)-PL amino acid sequence is shown below (SEQ ID NO. 7).
  • the amino acid numbers 241-490 of the BLK are shown within the sequence.
  • the PL sequence is underlined, and the nucleotide binding sequence is bolded.
  • the kinase domain is included in the sequence.
  • fusions were constructed that included varying amounts of the protein sequence centered around the kinase active site as defined by homology to other kinases.
  • fusion containing protein BLK amino acid numbers 241-494, 246-494, 251-494, 256-494, 261-494 and 266-494 were made.
  • the expression construct containing the fusion protein was used to transduce the HEK cells. The cells were then incubated in the presence of dasatinib for 3 hours.
  • BLK- PL fusions were then quantified by adding lysis buffer, EA and
  • Dasatinib N-(2-chloro-6-methylphenyl)-2-[[6-[4- (2-hydroxyethyl)- 1 -piperazinyl] -2-methyl-4-pyrimidinyl] amino] -5-thiazole carboxamide monohydrate, is an oral multi- BCR/ABL and Src family tyrosine kinase inhibitor approved for use in patients with chronic myelogenous leukemia (CML).
  • CML chronic myelogenous leukemia
  • results showing the binding of dasatinib to BLK containing amino acid sequence 241-494 are depicted in Figure 3.
  • the expression plasmids (e.g. 241-494) indicated in the legend are named to show the amino acid locations of the start and stop of the BLK sequence used.
  • the plasmids were used to transduce parental U20S cells. The cells were then treated with dasatanib for 3 hrs and the BLK-PL fusions were quantified by adding lysis buffer, EA and chemiluminescent substrate. As can be seen, the 241-494 construct showed the most robust response.
  • Example 2 Use of binding assay to monitor small molecules as inhibitors of kinase interactions
  • PDL173955 is a small molecule known to complex with the C-Abl kinase domain.
  • Foretinib GSK1363089, XL880
  • MET and VEGFR2/KDR kinases inhibitor are small molecule MET and VEGFR2/KDR kinases inhibitor.
  • Cells expressing the BLK-PL fusion were treated with the indicated ATP- competitive molecules for 6 hours. The cells were then lysed in the presence of EA and substrate; luminescence was measured 30 minutes later.
  • BLK-PL SEQ ID NO. 7
  • the expression constructs were used to transduce HEK cells.
  • the U20S cell pools expressing the indicated BLK-PL fusion were shown to detect different affinity compounds (dasatinib, PD173955, XL-2880) by changes in efficacy and potency ( Figure 4).
  • Example 3 Use of binding assay to monitor interaction of fusion protein with known compound and inhibition by small molecules
  • B-cell lymphoma-2 (BCL2) and BCL-X L are anti-apoptotic proteins whose function is regulated by the binding of anti- or pro-apoptotic factors such as BAK (Bcl-2 homologous antagonist/killer).
  • the Bcl-2 family of proteins include both anti- apoptotic molecules, such as Bcl-2 and Bcl-XL, and pro-apoptotic molecules, such as Bax, Bak, Bid and Bad.
  • Bcl-2 contributes to cancer cell progression by preventing normal cell turnover caused by physiological cell-death mechanisms.
  • Members of the BCLl-2 family of proteins represent key regulators of apoptosis, with pro-apoptotic (e.g., Bax, Bak, Bid, Bim, Noxa, Puma) and anti-apoptotic function (e.g., Bcl-2, Bcl-xL, Mcl-1).
  • Selective and competitive dimerization between pro-and anti-apoptotic members of the family determines the fate of a cell given pro-apoptotic stimulus.
  • truncating BCL2 will affect the stability of the protein.
  • Bcl-2 has separate binding sites that are responsible for homodimer and heterodimer formation. See, PNAS March 10, 2009 vol. 106 no. 10 3935-3940.
  • the amino acid sequence of the BIM fragment (SEQ ID NO. 8) (full length bim beta 5, 36 amino acids is at GenBank: AAT34900.1) is shown below:
  • the amino acid sequence of the BAK fragment (SEQ ID NO. 9) is shown below: GQVGRQLAIIGDDINR (SEQ ID NO. 9) full length Bak at GenBank: AAI10338.1, 153 amino acids)
  • the amino acid sequence of the BAX fragment (SEQ ID NO. 10) is shown below:
  • QDASTKKLSECLKRIGDELDS (SEQ ID NO. 10)( compare to full length Bax epsilon at GenBank: AAD22706.1, 164 amino acids)
  • the BIM-PL fusion sequence is shown below (SEQ ID NO. 11):
  • the native BCL-2 was co-expressed with each of the ProLabel fusions in U20S cells. Small molecules that are reported to disrupt BCL-2 interactions were then applied to the cells and incubated overnight.
  • Figure 7B shows that addition of ABT263 (small molecule dual Bcl-2/Bcl-xL inhibitor designed to restore apoptosis) and ABT 737 (small molecule mimicking Bcl-2 antagonist BH3) prevented the stabilizing effect of Bim on BCL-2. These compounds had a somewhat similar effect on BCL-2 stabilization of Bax ( Figure 7B). These compounds had little effect on BCL-2 binding to and stabilization of Bak ( Figure 7C).
  • ABT263 small molecule dual Bcl-2/Bcl-xL inhibitor designed to restore apoptosis
  • ABT 737 small molecule mimicking Bcl-2 antagonist BH3
  • MEK kinases comprise a family of related serine-threonine protein kinases that regulate mitogen-activated protein kinase (MAPK) signalling pathways leading to c-Jun NH2-terminal kinase (JNK) and p38 activation, induced by cellular stress (e.g., UV and gamma irradiation, osmotic stress, heat shock, protein synthesis inhibitors), inflammatory cytokines (e.g., tumor necrosis factor alpha, TNF alpha, and interleukin-1, IL1) and G protein-coupled receptor agonists (e.g., thrombin).
  • cellular stress e.g., UV and gamma irradiation, osmotic stress, heat shock, protein synthesis inhibitors
  • inflammatory cytokines e.g., tumor necrosis factor alpha, TNF alpha, and interleukin-1, IL1
  • G protein-coupled receptor agonists
  • U0126 is a highly selective inhibitor of both MEKl and MEK2, a type of MAPK/ERK kinase.
  • PD0325901 (R)-N-(2,3-dihydroxypropoxy)-3,4-difluoro-2-(2-fluoro-4- iodophenylamino)benzamide) is a selective and non ATP-competitive mitogen activated protein kinase kinase (MEK or MAPKK) MEK inhibitor.
  • MEK or MAPKK mitogen activated protein kinase kinase
  • NP_002746.1 was fused with the PL (SEQ ID 12).
  • the MEK (58-371)-PL sequence is shown in (SEQ ID NO. 12). This contains the catalytic domain.
  • the PL portion is
  • Example 5 Use of binding assay to monitor the specificity of binding compounds Dasatinib (a known ATP-competitive molecule) and U0126 and PD0325901 (known kinase inhibitors) were used to determine their specificity for ATP binding and non-ATP binding sites respectively.
  • Dasatinib a known ATP-competitive molecule
  • U0126 and PD0325901 known kinase inhibitors
  • Bromodomain proteins are known as epigenetic reader proteins and play an important role in the targeting of chromatin-modifying enzymes to specific sites.
  • BRD4 for example, contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.
  • fusion proteins were prepared using fragments of BRD4 (1) (Accession No. NM_058243), BRD2 (1) (Accession No.
  • NM_005104 and BRDT (1) (Accession No. NM_001242806) (SEQ ID NO. 13, 14 and 15 respectively) and prolabel (PL).
  • the expression construct containing the fusion proteins were used to transducer the HEK cells. Cells were plated in a 384 well-plate and incubated overnight at 31 ° CI 5% C02 to allow the cells to attach and gro. These sequences are listed as follows:
  • the assay can also be applied to proteins which consist of bromodomains as tandem domains (BRD-BRD, PHD-BRD or BRD-PHD) which are tightly associated with each other in sequence.
  • BRD-BRD bromodomains as tandem domains
  • BRD-PHD BRD-PHD
  • Example 7 Use of binding assay to study the effect of compound binding on half -life of a transferase enzyme in a cell
  • Methyltransferases are a group of transferases enzymes involved in DNA
  • G9a methyltransferase methylates lysine 9 of histone H3 and is present in humans.
  • the catalytic domain of G9A methyltransferase (a.a. 918- 1193, accession no. NM_006709) was fused at its C-terminus to PL tag (detection peptide, underlined below) (SEQ ID NO. 17).
  • G9A(918-1198)-PL (SEQ ID NO. 17), PL underlined for clarity MTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDD CSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQL YRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARY YGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTC OCGSEKCKHSAEAIALEOSRLARLDLSFELLESSNSLAVVLORRDWENPGVTOLNRLAAHPP FASWRNSEEARTDR
  • the enzyme donor PL fused to the catalytic domain of G9A was expressed in A549 cells, which were plated I a 384-well plate and incubated overnight at 37 ° C/5% C02 to allow the cells to attach and grow.
  • Cells expressing fusion protein were divided into 2 batches, one serving as control and other treated with binding compound (UNC0638) for 6 hrs at 37 ° C. Both the batches were then treated with cycloheximide to prevent further protein production and the half-life of the fusion protein in both the batches were calculated as shown in Figure 10. As can be seen, after 100 minutes the percent change in luminescence of the UNC0638 treated cells was minimal, while the cells treated with only cycloheximide had dropped approximately 50%.
  • UNC0638 is commercially available and is an inhibitor of G9a/GLP methyltransferases. See, e.g. http (colon slash slash) apps.thesgc.org/chemical_probes/ UNC0638/#overview, SGC product literature.
  • Cytochrome P450 are a major class of enzymes participating in drug metabolism and thus also act as a marker in drug designing/discovery studies.
  • Catalytic domain of each CYP (CYP19A accession no. NM_000103; SEQ ID NO. 18 and CYP 17A, accession no. NM_000102; SEQ ID NO. 19) was fused at its C-terminus to the PL tag.
  • HEK cells were transduced with fusion protein expression construct. The cells were then treated with different compounds for 3-6 hrs at 37 ° C. the fusion proteins were then quantified to analyze the effect of different compounds on the stabilization of fusion proteins. The following best- fit values were obtained, and the data for CYP 17 A is shown in Figure 11, which shows stabilization of that domain with Ketoconazole and Abiraterone, with the following best fit data:
  • S/B 1,9 2.0 CYP17 localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and
  • Ketoconazole is an imidazole medicine used to treat fungal infections. It binds to the fungal p450 enzymes, and is shown here to bind to CYP17a.
  • Abiratone, CAS 154229- 19-3, is known to be a potent CYP 17 inhibitor
  • CYP 19A amino acids 1-503 it was also found that anastrazole and YM511 stabilized that fusion peptide (data not shown).
  • Arimidex ® anastrazole is available from AstraZeneca and is known to bind to aromatase.
  • YM511 (chemical Name: 4-[[(4- Bromophenyl)methyl]-4H-l,2,4-triazol-4-ylamino]benzonitrile) is also an aromatase inhibitor.
  • CYP 19 is also known as aromatase.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Molecular Biology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
PCT/US2013/024789 2012-02-06 2013-02-05 Detection of intracellular binding events by measuring protein abundance Ceased WO2013119579A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP18156334.7A EP3367096B1 (en) 2012-02-06 2013-02-05 Detection of intracellular binding events by measuring protein abundance
EP13746491.3A EP2812695A4 (en) 2012-02-06 2013-02-05 DETECTION OF INTRA-CELLULAR BINDING EVENTS BY MEASUREMENT OF THE PROTEIN FILL
CA2863774A CA2863774C (en) 2012-02-06 2013-02-05 Detection of intracellular binding events by measuring protein abundance
JP2014555836A JP6141327B2 (ja) 2012-02-06 2013-02-05 タンパク質存在量の測定による細胞内結合事象の検出

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261595525P 2012-02-06 2012-02-06
US61/595,525 2012-02-06

Publications (2)

Publication Number Publication Date
WO2013119579A1 true WO2013119579A1 (en) 2013-08-15
WO2013119579A8 WO2013119579A8 (en) 2014-06-26

Family

ID=48903215

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/024789 Ceased WO2013119579A1 (en) 2012-02-06 2013-02-05 Detection of intracellular binding events by measuring protein abundance

Country Status (5)

Country Link
US (1) US8945853B2 (enExample)
EP (2) EP3367096B1 (enExample)
JP (1) JP6141327B2 (enExample)
CA (1) CA2863774C (enExample)
WO (1) WO2013119579A1 (enExample)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016028804A1 (en) * 2014-08-21 2016-02-25 Discoverx Corporation Homogenous thermal shift ligand binding assay

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201814451D0 (en) * 2018-09-05 2018-10-17 Valerie Nicholas Carl Kristoffer Methods
CN113785072A (zh) * 2019-03-28 2021-12-10 欧陆迪斯卡沃爱克斯制品有限责任公司 启动子区域分析方法和用于实施该方法的细胞

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040137480A1 (en) * 2001-08-30 2004-07-15 Eglen Richard M. Monitoring intracellular proteins
US20100203555A1 (en) * 2009-02-12 2010-08-12 Discoverx Corporation Wild-Type Receptor Assays

Family Cites Families (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4378428A (en) 1981-03-30 1983-03-29 Baker Instruments Corporation Method for carrying out non-isotopic immunoassays, labeled analytes and kits for use in such assays
US4708929A (en) 1984-10-29 1987-11-24 Microgenics Corporation Methods for protein binding enzyme complementation assays
US5604091A (en) 1984-03-01 1997-02-18 Microgenics Corporation Methods for protein binding enzyme complementation
JPH0779717B2 (ja) 1984-10-29 1995-08-30 マイクロジエニツクス コ−ポレ−シヨン タンパク質結合酵素相補性検定に関する方法
CA1335707C (en) * 1989-08-15 1995-05-30 Pyare Khanna Drug screening assay
US5444161A (en) 1989-08-16 1995-08-22 Microgenics Corporation Substrates for β-galactosidase
US5543264A (en) 1990-06-29 1996-08-06 Associated Universities, Inc. Co-factor activated recombinant adenovirus proteinases
US6828099B2 (en) 1998-02-02 2004-12-07 Odyssey Thera Inc. Protein fragment complementation assay (PCA) for the detection of protein-protein, protein-small molecule and protein nucleic acid interactions based on the E. coli TEM-1 β-Lactamase
AU6045900A (en) 1999-05-25 2000-12-12 Panorama Research, Inc. Interaction-activated proteins
US7220552B1 (en) 1999-11-19 2007-05-22 The Board Of Trustees Of The Leland Stanford Junior University Bifunctional molecules and their use in the disruption of protein-protein interactions
US7589167B2 (en) 2000-02-22 2009-09-15 J. David Gladstone Institutes ZA loops of bromodomains
AU2002332724A1 (en) * 2001-08-30 2003-03-18 Discoverx, Inc. Genetic construct intracellular monitoring system
CA2478395A1 (en) 2002-04-08 2003-10-23 Sunesis Pharmaceuticals, Inc. Methods for identifying allosteric sites
JP2007521021A (ja) 2003-11-06 2007-08-02 ディスカヴァーエックス インコーポレイテッド 細胞膜タンパク質の検定
EP2400030B1 (en) 2004-05-18 2016-01-20 The Board of Trustees of the Leland Stanford Junior University Detection of protein translocation by beta-galactosidase reporter fragment complementation
US7842815B2 (en) 2004-06-17 2010-11-30 Infinity Pharmaceuticals, Inc. Compounds and methods for inhibiting the interaction of BCL proteins with binding partners
JP5303448B2 (ja) 2006-03-13 2013-10-02 ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティ 親和性が減少した酵素の相補性レポーター系を用いた分子相互作用の検出
ES2321359B1 (es) * 2006-06-07 2010-03-03 Centro De Investigacion Cooperativa De Biociencias- Cic Biogune Proteinas de fusion de p53 sin actividad de transcripcion y sus aplicaciones.
EP2099925B1 (en) 2006-12-26 2013-02-13 The Board of Trustees of The Leland Stanford Junior University Detection of sub-cellular compartment localization of a cell-surface receptor to an endosome using a reduced affinity enzyme complementation reporter system
US8101373B2 (en) 2007-10-12 2012-01-24 Discoverx Corporation β-galactosidase donor fragments
US8530636B2 (en) 2008-05-07 2013-09-10 The Board Of Trustees Of The Leland Stanford Junior University Method for regulating protein function in cells in vivo using synthetic small molecules
US20100120063A1 (en) 2008-10-10 2010-05-13 Discoverx Corporation GPCR Arrestin Assays
US8080796B1 (en) 2010-06-30 2011-12-20 Ut-Battelle, Llc Standoff spectroscopy using a conditioned target
EP2487183A1 (en) 2011-01-18 2012-08-15 Helmholtz-Zentrum für Infektionsforschung GmbH Ubiquitin-isopeptide probes
WO2012178079A1 (en) 2011-06-23 2012-12-27 Discoverx Corporation Monitoring protein trafficking using beta-galactosidase reporter fragment complementation

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040137480A1 (en) * 2001-08-30 2004-07-15 Eglen Richard M. Monitoring intracellular proteins
US20100203555A1 (en) * 2009-02-12 2010-08-12 Discoverx Corporation Wild-Type Receptor Assays

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
LANGLEY ET AL.: "Molecular Basis of Beta-Galactosidase alpha-Complementation.", PROC. NAT. ACAD. SCI. USA, vol. 72, no. 4, April 1975 (1975-04-01), pages 1254 - 1257, XP055159921 *
See also references of EP2812695A4 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016028804A1 (en) * 2014-08-21 2016-02-25 Discoverx Corporation Homogenous thermal shift ligand binding assay
US9618516B2 (en) 2014-08-21 2017-04-11 Discoverx Corporation Homogenous thermal shift ligand binding assay
EP3183580A4 (en) * 2014-08-21 2018-04-25 DiscoveRx Corporation Homogenous thermal shift ligand binding assay
CN108368535A (zh) * 2014-08-21 2018-08-03 欧陆迪斯卡沃爱克斯公司 用于测量配体与靶标蛋白质的结合和细胞接合的方法
US10641776B2 (en) 2014-08-21 2020-05-05 Eurofins Discoverx Corporation Methods for measuring binding and cellular engagement of ligands with target proteins

Also Published As

Publication number Publication date
EP2812695A1 (en) 2014-12-17
CA2863774C (en) 2016-08-16
EP3367096B1 (en) 2019-11-27
CA2863774A1 (en) 2013-08-15
EP3367096A1 (en) 2018-08-29
JP6141327B2 (ja) 2017-06-07
JP2015507200A (ja) 2015-03-05
WO2013119579A8 (en) 2014-06-26
EP2812695A4 (en) 2015-12-02
US20130203067A1 (en) 2013-08-08
US8945853B2 (en) 2015-02-03

Similar Documents

Publication Publication Date Title
Petschnigg et al. The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells
Cerosaletti et al. Active role for nibrin in the kinetics of atm activation
KR100948767B1 (ko) 생체 고분자 물질의 상호작용 검출 방법
Pichierri et al. The RAD9–RAD1–HUS1 (9.1. 1) complex interacts with WRN and is crucial to regulate its response to replication fork stalling
Henry et al. Palmitoylation of the immunity related GTPase, Irgm1: impact on membrane localization and ability to promote mitochondrial fission
Narendra et al. PINK1 rendered temperature sensitive by disease-associated and engineered mutations
Diaz et al. A split-Abl kinase for direct activation in cells
Fossati et al. A positive signal prevents secretory membrane cargo from recycling between the Golgi and the ER
Ozgul et al. An ELISA-based screening platform for ligand–receptor discovery
Tibbe et al. Functional analysis of CASK transcript variants expressed in human brain
Rivera-Reyes et al. Proteomic analysis identifies transcriptional cofactors and homeobox transcription factors as TBX18 binding proteins
US8945853B2 (en) Detection of intracellular binding events by measuring protein abundance
Batenburg et al. CSB and SMARCAL1 compete for RPA32 at stalled forks and differentially control the fate of stalled forks in BRCA2-deficient cells
Mukherjee et al. Identification of a small-molecule inhibitor that selectively blocks DNA-binding by Trypanosoma brucei replication protein A1
Johannessen et al. BKV agnoprotein interacts with α-soluble N-ethylmaleimide-sensitive fusion attachment protein, and negatively influences transport of VSVG-EGFP
Odell et al. Yeast three-hybrid screen identifies TgBRADIN/GRA24 as a negative regulator of Toxoplasma gondii bradyzoite differentiation
Tsianou et al. The enzymatic activity of SR protein kinases 1 and 1a is negatively affected by interaction with scaffold attachment factors B1 and 2
Paquin et al. FANCD2 binding to H4K20me2 via a methyl-binding domain is essential for efficient DNA cross-link repair
CA2571730A1 (en) Analysis of intracellular modifications
EP4508095A1 (en) Methods of identifying proximity effector polypeptides and methods of use thereof
KR20110118231A (ko) 형광표지 유전자 라이브러리를 이용한 결합단백질 스크리닝 방법
Shinn-Thomas et al. Quantitative assays for cell fusion
Jia et al. Relative quantification of protein-protein interactions using a dual luciferase reporter pull-down assay system
Petersen et al. Low‐density lipoprotein receptor‐related protein interacts with MafB, a regulator of hindbrain development
Hernandez et al. Bimolecular fluorescence complementation analysis to reveal protein interactions in herpes virus infected cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13746491

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2014555836

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2863774

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013746491

Country of ref document: EP