WO2013091004A1 - Prevention and treatment of mycobacterium infection - Google Patents

Prevention and treatment of mycobacterium infection Download PDF

Info

Publication number
WO2013091004A1
WO2013091004A1 PCT/AU2012/001569 AU2012001569W WO2013091004A1 WO 2013091004 A1 WO2013091004 A1 WO 2013091004A1 AU 2012001569 W AU2012001569 W AU 2012001569W WO 2013091004 A1 WO2013091004 A1 WO 2013091004A1
Authority
WO
WIPO (PCT)
Prior art keywords
mycobacterium
tuberculosis
bcg
protein
infection
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/AU2012/001569
Other languages
English (en)
French (fr)
Inventor
James Anthony TRICCAS
Rachel PINTO-NADANACHANDRAN
Warwick John BRITTON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centenary Institute of Cancer Medicine and Cell Biology
University of Sydney
Original Assignee
Centenary Institute of Cancer Medicine and Cell Biology
University of Sydney
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centenary Institute of Cancer Medicine and Cell Biology, University of Sydney filed Critical Centenary Institute of Cancer Medicine and Cell Biology
Priority to CN201280070011.6A priority Critical patent/CN104271744B/zh
Priority to AU2012357637A priority patent/AU2012357637B9/en
Priority to US14/367,854 priority patent/US9610337B2/en
Priority to ES12859440.5T priority patent/ES2655190T3/es
Priority to EP12859440.5A priority patent/EP2794885B1/en
Priority to IN5865DEN2014 priority patent/IN2014DN05865A/en
Publication of WO2013091004A1 publication Critical patent/WO2013091004A1/en
Anticipated expiration legal-status Critical
Priority to US15/445,697 priority patent/US9931391B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/04Mycobacterium, e.g. Mycobacterium tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • A61P31/06Antibacterial agents for tuberculosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/35Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/52Bacterial cells; Fungal cells; Protozoal cells
    • A61K2039/523Bacterial cells; Fungal cells; Protozoal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/07Nucleotidyltransferases (2.7.7)
    • C12Y207/07004Sulfate adenylyltransferase (2.7.7.4)

Definitions

  • the invention relates to the identification of antigens for preventing and treating Mycobacterium infection, especially but not exclusively Mycobacterium tuberculosis infection, to expression systems including live Mycobacterium for expression of said antigens for prevention and treatment of said infection, and to use of said antigens and expression systems for prevention and treatment of said infection.
  • Mycobacterium tuberculosis the causative agent of tuberculosis (TB) claims almost 2 million lives annually ((Dye, 2010) and globally is the leading cause of death due to a single bacterial agent. The situation has become more critical in the past decade due to co-infection with HIV and the inefficiency of the current vaccine, Bacillus Calmette-Guerin (BCG), to protect adults against TB ((Dye, 2010).
  • BCG Bacillus Calmette-Guerin
  • BCG Bacille Calmette Guerin
  • the invention seeks to address orie or more of the above mentioned needs and/or provide improvements in the prevention and/or treatment of Mycobacterium infection and in one embodiment provides a method for minimising the likelihood of development of a Mycobacterium infection in an individual including:
  • a method for preventing a Mycobacterium infection from developing in an individual including: - providing a component of a Mycobacterium SAP in an individual requiring said prevention in conditions for enabling formation of an immune response to said component in said individual; thereby preventing the Infection from developing in the individual.
  • a component of a Mycobacterium SAP in the manufacture of a medicament for minimising the likelihood of development of a Mycobacterium infection in an individual.
  • a component of a Mycobacterium SAP for minimising the likelihood of development of a Mycobacterium infection in an individual.
  • the Mycobacterium CsyD gene or gene product is a preferred component for use in the above described methods.
  • Mycobacterium cell including a recombinant CysD gene or protein.
  • a recombinant protein suitable for use in the above described composition, said protein including a first region having a sequence encoded by a Mycobacterium CysD gene and one or more- further regions having a sequence of a Mycobacterium antigen. Also provided is a nucleic acid encoding the recombinant protein, and an expression vector including said nucleic acid.
  • a protein suitable for use in the above described composition including a first region having a sequence encoded by a Mycobacterium CysD gene and a further region having a sequence encoded by a Mycobacterium Agb85 gene. Also provided is a nucleic acid encoding the protein and an expression vector including said nucleic acid.
  • an expression vector including a nucleic acid encoding a Mycobacterium CysD protein and a promoter, wherein said promoter is operably linked to the nucleic acid for expression of the nucleic acid when a Mycobacterium strain including the vector is introduced into an APC, said promoter having a sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone.
  • a Mycobacterium including a recombinant protein, nucleic acid or expression vector described above.
  • the cell may be derived from M. tuberculosis or may be an attenuated strain of M. tuberculosis.
  • a promoter operably linked to the recombinant nucleic acid for expression of the recombinant nucleic acid when the strain is introduced into an APC, said promoter having a sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone.
  • nucleic acid encoding a Mycobacterium antigen for providing an antigen specific immune response to Mycobacterium infection
  • a promoter operably linked to the nucleic acid for expression of the nucleic acid when the strain is introduced into an APC, said promoter having a sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone.
  • the Mycobacterium HspX promoter is a preferred promoter for use as a promoter having the sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone.
  • a strain of Mycobacterium including the above described expression vector.
  • an expression vector including:
  • nucleic acid encoding a protein including a first region having a sequence encoded by a Mycobacterium CysD gene and a further region having a sequence encoded by a Mycobacterium Agb85 gene;
  • a cell typically a M. tuberculosis cell or an attenuated Mycobacterium cell, for example an attenuated M. bovis cell such as BCG, or an attenuated M tuberculosis cell, said cell including the expression vector described above.
  • a method for minimising the likelihood of development of a M. tuberculosis infection in an individual including:
  • an expression vector including:
  • a recombinant nucleic acid encoding a protein including a first region having a sequence encoded by a Mycobacterium Agb85 gene and a further region having a sequence encoded by a Mycobacterium CysD gene;
  • Figure 1 Up-regulation of the M. tuberculosis sulphate-activation complex within host cells and during non-replicating persistence.
  • A Genetic organisation of the cysDNC locus encoding the sulphate activation complex.
  • the cysN (GTPase) and cysC (kinase) activites are fused together in one polypeptide and cysDNC constitute an operon.
  • B Relative expression level of cysDNC, measured by quantitative real time PGR, of bacilli grown for 48 hours in culture (clear bar) or 48 hours post infection of RAW cells (black bar).
  • C Effect of DETA-NO (Det) on growth of cultured M. tuberculosis. 50 ⁇ DETA-NO was added to M. tuberculosis culture (filled squares) every 24 hours for 7 days or left untreated (filled circles). At days 0, 1, 3 and 7, aliquots were taken to determine CFU/mL.
  • D Relative expression level of cysDNC (black bar) at day 7 post DETA-NO treatment compared to the untreated M, tuberculosis culture (clear bar).
  • Antigen-specific T cell responses in the MLN of mice were measured 3- (A) and 8 (B) weeks following intranasal M. tuberculosis challenge. IFN- ⁇ secreting cells were enumerated by ELIspot following recall to CysDNC or 85B proteins (l( ⁇ g/ml). Data are the means ⁇ S.E.M. for four mice and are representative of duplicate experiments. The significance of differences between protein-stimulated and unstimulated cells was determined by ANOVA; * p ⁇ 0.0001.
  • T cell proliferation in response to M. tuberculosis CFP, CysDNC and Ag85B proteins at 10 ⁇ g/ml was measured via the incorporation of 3 II-thymidine and a stimulation index calculated. Horizontal lines represent the median for each group. Significance of differences between M. tuberculosis infected patients and TST-ve individuals was determined by the Mann- Whitney U test; *p ⁇ 0.001. Figure 3. Protection afforded by DNA vaccines encoding members of the sulphate- activation complex following M. tuberculosis challenge.
  • mice were immunised 3 times by i.m injection at 2-week intervals with 100 ⁇ « each of either pCDNA3, DNA-cysD, DNA- cysNC or ⁇ -cysD combined with ⁇ -cysNC.
  • mice were immunised once by s.c injection with 5 x 10 3 CFU of BCG.
  • mice were challenged with aerosol M. tuberculosis.
  • Four weeks post challenge the bacterial load was determined in the lung (A) and the spleen (B).
  • A mean CFU
  • B spleen
  • FIG. 4 Up-regulation and host immune recognition of downstream enzymes in the M. tuberculosis sulphate-activation pathway.
  • A Relative up-regulation of M tuberculosis SAP genes within RAW cells compared to in vitro grown bacilli. Total RNA was extracted from in vitro grown bacilli or M. tuberculosis infected RAW cells at 48 hrs post infection, ⁇ g of total RNA was reverse transcribed and subject to real-time PGR to assess expression of M. tuberculosis cysH, sir A, cysKl and cysE. Data is the mean relative expression ⁇ S.E.M measured in triplicate and is representative of two independent experiments.
  • tuberculosis infected patients open circles
  • TST-ve individuals filled circles
  • T cell proliferation in response to M. tuberculosis CFP (as per Fig2C)
  • CysH, SirA, CysKl and CysE proteins at 10 ⁇ g/ml was measured as described in figure 2C.
  • Significance of differences between M. tuberculosis infected patients and TST-ve individuals was determined by a Mann- Whitney U test; *p ⁇ 0.001.
  • mice were immunised once by s.c injection with 5 x 10 5 CFU of BCG.
  • mice were challenged by the aerosol M. tuberculosis.
  • the bacterial load was determined in the lung (A) and the spleen (B).
  • FIG. 6 Protective efficacy of BCG after boosting with CysDN protein.
  • Groups of mice were immunized with 5 x 105 CFU BCG by s.c injection and after 24 weeks mice received s.c 100 ⁇ g of CysDNC protein in MPL-DDA (3 times at 2 week intervals). After 6 weeks mice were challenged with aerosol M. tuberculosis. Control mice were not immunized either no immunisation or immunisation with BCG and boosted with MPL-DDA adjuvant alone.
  • Four weeks post-challenge the bacterial loads in the lung (A) and spleen (B) were determined. These data are presented as the mean bacterial number ⁇ SEM per organ for 6 to 10 mice per group.
  • Supplementary Figure 1 Sulphate assimilation in mycobacteria. Once imported into the cell, sulphate is activated by ATP Sulfurylase, encoded by cysDNC to produce adenosine-5'-phosphosulfate (APS). In mycobacteria, APS lies at a metabolic branch point. It could be phosphorylated by APS kianse, encoded by cysC, to produce phosphoadenosine-5'-phosphosulfate (PAPS), which functions as the universal sulphate donor for the sulfation of biomolecules that are the building block of the mycobacterial cell wall.
  • APS phosphoadenosine-5'-phosphosulfate
  • sulphate moiety in APS could also be reduced to sulfite, catalysed by APS reductase and encoded by cysH.
  • Sulfite is further reduced to sulphide by sulfite reductase, (encoded by sirA) and is the form of sulphur that is incorporated into cysteine in the last step of this reductive pathway involving two enzymes, O-Acetylserine sulfhydralse (OASS) and serine acetyltransferase encoded by cysKI and cysE respectively.
  • OASS O-Acetylserine sulfhydralse
  • Cysteine is the building block of many important molecules in mycobacteria.
  • FIG. 8 In vivo induction of the hspX promoter within the host. Mice were vaccinated subcutaneously with 1 x 10, CFU of control BCG or BCG:P justify,,x-GFP and at 0 1 , 3 and 7 days postinfection the level of GFP expression in CD45, cells from the infection site was determined (A). Scatter plot of cells from mice (black dots) is overlaid on the level of GFP expression from mice infected with control BCG (grey dots). The total number of GFP* from the injected is shown in (B). Data shown are the means ⁇ SEM and are representative of two independent experiments. The significance of differences between day 0 and other time-points was determined by ANOVA (**p ⁇ 0.01 ; * **p ⁇ 0.0001).
  • FIG. 9 Expression of the hspX promoter within dendritic cells recruited to the site of vaccination. Mice were vaccinated as described in Fig. 2 and the number of cells displaying a DC phenotype (CDl lc «CDl lb «) was determined by flow cytometry (A). GFP-expressing cells within CD45* population is shown as a scatter plot (B) along with the total number of GFP.CDl I b ⁇ CDl l ew cells at the vaccination site over the timecourse (C). Data shown are means ⁇ SEM and are representative of two independent experiments. The significance of differences between day 0 and other time-points was determined by ANOVA (*p ⁇ 0.05; **p ⁇ 0.001 ; ***p ⁇ 0.0001).
  • the hspX promoter can facilitate improved T cell recognition of a recombinant antigen within APCs.
  • Cultured BMDC were left uninfected (uni) or infected with control BCG, or BCG:Pi «px-85B for 4 h prior to co-incubation with Ag85B-specific T cells purified from p25 mice.
  • the proliferation (A) and IFN-_ release (B) by p25 T cells at day 3 was determined by [).H]-thymidine uptake or IFN-_ ELISA respectively.
  • FIG. 12 Increased specific T cell immunity induced by vaccination with BCG expressing Ag85B under the control of the hspX promoter. Mice were left unvaccinated (unv) or vaccinated subcutaneoulsy with 5x l 0» CFU of control BCG, BCG:P ⁇ ,-85B or BCG:P ⁇ -85B. The number of IFN- _-secreting splenocytes responding to the p25 peptide from Ag85B was determined at 3 weeks (A) or 12 weeks (B) post-vaccination. Twelve weeks following vaccination, groups of mice were also aerosolized with M. tuberculosis H37Rv and 4 weeks post-challenge the M.
  • tuberculosis load in the lungs (C) and the spleen (D) were determined.
  • Data shown are the means ⁇ SEM for three mice per group and are representative of two independent experiments.
  • the significances of differences between unvaccinated mice and BCG- vaccinated groups were determined by ANOVA (*p ⁇ 0.05; **p ⁇ 0.001 ; ***p ⁇ 0.0001).
  • Vaccination with BCG:Ag85BCysD displays improved immunogenicity.
  • Splenocytes re-stimulated with Ag85BCysD protein demonstrated an increased number of IFN-g- secreting cells compared with splenocytes from mice immunised with BCG only.
  • FIG. 14 Protection induced by the Ag85B-CysD fusion protein.
  • MPL/DDA adjuvant
  • Ag85B-CysD fusion protein l Omg
  • Ag85B l Omg
  • sulphate assimilation pathway SAP
  • SAP sulphate assimilation pathway
  • SAP genes and proteins can be utilised to induce an antigen specific protective immune response. More specifically, the inventors show that immunisation with SAP genes and proteins provides protection to lungs and spleen in mice subsequently infected with M. tuberculosis and the protective efficacy approached that observed with BCG immunisation.
  • SAP genes and gene products can be used to improve the protective immunity provided by BCG vaccination whereby, as shown in the specification, the SAP components improved the protective effect of BCG against M. tuberculosis infection which was most apparent in lung tissue.
  • SAP proteins are proposed to be intracellular or membrane associated proteins which, given location, should be less likely than secreted proteins to be subject to immune surveillance.
  • the amount of immune activation observed in these studies is equivalent to that observed for the cell surface antigen or secreted antigen, Ag85B.
  • Sulphate assimilation pathway or SAP generally refers to the pathway by which Mycobacteria reduce sulphur, thereby obtaining substrate for the biosynthesis of cysteine and downstream products including myc thiol.
  • the pathway involves the formation of adenosine 5'- phosphosulfate (APS) from sulphate, from which APS reductase (encoded by CysH) may produce sulphite, and from which sulfite reductase (encoded by SirA) may produce sulphide, and from which, and with O-Acetyl-L-serine, O- Acetyl -L-Serine Sulfhydalase (encoded by CysKl) may produce cysteine.
  • APS adenosine 5'- phosphosulfate
  • SAP 3' phosphoadenosine S'-phosphosulfate
  • a SAP component generally refers to a protein or enzyme involved in the reduction of sulphur in Mycobacterium according to the SAP, examples of which include those encoded by CysD, CysNC, CysH, SirA, CysE, Cys l genes.
  • Sulphate activating complex or SAC generally refers to a heterodimeric complex formed from the association of the CysD gene product with the CysNC gene product.
  • the CysD and CysNC genes exist together in Mycobacteria as an operon.
  • CysD gene generally refers to a nucleic acid encoding a ATP sulfurylase.
  • the nucleic acid may have a nucleotide sequence substantially as shown in SEQ ID No: 1 herein or otherwise having defined homology and/or identity as defined herein.
  • CysD protein generally refers to a ATP sulfurylase.
  • the protein may have an amino acid sequence substantially as shown in SEQ ID No: 2 herein or otherwise having defined homology and/or identity as defined herein..
  • CysNC gene generally refers to a nucleic acid encoding a GTPase and APS kinase.
  • the nucleic acid may have a nucleotide sequence substantially as shown in SEQ ID No: 3 herein or otherwise having defined homology and/or identity as defined herein.
  • CysNC protein generally refers to a GTPase and APS kinase.
  • the protein may have an amino acid sequence substantially as shown in SEQ ID No: 4 herein or otherwise having defined homology and/or identity as defined herein.
  • Ag85B gene generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 5 herein or otherwise having defined homology and/or identity as defined herein.
  • Ag85B protein generally refers to a protein having an amino acid sequence substantially as shown in SEQ ID No: 6 herein or otherwise having defined homology and/or identity as defined herein.
  • HspX promoter generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 7 herein or otherwise having defined homology and/or identity as defined herein.
  • pHspX85BCysD generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 9 herein.
  • the inventors have shown that SAP components elicit an antigen specific protective immune response. Specifically, immunisation with SAP components, and in particular, SAC components prevents the progression of Mycobacterium infection in mice later infected with M. tuberculosis. Further, the inventors show that the SAP components can be used to boost immunity arising from BCG immunisation, and that the SAP components are highly immunoreactive in M. tuberculosis infected individuals, suggesting that these components are useful for minimising development of a disease or condition caused by infection. Therefore, the invention provides methods for: (i) prophylaxis; (ii) treatment; and (iii) boosting immunity to Mycobacterium infection. It is in these contexts that the methods of the invention minimise the likelihood of development of an infection, either by preventing the infection from developing to a relevant disease or pathology, or by preventing further development of a disease or pathology once an infection has been established.
  • the individual may not have a detectable Mycobacterium infection and/or may not have been previously immunised against Mycobacterium.
  • SAP Mycobacterium sulphate assimilation pathway
  • the individual may be asymptomatic or have sub-clinical symptoms of infection.
  • An asymptomatic subject more typically, has one or more symptoms (e.g., fever, cough, weight loss).
  • Bacilli may be present and culturable, i.e., can be grown in culture from the above body fluids and individuals may have radiographicaliy evident pulmonary lesions which may include infiltration but without cavitation.
  • the individual may have obvious symptoms of infection such as cavitary lesions in the lungs.
  • Bacilli may be culturable from smears of sputum and/or the other body fluids noted above, but also present in sufficient numbers to be detectable as acid-fast bacilli in smears of these fluids.
  • the immune response is predominantly a Thl response.
  • This response is determined by detecting cellular proliferation after administration of the vaccine as measured by 3 H thymidine incorporation, or using cellular assays in which IFN- ⁇ production is assessed, such as flow cytometry and/or ELISA.
  • the immune response can also be measured by detecting specific antibodies (at a titer in the range of 1 to 1 x 10 6 , preferably 1 x 10 3 , more preferable in the range of about 1 x l O 3 to about 1 x 10 6 , and most preferably greater than 1 x 10 6 ).
  • An in vitro cellular response is determined by release of a relevant cytokine such as IFN-gamma, from lymphocytes withdrawn from an animal or human currently or previously infected with virulent mycobacteria, or by detection of proliferation of these T cells.
  • the induction is performed by addition of the polypeptide or the immunogenic portion to a suspension comprising from IxlO 5 cells to 3xl0 5 cells per well.
  • the cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic portion of the polypeptide result in a concentration of not more than 20 ug per ml suspension and the stimulation is performed from two to five days.
  • a positive response is a response more than background plus two standard deviations.
  • the release of IFN-gamma can be determined by the ELISA method, which is well known to a person skilled in the art.
  • a positive response is a response more than background plus two standard deviations.
  • Other cytokines than IFN- gamma could be relevant when monitoring an immunological response to the polypeptide, such as IL- 12, TNF-.alpha., IL-4, IL-5, IL-10, IL-6, TGF-.beta..
  • cytokine e.g. IFN-gamma
  • ELISPOT method where the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 4 x 10 6 cells/ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic portion of the polypeptide resulting in a concentration of not more than 20 ug per ml.
  • the cell suspensions are hereafter diluted to 1 to 2 x 10 6 /ml and transferred to Maxisorp plates coated with anti-IFN-gamma and incubated for preferably 4 to 16 hours.
  • the IFN-gamma producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PGR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA. It will be appreciated by a person skilled in the art that a significant increase or decrease in the amount of any of these cytokines induced by ' a specific polypeptide can be used in evaluation of the immunological activity of the polypeptide.
  • the immune response may be formed by providing a component of a Mycobacterium SAP in an individual in conditions for enabling formation of an immune response to said component in said individual.
  • These components may be provided in various forms as discussed under the relevant subheadings below.
  • Recombinant BCG and other live mycobacterium can be delivered subcutaneously or by inhalation.
  • the dosage regimen may also be determined by the skilled person using his expertise (e.g. single administration, repeated administration (twice or more at regular or irregular intervals), etc. This will typically also depend on the disease to be treated and the individual receiving the treatment (in bladder cancer in humans, for instance, a low-dose BCG regimen has been described as 75 mg, while a standard dose is 150 mg). However, doses of BCG as low as 1 mg have been documented to effectively support an immune response for a long period of time (5 years). In tuberculosis, an example of a typical dose is much lower: 0.075 mg, corresponding to 0.3-1.2 million living mycobacteria).
  • a typical dose may fall between 0.01 ⁇ g/kg body weight and 10 mg/kg body weight.
  • one treatment typically protects for a number of years.
  • repeat doses are given (as is e.g. typically the case in treatment of bladder cancer).
  • the manner of application may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These include oral, nasal or mucosal application in either a solid form containing the active ingredients (such as a pill, suppository or capsule) or in a physiologically acceptable dispersion, such as a spray, powder or liquid, or parenterally, by injection, for example, subcutaneously, intradermally or intramuscularly or transdermal ⁇ applied.
  • the dosage of the vaccine will depend on the route of administration and will vary according to the age of the person to be vaccinated and, to a lesser degree, the size of the person to be vaccinated.
  • the vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly.
  • Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations.
  • suppositories traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1-2%.
  • Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like.
  • compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and advantageously contain 10-95%) of active ingredient, preferably 25-70%.
  • a carrier can be any substance that does not itself induce the production of antibodies harmful to the patient receiving the composition, and which can be administered without undue toxicity.
  • Suitable carriers can be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable carriers can include liquids such ' as water, saline, glycerol and ethanol.
  • Auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, can also be present in such vehicles.
  • Stabilizing agents such as trehalose or substances that allow water-soluble sugar glass formation at ambient temperatures may also be present. The latter includes the use of mixed soluble glass stabilisation technology in microsphere format suspended in perfluorocarbon liquids. Liposomes are also suitable carriers. A thorough discussion of pharmaceutical carriers is available in Gennaro (2000), Remington: The Science " and Practice of Pharmacy. 20th ed., ISBN: 0683306472.
  • the pharmaceutical composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered e.g. at between pH 6 and pH 8, generally around pH 7.
  • the composition is substantially isotonic with humans.
  • the compositions of the invention may be administered via a variety of different routes. Certain routes may be favoured for certain compositions, as resulting in the generation of a more effective response, or as being less likely to induce side effects, or as being easier for administration.
  • the compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous applications, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means.
  • compositions may be prepared for intranasal administration, as nasal spray, nasal drops, gel or powder, as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
  • Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, intranasally, or delivered to the interstitial space of a tissue.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • the method is particularly useful to confirm the result of Mantoux testing, or other conventional Mycobacterium testing, or otherwise for further delineating a Mantoux test result, for example to identify key specificities in a particular immune response, or nature of the relevant immunogens on which the response is based.
  • the various assays mentioned in the previous sub-heading for detecting formation of an immune response can be implemented here.
  • the invention provides vaccines and immune stimulating compositions.
  • the vaccines and immune stimulating compositions are useful for providing a protective immune response to Mycobacterium infection, especially M. tuberculosis infection.
  • a preferred immunogen in each of these forms is the CysD gene or gene product, or fragments of homo logs thereof.
  • D.1 Acelhdar compositions containing a recombinant or synthetic SAP component D.1 Acelhdar compositions containing a recombinant or synthetic SAP component.
  • the immune response is formed by providing a component of the SAP in the form of an acellular composition including isolated or recombinant SAP protein in the individual.
  • compositions include two key components, the first being the immunogen in the form of the recombinant or synthetic SAP component and the second being an adjuvant for potentiating an immune response to the immunogen.
  • the immunogen may include any one or more of the SAP components as described herein.
  • the immunogen includes CysD, or an immunogenic or antigenic fragment or homolog thereof. Fragments and homologs are described in more detail below.
  • the immunogen may further include other recombinant or synthetic Mycobacterium antigens or immunogens. These may be provided in a form whereby they are fused to CysD by a coyalent bond, where they are non covalently associated with CysD, or where they are not bound to CysD at all. Particular examples of these antigens and immunogens include Ag85B. Others are discussed in WO2009/070700.
  • a given SAP component such as CysD, CysNC, CysH, SirA, CysE, CysKl proteins and their encoding genes
  • a given SAP component is one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a given SAP component.
  • a CysD immunogen may be one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a CysD protein shown in SEQ ID No: 2.
  • the nucleic acid sequence encoding the CysD immunogen may be one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a CysD gene shown in SEQ ID No: 1.
  • Percent sequence identity is determined by conventional methods, by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) as disclosed in Needleman, S.B. and Wunsch, CD., (1970), Journal of Molecular Biology, 48, 443-453, which is hereby incorporated by reference in its entirety.
  • GAP is used with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
  • Sequence identity of polynucleotide molecules is determined by similar methods using GAP with the following settings for DNA sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3.
  • a given SAP component is provided in the form of a fragment that is capable of forming a protective immune response.
  • These fragments are generally of sufficient length and conformation enabling presentation by the APC on Class I or II. They may be of a length ranging generally from about 8 to 15, and about 8 to 11 for Class I presentation and H to 15 for Class II presentation.
  • MHC class II epitopes In order to identify relevant T-cell epitopes which are recognized during an immune response, a common method is to use overlapping peptides for the detection of MHC class II epitopes, preferably synthetic, having a length of e.g. 20 amino acid residues derived from the polypeptide. These peptides can be tested in biological assays, such as the IFN-gamtna assay as described herein and those that give a positive response will be classed as immunogenic T cell epitopes. MHC class I epitopes can be identified by predicting those peptides that will bind to Class I (Stryhn, A., et al 1996 Eur. J. Immunol. 26: 19.1 1-1918) and hereafter produce these peptides synthetically and test them in relevant biological assays e.g. the IFN-gamma assay as described herein.
  • the peptides preferably having a length of e.g. 8 to 1 1 amino acid residues derived from the polypeptide.
  • B-cell epitopes can be determined by analyzing the B cell recognition to overlapping peptides covering the polypeptide of interest as e.g. described in Harboe, M, et al 1998 Infect. Immun. 66:2; 717-723
  • CysD, CysNC, CysH, SirA, CysE, CysKl or related nucleic acid sequences can be made by solid phase synthesis or recombinant DNA technology.
  • adjuvant there are many examples of adjuvants known in the art. See also Allison (1998, Dev. Biol. Stand., 92:3-11 ; incorporated herein by reference), Unkeless et al. (1998, Annu. Rev. Immunol., 6:251-281), and Phillips et al. (1992, Vaccine, 10: 151-158).
  • Exemplary adjuvants that can be utilized in accordance with the invention include, but are not limited to, cytokines, aluminium salts (e.g., aluminium hydroxide, aluminium phosphate, etc.; Baylor et al, Vaccine, 20:S18, 2002), gel-type adjuvants (e.g., calcium phosphate, etc.); microbial adjuvants (e.g., immunomodulatory DNA sequences that include CpG motifs; endotoxins such as monophosphoryl lipid A (Ribi et al., 1986, Immunology and Immunopharmacology of bacterial endotoxins, Plenum Publ. Corp., NY, p407, 1986); exotoxins such as cholera toxin, E.
  • cytokines e.g., aluminium hydroxide, aluminium phosphate, etc.; Baylor et al, Vaccine, 20:S18, 2002
  • gel-type adjuvants e.g., calcium phosphate, etc.
  • Other exemplary adjuvants include some polymers (e.g., polyphosphazenes; described in U.S.
  • Patent 5,500,161), Q57, saponins e.g., QS21, Ghochikyan et al.. Vaccine, 24:2275, 2006
  • saponins e.g., QS21, GACHikyan et al.. Vaccine, 24:2275, 2006
  • squalene tetrachlorodecaoxide
  • CPG 7909 Poly[di(carboxylatophenoxy)phosphazene]
  • PCCP Payne et al., Vaccine, 16:92, 1998)
  • interferon- ⁇ Cao et al., Vaccine, 10:238, 1992
  • block copolymer P1205 CL1005; Katz et al, Vaccine,.
  • IL-2 interleukin-2
  • PMMA polymethyl methacrylate
  • DDA dimethyloctadecylammonium bromide
  • compositions may also include diluents, excipients and carriers enabling administration of the composition, as known in the art.
  • the immune response is formed by providing a component of the SAP in the form of a cell extract including an isolated or recombinant SAP protein in the individual.
  • Cell extracts may be obtained by known techniques, including for example sonification of a Mycobacterium strain, pelleting by centrifugation and retrieving lysate for immunisation.
  • the lysate could be further enriched for SAP components by for example immunoaffmity chromatography. This is most useful where the strain is not recombinant for a SAP component, i.e. where the strain is not otherwise an over-expressor of, or enriched for, a SAP component. Where the strain is a recombinant strain having high levels of expression of a SAP component, a chromatographic enrichment step may not be necessary.
  • the cell extracts may be particularly useful as an in vitro reagent for testing efficacy of an immunisation protocol.
  • the immune response is formed by providing a component of the SAP in the form of a cell including an isolated or recombinant SAP protein in the individual.
  • the cell is a Mycobacterium, and in particular a M. tuberculosis strain, especially an attenuated M. tuberculosis strain capable of forming a live attenuated vaccine.
  • a 'live attenuated vaccine' as used herein is a vaccine containing live or viable micro-organisms with reduced virulence (attenuated); as opposed to an inactivated vaccine.
  • mycobacterium examples include members of the Mycobacterium tuberculosis complex (Taxon identifier 77643 in the UniProt or NCBI taxonomy database), which includes the species M. tuberculosis (the major cause of human tuberculosis), M. bovis, M. bovis BCG (the strain most often used for vaccination purposes), M. africanum, M. microti, M. canetti, and M. pinnipedii.
  • the cell is a BCG strain.
  • suitable BCG strains exist which are suitable for use in the practice of the invention, including but not limited to those designated ATCC ® Number:
  • bovis TMC 1012 [ BCG Montreal ; CIP 105920]
  • bovis TMC 1 108 [BCG Pasteur SM-R] 27290 M. bovis [BCG Copenhagen H]
  • mycobacteria of the invention need not be confined to strains of BCG.
  • Mycobacterium strains may also be employed, examples of which include but are not limited to: M tuberculosis CDC 1551 strain (See, e.g. Griffith et at., Am. J. Respir. Crit. Care Med. Aug;152(2):808; 1995), M. tuberculosis Beijing strain (van Soolingen et al., J CHn Microbiol.
  • H37Rv strain (ATCC#:25618), M tuberculosis pantothenate auxotroph strain (Sambandamurthy et al., supra; M. tuberculosis rpo V mutant strain (Collins et al., Proc Natl Acad Sci USA. 92(17):8036; 1995), M. tuberculosis leucine auxotroph strain (Hondalus et al, Infect. Immun. 68(5):2888; 2000), etc., or other attenuated and/or recombinant strains derived from M. tuberculosis.
  • Other candidate bacteria include other members of the M.
  • SAP component may be over-expressed, i.e. the protein may be expressed at a level that exceeds that of a suitable control organism, such as the same mycobacterium that has not been genetically engineered to over-express the SAP component.
  • suitable control organism such as the same mycobacterium that has not been genetically engineered to over-express the SAP component.
  • the over-expression of the SAP component may be carried out by any suitable method known in the art. Generally, the method will involve linking nucleic acid sequences encoding the SAP component to a particular promoter or other regulatory element that is activated when the strain is introduced into a cell especially an APC. Those of skill in the art will recognize that many such expression control sequences are known and would be suitable for use in the invention. For example, if constitutive expression of SAP component is desired, expression control sequences (e.g.
  • promoters and associated sequences including but not limited to: mycobacterium optimal promoter (mop, George et al., 1995); blaF promoter (Timm et al., 1994); hsp60, ace or msp!2 promoters; etc., with or without an optimized ribosomal binding site.
  • over-expression of SAP may not be constitutive but may instead be inducible, in response to an environmental cue.
  • expression of the protein may be driven by a promoter that is induced in a particular location or in response to an environmental stimulus, examples of which include but are not limited to: macrophage inducible promoter (which drives expression of genes that are specifically upregulated within the macrophage phagosome, see Schannapinger et al. JEM 2003); acetamidase promoter (Mahenthiralingam et al., J. Gen. Microbiol. 1993), and tetracycline-inducible (Blokpoel et al., Nucl. Acids Res. 33(2):e22, 2005), etc.
  • promoters from other species may be utilized, examples of which include but are not limited to: various viral promoters, whereby after "gene therapy-like” strategies (e.g. co-inoculation of mycobacteria and an engineered virus) the Mtb antigens are expressed in selected tissues infected by the co-administered virus; etc.
  • gene therapy-like strategies e.g. co-inoculation of mycobacteria and an engineered virus
  • native or naturally occurring SAP promoters may be altered by mutation to cause over-expression of SAP component.
  • sequences encoding the SAP component in operable linkage with one or more expression control sequences, into a mycobacterial host where over-expression will occur.
  • the sequences may be included in a vector that is subsequently introduced into the mycobacterium.
  • Many vectors suitable for containing and expressing genes are known, and include but are not limited to various extra-chromosomal elements such' as plasmids, e.g.
  • plasmids those comprising the pALSOO origin of replication, modified to augment their copy number; or other plasmids with origins of replication that are or will be developed; orextrachromosomal elements that do not replicate or integrate into mycobacterial genome but provide a suicidal source for homologous recombination to occur; etc.
  • Introduction of such a vector into a mycobacterium may be carried out by any of several known methods suitable for that particular vector, including but not limited to electroporation and mycobacteriophage-mediated transduction for homologous recombination.
  • the vector is a plasmid and the method that is used is electroporation.
  • the SAP component is over-expressed from the M. tuberculosis chromosome.
  • M. tuberculosis chromosome various molecular biology strategies exist for generating a mycobacterium with this property.
  • various mutations may be introduced into the chromosome (randomly or in a directed fashion) that result in over-production of the SAP component by the bacterium.
  • nucleic acid sequences that include one or more expression control sequences operably linked to nucleic acid sequences encoding the SAP component may be introduced into the bacterial chromosome, e.g. by transduction with a suicide plasmid with or without a means for counter-selection, to provide sequences for homologous recombination.
  • an expression vector including:
  • nucleic acid encoding a Mycobacterium antigen for providing an antigen specific immune response to Mycobacterium infection
  • promoter operably linked to the nucleic acid for expression of the nucleic acid when the strain is introduced into an APC, said promoter having a sequence of a Mycobacterium promoter that causes immediate and sustained expression of a Mycobacterium antigen when said promoter is introduced into an APC.
  • the Mycobacterium HspX promoter is a preferred promoter for use as a promoter having the sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone. Specifically, as exemplified in Example 2 here, this promoter is capable of inducing high and sustained expression of a SAP component in a BCG strain.
  • Other examples of promoters useful in the invention include Rv()962c, Rv0971c, Rv0983. Rv0986 Rv2428,Rvl 130.Rv2626c as described in Fontan et al. 2008 Infect. & immun. 76:pp 717.
  • Vaccine formulation under this subheading involves studies to determine maximum bacterial viability and stability throughout the manufacturing process. This includes determination of maximum organism viability (live to dead) during culture utilizing a variety of commonly used medium for the culture of Mycobacteria to include the addition of glycerol, sugars, amino acids, and detergents or salts. After culture cells are harvested by centrifugation or tangential flow filtration and resuspended in a stabilizing medium that allows for protection of cells during freezing or freeze-drying process. Commonly used stabilizing agents include sodium glutamate, amino acids or amino acid derivatives, glycerol, sugars or commonly used salts. The final formulation will provide sufficient viable organisms to be delivered by intradermal, percutaneous injection, perfusion or oral delivery with sufficient stability to maintain and adequate shelf life for distribution and use.
  • the BCG strains described under this subheading Prior to administration to humans as a vaccine, the BCG strains described under this subheading are tested according to methods that are well-known to those of skill in the art. For example, tests for toxicity, virulence, safety, etc. are carried out in suitable animal models, e.g. in mice, guinea pigs, etc., some of which are immunocompromised. The ability of the vaccine preparations to elicit an immune response is likewise typically tested in suitable animal models, e.g. mice, guinea pigs, etc. In addition, protection studies involving vaccination, boosting, and subsequent challenge with live Mtb may be carried out using suitable animal models such as mice, guinea pigs, and non-human primates.
  • the immune response is formed by providing a component of the SAP in the form of or a nucleic acid encoding a SAP protein in the individual.
  • Example 1 the inventors have shown that protective immunity can be provided by administering a DNA vaccine containing a gene encoding CysD in mice challenged with M. tuberculosis.
  • the nucleic acid may be provided in linearised or circular form for injection.
  • the nucleic acid will have a promoter enabling expression of the SAP component in the relevant cell.
  • the vector will contain a promoter capable of activation by muscle transcription factors and enhancers.
  • the muscle cell will produce the relevant SAP component which will then be phagocytosed by an APC such as a dendritic cell for presentation to a T cell, upon which immunity is established.
  • the immune response is formed by providing a component of the SAP in the form of a viral vector that contains a nucleic acid that encodes the component, or that expresses a component of the SAP.
  • Suitable vectors include those based on a vaccinia genome and those based on an adenovirus genome.
  • compositions described under the above subheadings may be formulated as liquid solutions or suspensions, however solid forms such as tablets, pills, powders and the like are also contemplated. Solid forms suitable for solution in, or suspension in, liquids prior to administration may also be prepared. The preparation may also be emulsified.
  • the active ingredients may be mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredients. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol arid the like, or combinations thereof.
  • the composition may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and the like.
  • compositions of the present invention may contain any such additional ingredients so as to provide the composition in a form suitable for administration.
  • M. tuberculosis can survive in a broad spectrum of environments, including high levels of oxidative stress, low pH and nutrient depri vation ((Nathan, 2000 #29). Exposure and adaption of M. tuberculosis to these conditions during infection requires the coordinated regulation of gene expression ((Timm,
  • Cysteine can be subsequently incorporated into mycothiol which functions analogously to glutathione ((Fan, 2009 #197) and is crucial to M. tuberculosis within the granuloma in regulating the redox balance upon encountering free radicals released by host cells.
  • Mutants of Mycobacterium smegmatis in which mycothiol biosynthesis has been abrogated exhibit high-level resistance to isoniazid and are more susceptible than wild-type strains to oxidative stress and antibiotics ((Rawat, 2002 #82;Buchmeier, 2003 #85). This first line of defence by M.
  • tuberculosis therefore is linked to the availability of cysteine and as such has been shown to be required for the organism's surivial ((Sareen, 2003 #84;Buchmeier, 2006 #83;Newton, 2002 #81). Reinforcing this increased need for cysteine in the macrophage environemnt, is the up-regulation of ATP sulfurylase, the first enzyme in. the SAP, upon exposure to oxidative stress ((Pinto, 2004 #14;, #35;Schnappinger, 2003 #31). Disabling the biosynthesis of cysteine attenuates bacterial virulence and persistence during the chronic phase of infection in mice ((Senaratne, 2006 #3).
  • Escherichia coli K-12 and BL21 were grown in Luria-Bertani (LB) broth or agar (Sigma- Aldrich).
  • M. tuberculosis H37Rv or strain MT103 (Jackson, 1999 #208) were grown in Middlebrook 7H9 medium (Difco Laboratories) supplemented with 0.5% glycerol, 0.05% Tween 80, and 10% albumin-dextrose-catalase (ADC) or on solid Middlebrook 7H11 medium (Difco Laboratories) supplemented with oleic acid-ADC. All cultures were grown at 37 °C with or without shaking.
  • Antibiotics were added to media when required at 25 ⁇ g/mL for kanamycin and 100 ⁇ g mL for ampicillin.
  • Non-replicating persistence of in vitro grown M. tuberculosis was achieved by adding daily 50 ⁇ of the nitric oxide-donating compound 2,2'-(Hydroxynitrosohydrazono)bis-ethanimine (DETA- NO) (Sigma) using the method of ((Bryk, 2008 #36). At day 0, 1, 3 and 7 bacterial counts were determined for these cultures and at day 7, RNA was extracted from both cultures for real-time (RT) PCR analysis. Protein antigens and DNA vaccines
  • CFP Culture Filtrate protein
  • ConA Concavalin A
  • the RAW264.7 mouse macrophage cell line was grown in RPMI (Gibco-BRL) supplemented with 10 % fetal calf serum (FCS; Gibco-BRL) and 2 mM L-glutaminc (Invitrogen) (Complete RPMI), at 37 °C in 5% C0 2 .
  • Adhered RAW264.7 cells were infected with M. tuberculosis at a multiplicity of infection of 1 :1.
  • macrophage monolayers were washed with phosphate buffered saline (PBS), cells were incubated for an additional 48 hours in fresh medium and total RNA was extracted for RT PCR analysis.
  • PBS phosphate buffered saline
  • Quantitive RT-PCR was performed using 4 ⁇ , of cDNA, SYBR green I PCR Master Mix (Qiagen) and 5 ⁇ of the gene- specific primer pair (supplementary table 1) in a. reaction volume of 25 ⁇ ,. PGR reactions were run on a Rotogene 6000-series sequence detector (Corbett research) in triplicate per primer pair. Relative expression levels were determined using the comparative threshold cycle method of Livak and Schmittgen ((Livak, 2001 #99) using the non-induced M. tuberculosis 16S rRNA (encoded by rrs) as the control ((Banaiee, 2006 #101).
  • PBMCs peripheral blood mononuclear cells
  • T cell proliferation assay PBMCs from whole blood were isolated on a Ficoll gradient (Histopaque- 1077, Sigma Aldrich). 2.5 xlO 5 cells/well of PBMCs were incubated at 37 °C in 5 % C0 2 for 5 days in the presence of 10 ⁇ g/mL of the SAP proteins, 10 xglmL of CFP, Ag-85B or 3 ⁇ g mL of ConA. T cell proliferation was assayed by 3 H-thymidine incorporation (MP Biomedicals, 1 ⁇ ) at day 5 using liquid scintillation spectroscopy (Microbeta Luminescence Counter, Wallace).
  • the lymphocyte stimulation index was calculated using the following formula: average counts per minute (cpm) in the presence of antigen/average cpm in the absence of antigen. A SI of greater than or equal to 3 was considered a positive response to mtigcn.Murine studies
  • mice Six- to eight-week-old female C57BL/6 mice were obtained from Animal Resources Centre (Perth, Australia) and maintained in specific pathogen-free conditions. For determination of immunogenicity, mice (4/group) were infected via the intra-nasal (i.n) route with 5 x 10 4 colony forming units (CFU) of M. tuberculosis Mtl03.
  • i.n intra-nasal
  • CFU colony forming units
  • mice Three and 8 weeks post-infection single cell suspensions were prepared from the mediastinal lymph node (MLN) of immunized mice in complete RPMI medium and the number of interferon (IFN)-Y-producing cells was determined by ELISpot as described previously ((Palendira, 2002 #210) using SAP enzymes, CFP and Ag85B at a concentration of 10 ⁇ with ConA used at 3 ⁇ g ml.
  • mice (5/group) were immunised subcutaneously (s.c) once with either 5xl0 5 CFU of M.
  • mice were challenged with aerosol M. tuberculosis Mtl03 using an inhalation exposure apparatus (Glas-Col) with an infective dose of D 100 viable bacilli per lung.
  • Bacterial load was determined 4 weeks after challenge by plating homogenates of lung and spleen.
  • M. tuberculosis ATP sulfurylase mRNA in the intracellular environment correlates with potent antigen-specific immunity.
  • the sulphate activating complex (SAC) of M. tuberculosis is the first step in the SAP (Supplementary figure 1) and constitutes 3 catalytic activities, ATP sulfurylase, GTPase and APS kinase activity encoded by the CysDNC operon (Fig. 1A).
  • SAC sulphate activating complex
  • Fig. 1A The ability of M. tuberculosis SAC to up-regulate its expression in culture conditions that mimic intracellular stress ((Pinto, 2004 #14), suggests that its expression may also be induced in the intracellular environment.
  • CysDNC mRNA levels within RAW264.7 cells during M. tuberculosis infection we examined the changes in CysDNC mRNA levels within RAW264.7 cells during M. tuberculosis infection.
  • mice were immunised with DNA vectors expressing cysD and/or cysNC and aerosol challenged with M. tuberculosis.
  • tuberculosis genome (Cole, 1998 #225) while CysKl and CysE lie adjacent in the genome ((Cole, 1998 #225;Schnell, 2007 #87).
  • CysKl and CysE lie adjacent in the genome ((Cole, 1998 #225;Schnell, 2007 #87).
  • Fig 4B lymphocyte proliferation assays on human PBMCs revealed that all SAP enzymes studied were recognized during human M. tuberculosis infection (Fig 4C).
  • Boosting BCG vaccinated mice with ATP sulfurylase improves protection afforded by BCG in the lung against challenge with M. tuberculosis.
  • CysDNC is able to improve the protective effect of the BCG against M. tuberculosis infection, which was most apparent in the lung.
  • SAC sulphate activation complex
  • CysDNC tuberculosis to the host cell environment, due to up-regulation of CysDNC within macrophages (Fig I B) ((Schnappinger, 2003 #31), and in response to a number of in vitro stress conditions including nutrient starvation and oxidative stress ((Hatzios, 201 1 #167;Pinto, 2004 #14). Therefore it is possible that strong recognition of CysDNC by both TB patients (Fig 2C) and M tuberculosis-infected mice (Fig 2A&B) may be due to the enhanced expression of CysDNC within the host. Intriguingly, CysDNC also displayed significant up-regulation in a model of non-replicating growth of M. tuberculosis (Fig ID).
  • Cysteine is incorporated into Acetyl CoA, the building block for lipids in the organism's cell wall and a substrate for the glyoxylate shunt, a pathway required for M. tuberculosis to persist in macrophages and in mice ((Mc inney, 2000 #211). Further, CysDNC is up-regulated during low-oxygen dormancy ((Voskuil, 2004 #35) and plays a role in the suppression of apoptosis by macrophages ((Danelishvili, 2010 #1 16), implying a role for CysDNC in evasion of the host immune response.
  • cysD was found to be up-regulated after exposure to anti-TB drugs that are bactericidal to non-replicating bacteria ((Fu, 2009 #1 17;Heifets, 2005 #120;Tasneen, 2008 # 121).
  • CysDNC Enhanced recognition of mycobacterial antigens by the host immune response does not always correlate protection against challenge with virulent M. tuberculosis in animal models ((Gartner, 2007 #215;Kamath, 1999 #143; Skinner, 2003 #1 15). We therefore assessed if CysDNC was protective in our low-dose murine model of aerosol M. tuberculosis infection. When delivered as DNA vaccines, CysD and CysN ' C were protective as single components in both the lung and spleen, and a combination of the two constructs achieved a level of protection similar to that induced by BCG (Fig 3). Thus the strong expression of genes encoding CysDNC correlates with the protective effect of the antigenic complex in the models used here.
  • SAP antigens are proposed to be intracellular or membrane-associated proteins due to their function in sulfur metabolism ((de Souza, 2011 #206), and we have confirmed this for some of the members by Western blot (not shown).
  • all M. tuberculosis antigens in clinical trials are secreted proteins, as these are predicted to be the early targets of host immunity ((Kaufmann, 201 1 #196). This study suggests that non-secreted proteins may also be suitable components of new TB vaccine formations.
  • stress-induced, latency-associated antigens improving protection at late-stages post M. tuberculosis infection (Aagaard, 2011 #213) warrants further testing of CysDNC in similar models, considering the marked induction of the protein complex in non-replicating bacteria and in response to in vitro stress.
  • the preferred niche within the host of virulent mycobacteria and the attenuated BCG vaccine strain is ⁇ the intracellular environment of the macrophage. It has been observed that mycobacteria also have the ability to infect and persist within DCs and stimulate in vivo T cell responses [8,9].
  • HspX or a-crystallin protein
  • HspX is a member of the small molecular weight heat-shock proteins that act as ATP-independent chaperones [10,1 1].
  • the hspX promoter is rapidly induced upon entry of M. tuberculosis into cultured macrophages [12].
  • the gene is also up-regulated in vitro by hypoxia [12], during stationary phase of growth of aerated M. tuberculosis cultures [11] and by addition of NO donors [13], which may all represent conditions encountered by M. tuberculosis within host cells.
  • the hspX gene is up-regulated after infection of mice with virulent M tuberculosis [14].
  • hspX promoter can be used to modulate expression of antigens expressed by rBCG, and antigen expression is rapidly induced upon entry of rBCG within DCs.
  • Use of the hspX promoter to control antigen expression resulted in accelerated priming of antigen-specific T cells and sustained in vivo generation of antigen-reactive T cells after vaccination.
  • M. tuberculosis H37Rv (ATC27294) and M. bovis BCG (Pasteur strain) were grown on Middlebrook 7H9 medium (Difco, BD) supplemented with 0.5% glycerol, 0.05% Tween-80 and 10% ADC or on solid Middlebrook 7H1 1 medium (Difco, BD) supplemented with OADC.
  • the antibiotic kanamycin (Km) was added at a concentration of 20 ⁇ g/ml.
  • mice Six to eight weeks old C57BL/6 mice were obtained from Animal Resources Centre (Perth, WA, Australia) and maintained in specific pathogen-free conditions.
  • the p25 CD4 + TCR transgenic (specific for residues 240-254 of Ag85B) were obtained from Prof. K. Takatsu (University of Tokyo, Japan) and Prof. J. Ernst (New York University School of Medicine, NY) [15] and were backcrossed onto B6.SJL/Ptprca to obtain the p25 + CD45.1 + line. Animal experiments were performed with approval of the University of Sydney Animal Care and Ethics Committee.
  • the ⁇ ⁇ ⁇ 3 ⁇ 4 ⁇ fragment was excised by digestion with Xbal and Hpal and ligated to the shuttle-vector pMV26I [16] digested with the same enzymes.
  • the resultant plasmid was transformed into BCG to produce BCG:P/, i7 , -85B.
  • Control BCG used in this study was either BCG Pasteur strain or BCG Pasteur transformed with pMV261 [16]. Construction of rBCG over-expressing the M. tuberculosis Ag85B protein under the control of the hsp60 promoter (BCG: f e P ( 5 5B) has been described previously [17].
  • DCs were prepared form the bone marrow of mice as described previously [18].
  • For DC infection 4- day old DC cultures were incubated with rBCG strains at a multiplicity of infection of 5: 1 or 1 : 1. After 4 h, extracellular bacteria were removed by extensive washing and at 6 and 24 h post-infection, DCs were lysed and bacteria collected for flow cytometry (LSR-II, Becton Dickinson, San Jose, CA, USA). The fold increase in fluorescence was determined by dividing the fluorescence of bacteria populations at 6 and 24 h by the initial value (day 0).
  • CD4 T cells were purified from p25 + CD45.1 + mice by autoMACS separation (Miltenyi Biotec, Bergisch Gladbach, Germany) and 5x 105 purified T cells cultured with infected DCs. Three days following co-incubation, supernatant were assayed for IFN- ⁇ by ELISA as described previously [19] and T cell proliferation was measured by [3H]-thymidine uptake.
  • C57BL/6 mice were inoculated with 1 *107 CPUs of fluorescent rBCG strains subcutaneously in the footpads. Tissue of the local inflammatory site was obtained immediately after infection or at days 1, 3 or 7 post-infection. Tissues were digested with collagenase and DNAse for at least 1 h and then strained to recover cells. Cells were stained with CD45-APCCy7, CD1 lb-APC and GDI Ic-PE-Cy7 (BD Pharmingen). Stained cells were analysed using the LSR-II flow cytometer (BD).
  • BD LSR-II flow cytometer
  • lymph node cells from p25 + CD45.1 + mice were prepared and labelled with Carboxyfl uorescein succinimidyl ester (CFSE; Molecular Probes, Invitrogen, USA).
  • C57BL/6 mice received 5x 105 CFSE-labelled p25 lymph node cells i.v. and the next day were immunized subcutaneously with 5 ⁇ 105 CPU rBCG strains.
  • postvaccination organs were processed and the CFSE profile of dividing cells analysed.
  • rBCG immunogenicity For determination of rBCG immunogenicity, C57BL/6 mice were subcutaneously vaccinated with 5x 105 CFUs of rBCG strains. At 3 and 12 weeks post- vaccination, splenocytes were recovered and 2x105 splenocytes were cultured with p25 peptide (3 ⁇ ⁇ ) at 37°C in 5% C0 2 . Eighteen hours following co-incubation, the number of IFN- ⁇ secreting cells was determined by ELIspot as described previously [19] and at 72 h following the antigen challenge, T cell proliferation was assessed by [3H]- thymidine uptake.
  • C57BL/6 mice (5 per group) were immunised with 5 105 CFU of BCG strains and at 12 weeks post-vaccination mice were challenged with aerosol M. tuberculosis H37Rv using a Middlebrook airborne infection apparatus (Glas-Col, Terre Haute, IN, USA) with an infective dose of approximately 100 viable bacilli per lung.
  • Middlebrook airborne infection apparatus Gibs-Col, Terre Haute, IN, USA
  • BCG strains in which the M. tuberculosis hspX promoter (P hsp x) controlled gene expression.
  • BCG:P/,jp.rGFP in which gfp ' was expressed using hsP x, displayed marked up-regulation of GFP fluorescence only when grown in non-aerated cultures, confirming up-regulation of the hspX promoter under low oxygen tension (Fig. 7A).
  • mice were vaccinated with BCG:P/din py y jFP and the presence of GFP + host cells determined.
  • GFP ! cells were detected as early as 1 day post-vaccination, and were prominent at days 3 and 7 post-vaccination (Fig. 8A). The proportion of GFP + cells peaked at day 3 post-vaccination, however there were no significant differences between the three timepoints examined (Fig. 8B).
  • the hspX promoter could be used to modulate immunity to defined antigens, we expressed the gene encoding the immunodominant M. tuberculosis Ag85B antigen under the control of this promoter. Although a homologue of this protein is expressed by BCG, improved anti-Ag85B immunity is conferred on BCG by constitutive over-expression of the antigen [17].
  • the BCG:P ⁇ r85B strain displayed up-regulation of Ag85B expression in cultures grown under conditions of limited aeration (data not shown).
  • hspX promoter can be used to drive foreign antigen expression in BCG, and induction within DCs results in improved T cell proliferation in vitro.
  • BCG:PfcpA ⁇ 5B vaccination had induced p25 T cells to proliferate, with most divided cells displaying an CFSE intermediate or low profile, while vaccination with BCG alone or BCG:?hsp60- 85B did not result in appreciable proliferation (Fig. 1 1A and B).
  • all BCG strains induced proliferation of the majority of transferred p25 T cells as determined by the CSFE profile of p25 CD4 + T cells (Fig. 1 1A) with approximately 90% of p25 CD4 T cells displaying a CSFE low profde after vaccination with BCG, BCG:P3 ⁇ 4sp ⁇ i0-85B or BCG:P fe/)A -85B (Fig.
  • Ag85B is an immunodominant antigen of M. tuberculosis
  • rBCG expressing Ag85B under control of the hspX promoter can improve the protective effect of BCG against M tuberculosis infection. Twelve weeks post-vaccination, mice were challenged with low dose M tuberculosis strain H37Rv via the aerosol route. The bacterial load in both the lungs (Fig. 12C) and the spleen (Fig. 12D) at 4 weeks post M. tuberculosis infection were significantly reduced in all mice vaccinated with BCG strains compared to unvaccinated mice.
  • the BCG vaccine displays variable protective efficacy against tuberculosis, however the vaccine can be engineered to express foreign molecules in a functional form, and this has driven the development of BCG as a recombinant vector to protect against infectious diseases and malignancies such as cancer [20].
  • Critical to the success of such approaches is the ability to modulate BCG-induced immunity to generate the desired immune response.
  • the M. tuberculosis hspX promoter can be used to modulate expression of recombinant antigens produced in BCG.
  • the hspX promoter is rapidly induced in vitro within DCs (Fig.
  • tuberculosis infection of mice with hspX mRNA detected only at approximately 15 days post-infection and most prevalent at later stages [14]. This suggests that in vivo hspX accumulation in M. tuberculosis may be a slow process, or could also relate to the delivery of a high rBCG dose used in the current study and the sensitive GFP reporting system facilitating the detection of hspX promoter activity.
  • BCG:P 3 ⁇ 4 ⁇ v-85B should be assessed in other pre-elinical models of tuberculosis where Ag85B expression doe impart some level of improved protective efficacy when expressed in rBCG [25].
  • MPL/DDA adjuvant
  • lOmg Ag85B-CysD fusion protein
  • Ag85B Ag85B
  • Senaratne. R.H., et al., 5 '-A denosinephosphosulphate reductase (Cysli) protects Mycobacterium tuberculosis against free radicals during chronic infection phase in mice. Mol Microbiol, 2006. 59(6): p. 1744-53.
  • Garbe TR Hibler NS, Deretic V. Response to reactive nitrogen intermediates in Mycobacterium tuberculosis: induction of the 16-kilodalton alpha-crystallin homolog by exposure to nitric oxide donors. Infect Immun 1999;67(l):460-5.
  • Triccas JA Recombinant BCG as a vaccine vehicle to protect against tuberculosis. Bioeng Bugs 2001 ;l(2): l-6.
  • Forward primer Reverse primer cysD was cut out of a pET22b (Novagen) vector using BamHl and Xhol restriction enzymes and
  • DNA-cysH 5'-acg aaa get tat gag egg cga gac a-3' 5'-ggc ggg ate ccg agg cgt gca acc c-3'
  • DNA-s r/f 5'-tag gaa get tat gtc cgc gaa gga g-3' 5'- teg egg tac etc gca ggt cgt cct c-3' D
  • A-cysKl 5'- ggc gaa get tat gag cat cgc cga g-3' 5'- gca tgg ate cgt cag cca cgt egg c-3'
  • SEQ ID No: 8 (Ag85BCysD amino acid sequence)
  • VQFQSGGN SPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPA

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pulmonology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Immunology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/AU2012/001569 2011-12-22 2012-12-20 Prevention and treatment of mycobacterium infection Ceased WO2013091004A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CN201280070011.6A CN104271744B (zh) 2011-12-22 2012-12-20 分枝杆菌感染的预防和治疗
AU2012357637A AU2012357637B9 (en) 2011-12-22 2012-12-20 Prevention and treatment of Mycobacterium infection
US14/367,854 US9610337B2 (en) 2011-12-22 2012-12-20 Prevention and treatment of mycobacterium infection
ES12859440.5T ES2655190T3 (es) 2011-12-22 2012-12-20 Prevención y tratamiento de la infección por Mycobacterium
EP12859440.5A EP2794885B1 (en) 2011-12-22 2012-12-20 Prevention and treatment of mycobacterium infection
IN5865DEN2014 IN2014DN05865A (https=) 2011-12-22 2012-12-20
US15/445,697 US9931391B2 (en) 2011-12-22 2017-02-28 Prevention and treatment of mycobacterium infection

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161579166P 2011-12-22 2011-12-22
US61/579,166 2011-12-22

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/367,854 A-371-Of-International US9610337B2 (en) 2011-12-22 2012-12-20 Prevention and treatment of mycobacterium infection
US15/445,697 Continuation US9931391B2 (en) 2011-12-22 2017-02-28 Prevention and treatment of mycobacterium infection

Publications (1)

Publication Number Publication Date
WO2013091004A1 true WO2013091004A1 (en) 2013-06-27

Family

ID=48667508

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/AU2012/001569 Ceased WO2013091004A1 (en) 2011-12-22 2012-12-20 Prevention and treatment of mycobacterium infection

Country Status (7)

Country Link
US (2) US9610337B2 (https=)
EP (1) EP2794885B1 (https=)
CN (1) CN104271744B (https=)
AU (1) AU2012357637B9 (https=)
ES (1) ES2655190T3 (https=)
IN (1) IN2014DN05865A (https=)
WO (1) WO2013091004A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021243417A1 (en) * 2020-06-05 2021-12-09 Centenary Institute Of Cancer Medicine And Cell Biology Immunogenic formulations

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105567660B (zh) * 2016-01-08 2018-11-20 中国人民解放军第四军医大学 一种大肠杆菌重组表达结核分枝杆菌Rv2837c活性蛋白的方法及其应用
EP3743103A4 (en) * 2018-01-26 2021-03-17 The Regents of The University of California INTRANASAL ADMINISTRATION OF CYCLIC DI-NUCLEOTIDE ADJUVED VACCINE FOR TUBERCULOSIS
CA3098015A1 (en) * 2018-04-26 2019-10-31 Children's National Medical Center Mycobacterial antigen compositions and methods of use
EP3797791A1 (en) * 2019-09-26 2021-03-31 Universidad De Zaragoza Therapeutic efficacy by pulmonary delivery of live attenuated mycobacteria

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002086067A2 (en) * 2001-04-20 2002-10-31 The Regents Of The University Of California Mycobacterial sulfation pathway proteins and methods of use thereof

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NZ309945A (en) * 1995-05-23 2001-04-27 Univ California Abundant extracellular products and their use as vaccines
WO2002004018A2 (en) * 2000-07-10 2002-01-17 Colorado State University Research Foundation Mid-life vaccine and methods for boosting anti-mycobacterial immunity
US7074559B2 (en) * 2002-03-06 2006-07-11 Refents of the University of Minnesota Mycobacterial diagnostics
US20100015171A1 (en) * 2008-07-15 2010-01-21 Statens Serum Institute Vaccines comprising tb 10.4
EP2355798A1 (en) * 2008-11-12 2011-08-17 Statens Serum Institut Modified cationic liposome adjuvans

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002086067A2 (en) * 2001-04-20 2002-10-31 The Regents Of The University Of California Mycobacterial sulfation pathway proteins and methods of use thereof

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
CAO ET AL., VACCINE, vol. 10, 1992, pages 238
GENNARO: "Remington: The Science and Practice of Pharmacy. 20th ed.", 2000
HARBOE, M. ET AL., INFECT. IMMUN, vol. 66, no. 2, 1998, pages 717 - 723
KATZ ET AL., VACCINE, vol. 18, 2000, pages 2177
KREUTER ET AL., J. PHARM. SCL, vol. 70, 1981, pages 367
MBWUIKE ET AL., VACCINE, vol. 8, 1990, pages 347
PINTO, R. ET AL.: "Host-cell-induced components of the sulfate assimilation pathway are major protective antigens of Mycobacterium tuberculosis", THE JOURNAL OF INFECTIOUS DISEASES, vol. 207, 7 December 2012 (2012-12-07), pages 778 - 785, XP055157052 *
PINTO, R. ET AL.: "The Mycobacterium tuberculosis cysD and cysNC genes form a stress- induced operon that encodes a tri-functional sulfate-activating complex", MICROBIOLOGY, vol. 150, 2004, pages 1681 - 1686, XP055076829 *
SENARATNE, R. H. ET AL.: "Vaccine efficacy of an attenuated but persistent Mycobacterium tuberculosis cysH mutant", JOURNAL OF MEDICAL MICROBIOLOGY, vol. 56, 2007, pages 454 - 458, XP055076831 *
STRYHN, A. ET AL., EUR. J. IMMUNOT., vol. 26, 1996, pages 1911 - 1918
SUN, M. ET AL.: "The trifunctional sulfate-activating complex (SAC) of Mycobacterium tuberculosis", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 280, no. 9, 2005, pages 7861 - 7866, XP055076830 *
VANN DISSEL, VACCINE, vol. 29, 2011, pages 2100

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021243417A1 (en) * 2020-06-05 2021-12-09 Centenary Institute Of Cancer Medicine And Cell Biology Immunogenic formulations

Also Published As

Publication number Publication date
EP2794885B1 (en) 2017-10-04
AU2012357637B2 (en) 2017-09-21
AU2012357637B9 (en) 2017-10-19
IN2014DN05865A (https=) 2015-05-22
EP2794885A4 (en) 2015-07-22
AU2012357637A1 (en) 2014-07-17
CN104271744B (zh) 2017-06-06
US20170173137A1 (en) 2017-06-22
US9931391B2 (en) 2018-04-03
CN104271744A (zh) 2015-01-07
US9610337B2 (en) 2017-04-04
EP2794885A1 (en) 2014-10-29
ES2655190T3 (es) 2018-02-19
US20160022795A1 (en) 2016-01-28

Similar Documents

Publication Publication Date Title
US8124068B2 (en) Recombinant intracellular pathogen immunogenic compositions and methods of use
EP2421557B1 (en) A tuberculosis tb vaccine to prevent reactivation
Singh et al. A century of BCG vaccination: Immune mechanisms, animal models, non-traditional routes and implications for COVID-19
EP2163255B1 (en) Tuberculosis vaccines comprising antigens expressed during the latent infection phase
JP5713523B2 (ja) エンドソームエスケープ能力増強組み換えbcg株類
US9931391B2 (en) Prevention and treatment of mycobacterium infection
US10010595B2 (en) Live recombinant booster vaccine against tuberculosis
JP2016513078A (ja) 一段階または多段階のトリ型結核菌亜種副結核症サブユニット・ワクチン
US6776993B2 (en) Tuberculosis vaccine
Brun et al. Intranasal delivery of DNA encoding antigens of Mycobacterium tuberculosis by non-pathogenic invasive Escherichia coli
Kondratieva et al. Mycobacterium tuberculosis attenuated by multiple deletions of rpf genes effectively protects mice against TB infection
Romano et al. A Structural View at Vaccine Development Against M. tuberculosis. Cells 2023, 12, 317
CN102782138A (zh) 包含热敏性转基因的疫苗
Yin et al. Attenuated Listeria monocytogenes, a Mycobacterium tuberculosis ESAT-6 antigen expression and delivery vector for inducing an immune response
Nisa Novel subunit and live vaccine strategies to protect against tuberculosis
AU2011203012A1 (en) Tuberculosis vaccines comprising antigens expressed during the latent infection phase
Ko et al. A vaccine targeting lung resident-memory CD4 T cell phenotype protects against
Kamanová Bordetella Adenylate Cyclase: Molecular Mechanism of Action and Its Use for Antigen Delivery

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12859440

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14367854

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2012859440

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012859440

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2012357637

Country of ref document: AU

Date of ref document: 20121220

Kind code of ref document: A