WO2013064701A2 - Bispecific antibodies and methods for isolating same - Google Patents

Bispecific antibodies and methods for isolating same Download PDF

Info

Publication number
WO2013064701A2
WO2013064701A2 PCT/EP2012/071866 EP2012071866W WO2013064701A2 WO 2013064701 A2 WO2013064701 A2 WO 2013064701A2 EP 2012071866 W EP2012071866 W EP 2012071866W WO 2013064701 A2 WO2013064701 A2 WO 2013064701A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antigen
binding
human
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/071866
Other languages
English (en)
French (fr)
Other versions
WO2013064701A3 (en
Inventor
Anna Hultberg
Johannes De Haard
Natalie De Jonge
Christophe Blanchetot
Mohammed EL KHATTABI
Ava SADI
Cornelis Theodorus Verrips
Michael Saunders
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ArgenX SE
Original Assignee
ArgenX SE
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US13/288,587 external-priority patent/US9688773B2/en
Application filed by ArgenX SE filed Critical ArgenX SE
Publication of WO2013064701A2 publication Critical patent/WO2013064701A2/en
Publication of WO2013064701A3 publication Critical patent/WO2013064701A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4208—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
    • C07K16/4241—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46—Hybrid immunoglobulins
    • C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • B—PERFORMING OPERATIONS; TRANSPORTING
    • B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01D—SEPARATION
    • B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08—Selective adsorption, e.g. chromatography
    • B01D15/10—Selective adsorption, e.g. chromatography characterised by constructional or operational features
    • B01D15/18—Selective adsorption, e.g. chromatography characterised by constructional or operational features relating to flow patterns
    • B01D15/1864—Selective adsorption, e.g. chromatography characterised by constructional or operational features relating to flow patterns using two or more columns
    • B—PERFORMING OPERATIONS; TRANSPORTING
    • B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01D—SEPARATION
    • B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08—Selective adsorption, e.g. chromatography
    • B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/38—Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 and B01D15/30 - B01D15/36, e.g. affinity, ligand exchange or chiral chromatography
    • B01D15/3804—Affinity chromatography
    • B01D15/3809—Affinity chromatography of the antigen-antibody type, e.g. protein A, G or L chromatography
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4208—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4208—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
    • C07K16/4241—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
    • C07K16/4258—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig against anti-receptor Ig
    • C07K16/4266—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig against anti-receptor Ig against anti-tumor receptor Ig
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034—Isolating an individual clone by screening libraries
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034—Isolating an individual clone by screening libraries
    • C12N15/1055—Protein x Protein interaction, e.g. two hybrid selection
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854—Immunoglobulins
    • G01N33/686—Anti-idiotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity

Definitions

  • the present invention relates to multispecific, e.g., bispecific antibodies and methods for the purification or isolation of said antibodies.
  • the invention relates to the use of anti-idiotypic antibodies for purification of homogenous preparations of bispecific antibodies.
  • the invention relates to
  • multispecific antibodies wherein at least one of the domains is camelid-derived.
  • the multispecific antibodies of the inventions are capable of targeting two distinct, non- overlapping epitopes on the same antigen or different antigens.
  • Bispecific antibodies are of great interest due their ability to bind to multiple antigens.
  • the issue of mispairings in both heavy and light chains observed during the production of bispecific antibodies has often been described.
  • up to 10 different combinations of heavy chains and light chains can be formed, which affect the yield of the bispecific antibodies and imposes major purification challenges.
  • the art has turned to complex antibody engineering in the Fc or V regions to avoid this problem.
  • Roche US2010/0254989A1
  • Genmab has described a "Duobody” approach, in which the individual antibodies are produced with mutations in the Fc in residues of the human IgG4 responsible for the Fab exchange (Van der Neut at al., Science (2007) 317: 1554).
  • Fresenius uses rat - mouse quadromas for generating bispecific antibodies, where the mouse and the rat antibody predominantly forms the original VH - VL pairings and the bispecific antibody consists of the rat and the mouse Fc (Lindhofer et al., J Immunol. (1995) 155: 1246 -1252).
  • bispecific antibodies that do not contribute in binding, but only stabilize the VH (Merchant et al., Nature Biotechnology (1998) 16: 677 - 681). Notwithstanding these attempts at antibody engineering, bispecific antibodies continue to suffer from poor expression yields and instability. Accordingly, an urgent need exists in the art for bispecific antibodies with improved expressibility and homogeneity, but minimal protein engineering.
  • the present invention improves upon the state of the art by providing bispecific and other multi- specific antibodies with excellent expressability and homogeneity but with minimal protein engineering.
  • the multi- specific antibodies comprise camelid-derived binding sites which confer these properties.
  • the antibodies of the invention are characterized as comprising binding sites comprising light chains which contribute to the antigen binding properties of the binding site.
  • the invention also provides improved methods for purifying homogenous preparations of bispecific antibodies.
  • the invention provides a method for isolating a multi- specific antibody or fragment thereof from a mixture, said antibody or fragment comprising at least a first and a second antigen-binding region with different antigen binding
  • each antigen-binding region comprising a heavy chain variable domain (VH) paired with a light chain variable domain (VL), wherein the first antigen binding region forms a first idiotypic binding site specifically recognized by a first anti-idiotype binding agent and wherein the second antigen binding region forms a second idiotypic binding specifically recognized by a second anti-idiotype binding agent, said method comprising:
  • the second mixture to the second anti-idiotype binding agent, thereby separating the multi- specific antibody or fragment from the mixture to obtain the isolated multi- specific antibody or fragment thereof.
  • at least one of the VL domains contributes to the antigen binding/antigen recognition by the respective antigen-binding region of the multi- specific antibody.
  • the paired VH and VL domains of each of the antigen- binding regions each contribute to the antigen binding/antigen recognition by the respective antigen-binding region.
  • step (a) is conducted by applying the mixture to the first anti-idiotype binding agent that is fixed to a solid support and eluting with an elution buffer to obtain the second mixture.
  • step (b) is conducted by applying the mixture to the second anti-idiotype binding agent that is fixed to a solid support and eluting with an elution buffer to obtain the isolated multi- specific antibody or fragment thereof.
  • one or both of the anti-idiotypic binding agents is an anti- idiotypic antibody.
  • the first anti-idiotype binding agent is a first anti-idiotype antibody obtained from an antibody of a species of Camelidae by active immunization of the Camelidae species with a polypeptide comprising first idiotypic binding site.
  • the polypeptide comprising first idiotypic binding site comprises the first antigen binding region of the multispecific antibody or fragment.
  • the second anti-idiotype binding agent is a second antiidiotype antibody obtained from an antibody of a species of Camelidae by active immunization of the Camelidae species with a polypeptide comprising the second idiotypic binding site.
  • the polypeptide comprising the second idiotypic binding site comprises the second antigen binding region of the multispecific antibody or fragment.
  • the mispaired antibody comprises a VH or VL domain from the first antigen binding region of the multispecific antibody that is mispaired with a VL or VH from the second antigen binding region of the multi- specific antibody. In other embodiments, the mispaired antibody comprises a VH or VL domain from the first antigen binding region of the multispecific antibody that is mispaired with a VH or VL from a third antigen binding region having a third binding specificity.
  • one or both anti-idiotype antibodies are conventional antibodies of the Camelidae species.
  • one or both anti-idiotype antibodies are VHH antibodies of the Camelidae species.
  • the Camelidae species is a Lama species.
  • one or both of the VH and VL domains of the first cell are identical to the VH and VL domains of the first cell.
  • multispecific antibody or fragment are camelid-derived.
  • the VH domains of the multispecific antibody or fragment are each fused to one or more heavy chain constant domains derived from human IgG antibodies.
  • At least one hypervariable loop in one or both VH domain and VL domains of at least one of the antigen binding regions of the multispecific antibody or fragment are obtained from a conventional antibody of a Lama species by active immunization of the Lama species with target antigens.
  • hypervariable loop H3 or hypervariable loop L3 or both hypervariable loops H3 and L3 of at least one of the antigen binding sites of the multispecific antibody or fragment is obtained from a conventional antibody.
  • one or both VH and VL domains of at least one of the antigen binding sites of the multi- specific antibody or fragment exhibits a sequence identity of 90%, 95%, 97% or greater with one or more human VH or VL domains across framework regions FR1, FR2, FR3 and FR4.
  • one or both VH and VL domains of at least one of the antigen binding sites of the multi- specific antibody or fragment comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 substitutions across framework regions FR1, FR2, FR3 and FR4, as compared to the corresponding VH and VL domains of a conventional camelid antibody.
  • one or both VH and VL domains of at least one of the antigen binding sites of the multi- specific antibody or fragment comprises hypervariable loops from a conventional antibody, wherein at least one of hypervariable loops HI, H2, LI, L2 or L3 exhibits a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
  • one or both VH and VL domains of at least one of the antigen binding sites of the multi- specific antibody or fragment are human germlined variants of llama VH and VL domains.
  • At least two antigen-binding regions of the multi-specific antibody or fragment exhibit binding specificity for distinct antigen epitopes on different target antigens.
  • the at least two antigen-binding regions of the multi- specific antibody or fragment exhibit binding specificity for distinct antigen epitopes present on a single target antigens.
  • the at least two antigen -binding regions of the multi- specific antibody or fragment are capable of binding their respective antigen epitopes simultaneously.
  • the target antigens are human target antigens.
  • At least one of the human target antigens is a human c- MET antigen.
  • the first antigen binding site specifically binds a SEMA domain sequence of the human c-MET antigen and wherein the second antigen binding site specifically binds an IPT domain sequence of the human c-MET antigen.
  • the first antigen binding site specifically binds the human c-MET antigen and wherein the second antigen binding site specifically binds a different human antigen.
  • the different human antigen is a human cytokine.
  • the first and second antigen-binding regions of the multi- specific antibody or fragment are provided by first and second antibody Fab regions.
  • first and second antigen-binding regions of the multi-specific antibody or fragment are provided by first and second single chain antibody (scFv) sequences.
  • each of the antigen-binding regions of the multi- specific antibody or fragment exhibits a dissociation off-rate for target antigen of lQ ' V 1 or less.
  • all of the VH and VL domains of the multi- specific antibody or fragment are camelid-derived.
  • the invention is directed to an isolated multi- specific antibody or fragment thereof, said antibody or fragment comprising at least a first and a second antigen -binding region with different antigen binding specificities, each antigen-binding region comprising a heavy chain variable domain (VH) paired with a light chain variable domain (VL), wherein the VL domain of the first antigen binding region is a VK domain, and the VL domain of the second antigen binding region is a ⁇ domain, and wherein at least one of the VL and VH domains is camelid-derived.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • the VL domain of the first antigen binding region is a VK domain
  • VL domain of the second antigen binding region is a ⁇ domain
  • at least one of the VL and VH domains is camelid-derived.
  • at least one of the VL domains contributes to the antigen binding/antigen recognition by the respective antigen-binding region.
  • the VK domain is fused to a first purification tag
  • the ⁇ domain of the second antigen binding region is fused to a second purification tag, the first and second purification tags comprising different antigenic sequences.
  • the first purification tag forms a binding site specifically recognized by a first binding agent and the second purification tag forms a second binding site specifically recognized by a second binding agent.
  • the first and second binding agents are independently selected from the group consisting of an antibody, an antibody fragment, a sdAb, an aptamer, or an alternative protein scaffold.
  • the first purification tag is a first light chain constant domain (CL1) and the second purification tag is a second light chain constant domain (CL2).
  • the CL1 and CL2 domains are derived from human IgG antibodies.
  • the CL1 domain is a CK domain and the CL2 domain is a ⁇ domain.
  • the first binding agent is an anti-CK antibody and the second binding agent is an anti-C antibody.
  • the paired VH and VL domains of each of the antigen- binding regions each contribute to the antigen binding/antigen recognition by the respective antigen-binding region.
  • the first antigen binding region forms a first idiotypic binding site specifically recognized by a first anti-idiotype antibody and wherein the second antigen binding region forms a second idiotypic binding specifically recognized by a second anti-idiotype antibody.
  • the VH domains are each fused to one or more heavy chain constant domains derived from human IgG antibodies.
  • At least one hypervariable loop in one or both VH domain and VL domains of at least one of the antigen binding regions are obtained from a
  • hypervariable loop H3 or hypervariable loop L3 or both hypervariable loops H3 and L3 of at least one of the antigen binding sites is obtained from a conventional antibody.
  • one or both VH and VL domains of at least one of the antigen binding sites exhibits a sequence identity of 90%, 95%, 97% or greater with one or more human VH or VL domains across framework regions FR1, FR2, FR3 and FR4.
  • one or both VH and VL domains of at least one of the antigen binding sites comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 substitutions across framework regions FR1, FR2, FR3 and FR4 as compared to the corresponding VH and VL domains of a conventional camelid antibody.
  • one or both VH and VL domains of at least one of the antigen binding sites comprises hypervariable loops from a conventional antibody, wherein at least one of hypervariable loops HI, H2, LI, L2 or L3 exhibits a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
  • one or both VH and VL domains or at least one of the antigen binding sites are human germlined variants of llama VH and VL domains.
  • At least two antigen-binding regions exhibit binding specificity for distinct antigen epitopes on different target antigens. In one embodiment, the at least two antigen-binding regions exhibit binding specificity for distinct antigen epitopes present on a single target antigens. In one embodiment, the at least two antigen- binding regions are capable of binding their respective antigen epitopes simultaneously.
  • the target antigens are human target antigens. In one embodiment, at least one of the human target antigens is a human c-MET antigen. In one embodiment, the first antigen binding site specifically binds a SEMA domain sequence of the human c-MET antigen and wherein the second antigen binding site specifically binds an IPT domain sequence of the human c-MET antigen. In one embodiment, the first antigen binding site specifically binds the human c-MET antigen and wherein the second antigen binding site specifically binds a different human antigen.
  • first and second antigen-binding regions are provided by first and second antibody Fab regions. In one embodiment, the first and second antigen - binding regions are provided by first and second single chain antibody (scFv) sequences.
  • each of the antigen-binding regions exhibits a dissociation off-rate for target antigen of ICTV 1 or less.
  • all of the VH and VL domains are camelid-derived.
  • the multi-specific antibody or fragment is bispecific.
  • Figure 1 illustrates an exemplary method for purifying a desired and properly paired bispecific SIMPLE antibody (circled, BsAb) from a mixture of 10 combinations formed by alternative mispairings of light and heavy chains (Figure 1A).
  • Purification employs a two step process in which the mixture is applied to a first anti-idiotypic antibody (All) specifically recognizing only the properly paired VHl/VLl domains of a first antigen binding site ( Figure IB) to obtain a second mixture of 4 antibodies; followed by application of the second mixture to a second anti-idiotypic antibody (AI2) that specifically recognizes only the properly paired VH2/VL2 domains of the second antigen binding site of the bispecific antibody to obtain the isolated desired BsAb (Figure 1C).
  • a first anti-idiotypic antibody All
  • Figure IB specifically recognizing only the properly paired VHl/VLl domains of a first antigen binding site
  • AI2 second anti-idiotypic antibody
  • Figure 2 illustrates a variant method from Figure 1 for purifying a desired and properly paired bispecific SIMPLE antibody (circled, BsAb) from a mixture of 10 combinations formed by alternative mispairings of light and heavy chains (Figure 2A).
  • Purification employs a two step process in which the mixture is applied first to the second anti- idiotypic antibody (AI2) specifically recognizing only the properly paired VH2/VL2 domains of the second antigen binding site ( Figure 2B) to obtain a second mixture of 4 antibodies; followed by application of the second mixture to the first anti-idiotypic antibody (All) that specifically recognizes only the properly paired VHl/VLl domains of the second antigen binding site of the bispecific antibody to obtain the isolated desired
  • Figure 3 illustrates an exemplary scheme for the creation of camelid-derived anti- idiotypic antibodies employed in the methods of the invention.
  • a first anti-idiotypic antibody is raised by actively immunizing a llama with a llama antibody comprising the first antigen-binding site of a SIMPLE BsAb ( Figure 3A), while the second anti-idiotypic antibody is raise by actively immunizing a llama with a llama antibody comprising the second antigen binding site of the BsbAb ( Figure 3B).
  • Figure 4 illustrates the way in which anti-idiotypic (AI) antibodies of the invention recognize their specific idiotype only when the properly paired VH and VL are present, but not when VH1 is mispaired with VL2 or when VH2 is mispaired with VL1.
  • AI anti-idiotypic
  • Figure 4A corresponds to first anti-idiotype antibody (All) and Figure 4B corresponds to second anti-idiotype antibody (AI2).
  • Figure 5 illustrates selected VHH sequences (SEQ ID NOs 201-244) of an anti-idiotype library against mAb 68F2.
  • Figure 6 illustrates selected VHH sequences (SEQ ID NOs 245-290) of an anti-idiotype library against mAb mAb 61H7.
  • Figure 7 illustrates the sequences (SEQ ID NOs 291-360) of 70 clones from different outputs of the second round selection for anti-idiotypic antibodies.
  • Figure 8 illustrates the sequences of the VHH (SEQ ID NOs 362-409) with high specificity and good binding affinity against mAb 48A2 or mAb 36C4 from an anti- idiotypic.
  • Figure 9 illustrates the sequences of the VHH (SEQ ID NOs 410-455) with high specificity and good binding affinity against mAb 48A2 or mAb 36C4.
  • Figure 10 illustrates the sequences (SEQ ID NOs 456-471) of VHH clones from a second round selection against mAb 36C4.
  • Figure 11 illustrates the sequences (SEQ ID NOs 472-501) of VHH clones from a second round selection against mAb 48A2.
  • Figure 12 illustrates the detection of anti-cytokine binding fractions in the bispecific mAb fraction obtained by two-step VHH purification.
  • Figure 13 illustrates the detection of anti-cMET binding fractions in the bispecific mAb fraction obtained by two-step VHH purification.
  • Figure 14 illustrates the results of applying capturing ELISA on the 68F2/48A2 bispecific mAb to confirm the dual binding function of cytokine and c-MET.
  • Figure 15 illustrates the capturing of cMET chimera LP6 (which contained mAb 36C4 epitope) to immunoplates coated with cMET chimera LS5 (which contained mAb 48A2 epitope) through bispecific 48A2/36C4 mAbs. No binding of the monospecific mAbs, confirmed the presence and functionality of the BsAb.
  • Figure 16 shows a Coomassie stained SDS-Page gel illustrating the successful purification of a desired bispecific anti-cMET antibodies (Bi2 and Bi3) obtained by successive two-step purification on columns with anti-idiotypic VHH antibody fragments. Two light chain bands (equimolar amounts) are visible for Bi2 and Bi3, but only one light chain band is observed for the monospecific bivalent parental antibodies (36C4#9 and 48A2#9).
  • Figure 17 depicts a mass spectrogram illustrating that two preparations of an exemplary cMET BsAbs (48A2/36C4) have mass that is intermediate to those of their parental monospecific cMET antibodies. This data further confirms the purity of the bispecific antibody.
  • Figure 18 demonstrates that an anti-cMet/anti-cytokine bispecific antibody (68F2/48A2) has an intermediate mass when compared to those of the parental antibodies through mass spectrometry. This data further confirms the purity of the bispecific antibody.
  • Figure 19 shows bispecific binding demonstrated in Biacore when binding to two epitopes on the same target (cMET; Figure 19 A) or when binding to two different targets (cMET and a cytokine; Figure 19B).
  • Figure 20 illustrates another method of the invention for purifying theoretical combinations of heavy and light chain pairs produced by hybrid hybridomas (Figure 20A). Desired combinations are obtained by two-step purification on Kappa-Select and Lambda-Select columns ( Figure 20B). The two parental antibodies are shown and blue and yellow while the bispecific antibody with non-promiscuous VL domains is circled.
  • FIG. 21 illustrates the setup of an exemplary ELISA to demonstrate bispecificity.
  • the exemplary bispecific antibody comprises a VH/ ⁇ binding site (e.g., derived from a 36C4 or 20F1 antibody) that specifically recognizes the SEMA domain of cMet and a VH/VK binding site (e.g., derived from 38H10 or 40B8 antibody) that specifically recognizes the IPT domain of c-MET.
  • VH/ ⁇ binding site e.g., derived from a 36C4 or 20F1 antibody
  • VH/VK binding site e.g., derived from 38H10 or 40B8 antibody
  • Figure 22 illustrates SEMA binding of mAb mixtures detected with anti-human Fc antibody.
  • Cultures of HEK cells transfected with mixtures of plasmid encoding HC and LC of 36C4/20F1 and 38H10/40B8 were purified with protein A and tested at two concentrations.
  • Parental mAbs 40B8 and 38H10, both IPT specific, and 36C4 and 20F1, SEMAdomain specific, were included next to the isotype control (U16.1).
  • Figure 23 illustrates SEMA domain binding of bispecific mAbs as detected with anti-CK antibody.
  • FIG. 24 illustrates a CBB stained PAGE of purified bispecific cMet antibodies and enforced wrong combinations of VH and VL. Analysis of flow-through of protein A (coded A) and Kappa-Select (coded K) or Lambda-Select (coded L) or both (coded LK) purified enforced wrong combinations (1 - 4) or bispecifics (5 and 6).
  • CBB gels are shown of reduced samples (panel A) or non-reduced samples (panel B).
  • Sample 1 is VH36C4+VK40B8, sample 2 VH40B8+VL36C4, sample 3 VH36C4+VK38H10, sample 4 VH38H10+VL36C4, sample 5 bispecific VH VL36C4+ VH VK40B 8 and sample 6 bispecific VHVL36C4+VHVK38H10.
  • Figure 25 illustrates SEMA domain binding of all purified combinations as detected with (A) anti-CK and (B) anti-Fc antibodies.
  • Bispecific purified samples from 38H10 and 40B8 gave high binding signals when detected with anti-CK and anti-Fc antibodies.
  • Figure 26 illustrates SEMA domain binding of the samples taken during purifications as detected with (A) anti-CK and (B) anti-Fc antibodies. Enrichment during purification could be observed in ELISA with anti-kappa antibody detection (A), confirming that each step enriched for the bispecific antibodies and removed the parental antibodies. Detection with anti-Fc (B) gave lower signals after purification on kappa beads as compared to lambda beads, suggesting that parental antibodies were removed.
  • Antibody or “Immunoglobulin”- As used herein, the term “immunoglobulin” includes a polypeptide having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity. “Antibodies” refers to such assemblies which have significant known specific immunoreactive activity to an antigen of interest (e.g. a human antigen). As explained elsewhere herein, “specificity” for a particular human antigen does not exclude cross-reaction with species homologues that antigen. Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them. Basic immunoglobulin structures in vertebrate systems are relatively well understood.
  • immunoglobulin comprises five distinct classes of antibody that can be distinguished biochemically. All five classes of antibodies are within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules.
  • immunoglobulins comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000. The four chains are joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y” and continuing through the variable region.
  • the light chains of an antibody are classified as either kappa or lambda ( K, ⁇ ) .
  • Each heavy chain class may be bound with either a kappa or lambda light chain.
  • the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells.
  • the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
  • heavy chains are classified as gamma, mu, alpha, delta, or epsilon, ( ⁇ , ⁇ , , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ - ⁇ 4). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA IgG, or IgE, respectively.
  • the immunoglobulin subclasses e.g., IgGl, IgG2, IgG3, IgG4, IgAl, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention.
  • variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain of an antibody combine to form the variable region that defines a three dimensional antigen binding site.
  • This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three complementary determining regions (CDRs) on each of the VH and VL chains.
  • CDRs complementary determining regions
  • c-Met protein or "c-Met receptor”— As used herein, the terms “c-Met protein” or “c-Met receptor” or “c-Met” are used interchangeably and refer to the receptor tyrosine kinase that, in its wild- type form, binds Hepatocyte Growth Factor (HGF).
  • HGF Hepatocyte Growth Factor
  • human c-Met protein or “human c-Met receptor” or “human c-Met” are used interchangeably to refer to human c-Met, including the native human c-Met protein naturally expressed in the human host and/or on the surface of human cultured cell lines, as well as recombinant forms and fragments thereof and also naturally occurring mutant forms.
  • human c-Met examples include, e.g., the human polypeptide encoded by the nucleotide sequence provided in GenBank accno. NM_000245, or the human protein encoded by the polypeptide sequence provided in GenBank accno. NP_000236, or the extracellular domain of thereof.
  • the single chain precursor c-Met protein is post- translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor.
  • Binding Site comprises a region of a polypeptide which is responsible for selectively binding to a target antigen of interest (e.g. a human antigen). Binding domains comprise at least one binding site. Exemplary binding domains include an antibody variable domain. In certain aspects, the antibody molecules of the invention comprise multiple (e.g., two, three or four) binding sites.
  • the term "derived from” a designated protein refers to the origin of the polypeptide.
  • the polypeptide or amino acid sequence which is derived from a particular starting polypeptide is a CDR sequence or sequence related thereto.
  • the amino acid sequence which is derived from a particular starting polypeptide is not contiguous. For example, in one embodiment, one, two, three, four, five, or six CDRs are derived from a starting antibody.
  • the polypeptide or amino acid sequence which is derived from a particular starting polypeptide or amino acid sequence has an amino acid sequence that is essentially identical to that of the starting sequence, or a portion thereof wherein the portion consists of at least of at least 3-5 amino acids, 5-10 amino acids, at least 10-20 amino acids, at least 20-30 amino acids, or at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
  • the one or more CDR sequences derived from the starting antibody are altered to produce variant CDR sequences, e.g. affinity variants, wherein the variant CDR sequences maintains the antigen binding activity of the starting antibody.
  • the antibody molecules of the invention comprise framework amino acid sequences and/or CDR amino acid sequences derived from a camelid conventional antibody raised by active immunisation of a camelid with a target antigen of interest (e.g., a human target antigen).
  • a target antigen of interest e.g., a human target antigen
  • antibodies comprising camelid-derived amino acid sequences may be engineered to comprise framework and/or constant region sequences derived from a human amino acid sequence or other non-camelid mammalian species.
  • a human or non-human primate framework region, heavy chain portion, and/or hinge portion may be included in the subject antibodies.
  • one or more non-camelid amino acids may be present in the framework region of a "camelid-derived" antibody, e.g., a camelid framework amino acid sequence may comprise one or more amino acid mutations in which the corresponding human or non-human primate amino acid residue is present.
  • camelid-derived VH and VL domains, or humanised variants thereof may be linked to the constant domains of human antibodies to produce a chimeric molecule, as extensively described elsewhere herein.
  • Constant amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e.g.,
  • a nonessential amino acid residue in an immunoglobulin polypeptide may be replaced with another amino acid residue from the same side chain family.
  • a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • Heavy chain portion includes amino acid sequences derived from the constant domains of an immunoglobulin heavy chain.
  • a polypeptide comprising a heavy chain portion comprises at least one of: a CHI domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof.
  • a binding molecule of the invention may comprise the Fc portion of an immunoglobulin heavy chain (e.g., a hinge portion, a CH2 domain, and a CH3 domain).
  • a binding molecule of the invention lacks at least a portion of a constant domain (e.g., all or part of a CH2 domain).
  • at least one, and preferably all, of the constant domains are derived from a human immunoglobulin heavy chain.
  • the heavy chain portion comprises a fully human hinge domain.
  • the heavy chain portion comprising a fully human Fc portion (e.g., hinge, CH2 and CH3 domain sequences from a human immunoglobulin).
  • the constituent constant domains of the heavy chain portion are from different immunoglobulin molecules.
  • a heavy chain portion of a polypeptide may comprise a CH2 domain derived from an IgGl molecule and a hinge region derived from an IgG3 or IgG4 molecule.
  • the constant domains are chimeric domains comprising portions of different immunoglobulin molecules.
  • a hinge may comprise a first portion from an IgGl molecule and a second portion from an IgG3 or IgG4 molecule.
  • the constant domains of the heavy chain portion may be modified such that they vary in amino acid sequence from the naturally occurring (wild-type) immunoglobulin molecule.
  • polypeptides of the invention disclosed herein may comprise alterations or modifications to one or more of the heavy chain constant domains (CHI, hinge, CH2 or CH3) and/or to the light chain constant domain (CL).
  • exemplary modifications include additions, deletions or substitutions of one or more amino acids in one or more domains.
  • chimeric protein comprises a first amino acid sequence linked to a second amino acid sequence with which it is not naturally linked in nature.
  • the amino acid sequences may normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide.
  • a chimeric protein may be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
  • Exemplary chimeric antibodies include fusion proteins comprising camelid-derived VH and/or VL domains, or humanised variants thereof, fused to the constant domains of a human antibody, e.g. human IgGl, IgG2, IgG3 or IgG4.
  • variable region or “variable domain” — The term “variable” refers to the fact that certain portions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops" in each of the VL domain and the VH domain which form part of the antigen binding site.
  • the first, second and third hypervariable loops of the ⁇ light chain domain are referred to herein as hl(X), L2(X) and L3 k) and may be defined as comprising residues 24-33 (hl (X), consisting of 9, 10 or 11 amino acid residues), 49-53 L2(X), consisting of 3 residues) and 90-96 L3(X), consisting of 5 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
  • the first, second and third hypervariable loops of the VK light chain domain are referred to herein as L1(K), L2(K) and L3(K) and may be defined as comprising residues 25-33 (L1 (K), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2(K), consisting of 3 residues) and 90-97 (L3(K), consisting of 6 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
  • the first, second and third hypervariable loops of the VH domain are referred to herein as HI, H2 and H3 and may be defined as comprising residues 25-33 (HI, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the VH domain (Morea et al., Methods 20:267-279 (2000)).
  • LI, L2 and L3 respectively refer to the first, second and third hypervariable loops of a VL domain, and encompass hypervariable loops obtained from both VK and ⁇ isotypes.
  • HI, H2 and H3 respectively refer to the first, second and third hypervariable loops of the VH domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including ⁇ , ⁇ , ⁇ , a or ⁇ .
  • the hypervariable loops LI, L2, L3, HI, H2 and H3 may each comprise part of a "complementarity determining region" or "CDR", as defined below.
  • CDR complementarity determining region
  • hypervariable loop and CDRs are not strictly synonymous, since the hypervariable loops (HVs) are defined on the basis of structure, whereas complementarity determining regions (CDRs) are defined based on sequence variability (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD., 1983) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
  • the CDRs of the VL and VH domains can typically be defined as comprising the following amino acids: residues 24-34 (CDRL1), 50-56 (CDRL2) and 89-97 (CDRL3) in the light chain variable domain, and residues 31-35 or 31-35b (CDRH1), 50-65 (CDRH2) and 95-102 (CDRH3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • the HVs may be comprised within the following amino acids: residues 24-34 (CDRL1), 50-56 (CDRL2) and 89-97 (CDRL3) in the light chain variable domain, and residues 31-35 or 31-35b (CDRH1), 50-65 (CDRH2) and 95-102 (CDRH3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest
  • variable domains The more highly conserved portions of variable domains are called the framework region (FR), as defined below.
  • the variable domains of native heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a ⁇ - sheet configuration, connected by the three hypervariable loops.
  • the hypervariable loops in each chain are held together in close proximity by the FRs and, with the hypervariable loops from the other chain, contribute to the formation of the antigen-binding site of antibodies.
  • Structural analysis of antibodies revealed the relationship between the sequence and the shape of the binding site formed by the complementarity determining regions (Chothia et al., J. Mol. Biol.
  • CDR complementarity determining region
  • CDR complementary antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991), and by Chothia et al., J. Mol. Biol. 196:901-917 (1987) and by MacCallum et al., J. Mol. Biol. 262:732-745 (1996) where the definitions include overlapping or subsets of amino acid residues when compared against each other. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth for comparison.
  • the term "CDR” is a CDR as defined by Kabat based on sequence comparisons.
  • Residue numbering follows the nomenclature of Kabat et al., supra
  • Residue numbering follows the nomenclature of MacCallum et al., supra
  • Framework region includes the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a variable region framework is between about 100- 120 amino acids in length but includes only those amino acids outside of the CDRs.
  • the framework regions for the light chain are similarly separated by each of the light claim variable region CDRs.
  • the framework region boundaries are separated by the respective CDR termini as described above.
  • the CDRs are as defined by Kabat.
  • the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding site as the antibody assumes its three dimensional configuration in an aqueous environment.
  • the remainder of the heavy and light variable domains show less inter-molecular variability in amino acid sequence and are termed the framework regions.
  • the framework regions largely adopt a ⁇ -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the antigen binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non- covalent binding of the antibody to the immunoreactive antigen epitope.
  • the position of CDRs can be readily identified by one of ordinary skill in the art.
  • Hinge region includes the portion of a heavy chain molecule that joins the CHI domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al. J. Immunol. 1998 161 :4083). Antibodies comprising a "fully human" hinge region may contain one of the hinge region sequences shown in Table 2 below.
  • CH2 domain includes the portion of a heavy chain molecule that extends, e.g., from about residue 244 to residue 360 of an antibody using conventional numbering schemes (residues 244 to 360, Kabat numbering system; and residues 231-340, EU numbering system, Kabat EA et al. Sequences of Proteins of Immunological Interest. Bethesda, US Department of Health and Human Services, NIH. 1991).
  • the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule.
  • fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain.
  • antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding to a human antigen).
  • fragment of an antibody molecule includes antigen-binding fragments of antibodies, for example, an antibody light chain (VL), an antibody heavy chain (VH), a single chain antibody (scFv), a F(ab')2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, and a single domain antibody fragment (DAb). Fragments can be obtained, e.g., via chemical or enzymatic treatment of an intact or complete antibody or antibody chain or by recombinant means.
  • valency refers to the number of potential target binding sites in a polypeptide. Each target binding site specifically binds one target molecule or specific site on a target molecule. When a polypeptide comprises more than one target binding site, each target binding site may specifically bind the same or different molecules (e.g., may bind to different ligands or different antigens, or different epitopes on the same antigen).
  • the subject binding molecules preferably have at least one binding site specific for a human antigen molecule.
  • Specificity refers to the ability to specifically bind (e.g., immunoreact with) a given target antigen, e.g., a human target antigen.
  • a polypeptide may be monospecific and contain one or more binding sites which specifically bind a target or a polypeptide may be multispecific and contain two or more binding sites which specifically bind the same or different targets.
  • an antibody of the invention is specific for two different (e.g., non-overlapping) portions of the same target. In other aspects, an antibody of the invention is specific for more than one target.
  • a multispecific binding molecule of the invention binds to c-Met and a second molecule (e.g., an antigen expressed on a tumor cell or a soluble antigen expressed by a tumor cell).
  • a second molecule e.g., an antigen expressed on a tumor cell or a soluble antigen expressed by a tumor cell.
  • Exemplary antibodies which comprise antigen binding sites that bind to antigens expressed on tumor cells are known in the art and one or more CDRs from such antibodies can be included in an antibody of the invention.
  • non-naturally occurring polypeptides which are modified forms of naturally occurring polypeptides (e.g., comprising a mutation such as an addition, substitution or deletion) or which comprise a first amino acid sequence (which may or may not be naturally occurring) that is linked in a linear sequence of amino acids to a second amino acid sequence (which may or may not be naturally occurring) to which it is not naturally linked in nature.
  • Engineerered includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
  • the antibodies of the invention are engineered, including for example, humanized and/or chimeric antibodies, and antibodies which have been engineered to improve one or more properties, such as antigen binding, stability/half-life or effector function.
  • Modified antibody includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as, domain deleted antibodies or minibodies); multispecific forms of antibodies (e.g., bispecific, trispecific, etc.) altered to bind to two or more different antigens or to different epitopes on a single antigen); heavy chain molecules joined to scFv molecules and the like. ScFv molecules are known in the art and are described, e.g., in US patent 5,892,019.
  • modified antibody includes multivalent forms of antibodies (e.g., trivalent, tetravalent, etc., antibodies that bind to three or more copies of the same antigen).
  • a modified antibody of the invention is a fusion protein comprising at least one heavy chain portion lacking a CH2 domain and comprising a binding domain of a polypeptide comprising the binding portion of one member of a receptor ligand pair.
  • modified antibody may also be used herein to refer to amino acid sequence variants of an antibody. It will be understood by one of ordinary skill in the art that an antibody may be modified to produce a variant antibody which varies in amino acid sequence in comparison to the antibody from which it was derived. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at "non-essential" amino acid residues may be made (e.g., in CDR and/or framework residues). Amino acid substitutions can include replacement of one or more amino acids with a naturally occurring or non-natural amino acid.
  • “Humanising substitutions” refers to amino acid substitutions in which the amino acid residue present at a particular position in the VH or VL domain antibody (for example a camelid-derived antibody) is replaced with an amino acid residue which occurs at an equivalent position in a reference human VH or VL domain.
  • the reference human VH or VL domain may be a VH or VL domain encoded by the human germline. Humanising substitutions may be made in the framework regions and/or the CDRs of an antibody, defined herein.
  • affinity variants refers to "a variant antibody which exhibits one or more changes in amino acid sequence compared to a reference antibody, wherein the affinity variant exhibits an altered affinity for the human protein in comparison to the reference antibody.
  • affinity variants will exhibit an improved affinity for the human antibody, as compared to the reference antibody. The improvement may be either a lower K D or a faster off -rate for the human antigen or an alteration in the pattern of cross -reactivity with non-human homologues.
  • Affinity variants typically exhibit one or more changes in amino acid sequence in the CDRs, as compared to the reference antibody.
  • Such substitutions may result in replacement of the original amino acid present at a given position in the CDRs with a different amino acid residue, which may be a naturally occurring amino acid residue or a non-naturally occurring amino acid residue.
  • the amino acid substitutions may be conservative or non- conservative.
  • "High human homology" An antibody comprising a heavy chain variable domain (VH) and a light chain variable domain (VL) will be considered as having high human homology if the VH domains and the VL domains, taken together, exhibit at least 90% amino acid sequence identity to the closest matching human germline VH and VL sequences.
  • Antibodies having high human homology may include antibodies comprising VH and VL domains of native non-human antibodies which exhibit sufficiently high % sequence identity human germline sequences, including for example antibodies comprising VH and VL domains of camelid conventional antibodies, as well as engineered, especially humanised, variants of such antibodies and also "fully human” antibodies.
  • the VH domain of the antibody with high human homology may exhibit an amino acid sequence identity or sequence homology of 80% or greater with one or more human VH domains across the framework regions FR1, FR2, FR3 and FR4.
  • the amino acid sequence identity or sequence homology between the VH domain of the polypeptide of the invention and the closest matching human germline VH domain sequence may be 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100%.
  • the VH domain of the antibody with high human homology may contain one or more (e.g. 1 to 10) amino acid sequence mis-matches across the framework regions FRl, FR2, FR3 and FR4, in comparison to the closest matched human VH sequence. .
  • the VL domain of the antibody with high human homology may exhibit a sequence identity or sequence homology of 80% or greater with one or more human VL domains across the framework regions FRl, FR2, FR3 and FR4.
  • the amino acid sequence identity or sequence homology between the VL domain of the polypeptide of the invention and the closest matching human germline VL domain sequence may be 85% or greater 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100%.
  • the VL domain of the antibody with high human homology may contain one or more (e.g. 1 to 10) amino acid sequence mis-matches across the framework regions FRl, FR2, FR3 and FR4, in comparison to the closest matched human VL sequence.
  • the canonical folds may be determined, which allows the identification of the family of human germline segments with the identical combination of canonical folds for HI and H2 or LI and L2 (and L3). Subsequently the human germline family member that has the highest degree of sequence homology with the variable region of the antibody of interest is chosen for scoring the sequence homology.
  • the determination of Chothia canonical classes of hypervariable loops LI, L2, L3, HI and H2 can be performed with the bioinformatics tools publicly available on webpage www.bioinf.org.uk/abs/chothia.html.page.
  • the output of the program shows the key residue requirements in a datafile.
  • the key residue positions are shown with the allowed amino acids at each position.
  • the sequence of the variable region of the antibody of interest is given as input and is first aligned with a consensus antibody sequence to assign the Kabat numbering scheme.
  • the analysis of the canonical folds uses a set of key residue templates derived by an automated method developed by Martin and Thornton (Martin et al., J. Mol. Biol. 263:800-815 (1996)). With the particular human germline V segment known, which uses the same combination of canonical folds for HI and H2 or LI and L2 (and L3), the best matching family member in terms of sequence homology can be determined.
  • VH and VL domain framework amino acid sequences of the antibody of interest can be determined, but actually manual alignment of the sequences can be applied as well.
  • Human immunoglobulin sequences can be identified from several protein data bases, such as VBase (http://vbase.mrc-cpe.cam.ac.uk/) or the
  • residues of FR1, FR2 and FR3 are evaluated using the closest match sequence from the human germline family with the identical combination of canonical folds. Only residues different from the closest match or other members of the same family with the same combination of canonical folds are scored (NB - excluding any primer-encoded differences). However, for the purposes of humanization, residues in framework regions identical to members of other human germline families, which do not have the same combination of canonical folds, can be considered "human", despite the fact that these are scored "negative” according to the stringent conditions described above.
  • IMGT numbering scheme is an adaptation of the numbering scheme of Chothia (Lefranc et al., NAR 27: 209-212 (1999); http://imgt.cines.fr).
  • Antibodies with high human homology may comprise hypervariable loops or CDRs having human or human-like canonical folds, as discussed in detail below.
  • At least one hypervariable loop or CDR in either the VH domain or the VL domain of the antibody with high human homology may be obtained or derived from a VH or VL domain of a non-human antibody, for example a conventional antibody from a species of Camelidae, yet exhibit a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
  • canonical structures of the hypervariable loops in intact VH or VL domains can be determined by structural analysis (e.g. X-ray crystallography), but it is also possible to predict canonical structure on the basis of key amino acid residues which are characteristic of a particular structure (discussed further below). In essence, the specific pattern of residues that determines each canonical structure forms a "signature" which enables the canonical structure to be recognised in hypervariable loops of a VH or VL domain of unknown structure; canonical structures can therefore be predicted on the basis of primary amino acid sequence alone.
  • the foregoing analysis relies on prediction of the canonical structure of the HI and H2 loops of the antibody of interest. If the actual structures of the HI and H2 loops in the antibody of interest are known, for example based on X-ray crystallography, then the HI and H2 loops in the antibody of interest may also be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if the length of the loop differs from that of the closest matching human canonical structural class (typically by +1 or +2 amino acids) but the actual structure of the HI and H2 loops in the antibody of interest matches the structure of a human canonical fold.
  • both HI and H2 in the VH domain of the antibody with high human homology exhibit a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
  • Antibodies with high human homology may comprise a VH domain in which the hypervariable loops HI and H2 form a combination of canonical fold structures which is identical to a combination of canonical structures known to occur in at least one human germline VH domain. It has been observed that only certain combinations of canonical fold structures at HI and H2 actually occur in VH domains encoded by the human germline.
  • HI and H2 in the VH domain of the antibody with high human homology may be obtained from a VH domain of a non-human species, e.g. a Camelidae species, yet form a combination of predicted or actual canonical fold structures which is identical to a combination of canonical fold structures known to occur in a human germline or somatically mutated VH domain.
  • HI and H2 in the VH domain of the antibody with high human homology may be obtained from a VH domain of a non-human species, e.g. a Camelidae species, and form one of the following canonical fold combinations: 1-1, 1-2, 1-3, 1-6, 1-4, 2- 1, 3-1 and 3- 5.
  • An antibody with high human homology may contain a VH domain which exhibits both high sequence identity/sequence homology with human VH, and which contains hypervariable loops exhibiting structural homology with human VH.
  • the canonical folds present at HI and H2 in the VH domain of the antibody with high human homology, and the combination thereof, may be "correct" for the human VH germline sequence which represents the closest match with the VH domain of the antibody with high human homology in terms of overall primary amino acid sequence identity.
  • the closest sequence match is with a human germline VH3 domain
  • VH domain of an antibody with high human homology may exhibit a sequence identity or sequence homology of 80% or greater, 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100% with a human VH domain across the framework regions FRl, FR2 , FR3 and FR4, and in addition HI and H2 in the same antibody are obtained from a non-human VH domain (e.g. derived from a Camelidae species), but form a combination of predicted or actual canonical fold structures which is the same as a canonical fold combination known to occur naturally in the same human VH domain.
  • a non-human VH domain e.g. derived from a Camelidae species
  • LI and L2 in the VL domain of the antibody with high human homology are each obtained from a VL domain of a non-human species (e.g. a camelid-derived VL domain), and each exhibits a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
  • a non-human species e.g. a camelid-derived VL domain
  • the hypervariable loops of VL domains of both ⁇ and VK types can adopt a limited number of conformations or canonical structures, determined in part by length and also by the presence of key amino acid residues at certain canonical positions.
  • LI, L2 and L3 loops obtained from a VL domain of a non-human species may be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if at least the first, and preferable both, of the following criteria are fulfilled: 1. An identical length, determined by the number of residues, to the closest matching human structural class.
  • the foregoing analysis relies on prediction of the canonical structure of the LI, L2 and L3 loops in the VL domain of the antibody of interest.
  • LI, L2 and L3 loops derived from the antibody of interest may also be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if the length of the loop differs from that of the closest matching human canonical structural class (typically by +1 or +2 amino acids) but the actual structure of the Camelidae loops matches a human canonical fold.
  • LI and L2 in the VL domain of an antibody with high human homology may form a combination of predicted or actual canonical fold structures which is identical to a combination of canonical fold structures known to occur in a human germline VL domain.
  • LI and L2 in the ⁇ domain of an antibody with high human homology may form one of the following canonical fold combinations: 11-7, 13-7(A,B,C), 14-7(A,B), 12-11, 14-11 and 12-12 (as defined in Williams et al. J. Mol. Biol. 264:220 -32 (1996) and as shown on
  • LI and L2 in the Vkappa domain may form one of the following canonical fold combinations: 2-1, 3-1, 4-1 and 6-1 (as defined in Tomlinson et al. EMBO J. 14:4628-38 (1995) and as shown on
  • all three of LI, L2 and L3 in the VL domain of an antibody with high human homology may exhibit a substantially human structure. It is preferred that the VL domain of the antibody with high human homology exhibits both high sequence identity/sequence homology with human VL, and also that the
  • hypervariable loops in the VL domain exhibit structural homology with human VL.
  • the VL domain of an antibody with high human homology may exhibit a sequence identity of 80% or greater, 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100% with a human VL domain across the framework regions FR1, FR2 , FR3 and FR4, and in addition hypervariable loop LI and hypervariable loop L2 may form a combination of predicted or actual canonical fold structures which is the same as a canonical fold combination known to occur naturally in the same human VL domain.
  • identity/sequence homology with human VH and also structural homology with hypervariable loops of human VH will be combined with VL domains exhibiting high sequence identity/sequence homology with human VL, and also structural homology with hypervariable loops of human VL to provide antibodies with high human homology containing VH/VL pairings (e.g camelid-derived VH/Vl pairings) with maximal sequence and structural homology to human-encoded VH/VL pairings.
  • VH/VL pairings e.g camelid-derived VH/Vl pairings
  • Epitope refers to a specific arrangement of amino acids located on a peptide or protein to which an antibody or antibody fragment binds. Epitopes often consist of a chemically active surface grouping of molecules such as amino acids or sugar side chains, and have specific three dimensional structural characteristics as well as specific charge characteristics. Epitopes can be linear, i.e., involving binding to a single sequence of amino acids, or conformational, i.e., involving binding to two or more sequences of amino acids in various regions of the antigen that may not necessarily be contiguous.
  • the invention relates, at least in part, to isolated multispecific antibodies (which may be monoclonal antibodies), or fragments thereof having at one binding site with a paired VH/VK domain and at least one binding site with a paired VH/ ⁇ domains, wherein at least one (or all) of the VH, VK, and ⁇ domains are camelid-derived.
  • the antibodies of the invention may comprise at least one hypervariable loop or complementarity determining region obtained from a VH domain, ⁇ domain and/or VK domain of a species in the family Camelidae, such as VH and/or VL domains, or CDRs thereof, obtained by active immunisation of outbred camelids, e.g. llamas, with a human antigen.
  • a hypervariable loop or complementarity determining region obtained from a VH domain, ⁇ domain and/or VK domain of a species in the family Camelidae, such as VH and/or VL domains, or CDRs thereof, obtained by active immunisation of outbred camelids, e.g. llamas, with a human antigen.
  • hypervariable loop or complementarity determining region obtained from a VH domain or a VL domain of a species in the family Camelidae is meant that that hypervariable loop (HV) or CDR has an amino acid sequence which is identical, or substantially identical, to the amino acid sequence of a hypervariable loop or CDR which is encoded by a Camelidae immunoglobulin gene.
  • hypervariable loop (HV) or CDR has an amino acid sequence which is identical, or substantially identical, to the amino acid sequence of a hypervariable loop or CDR which is encoded by a Camelidae immunoglobulin gene.
  • immunoglobulin gene includes germline genes, immunoglobulin genes which have undergone
  • the amino acid sequence of the HV or CDR obtained from a VH or VL domain of a Camelidae species may be identical to the amino acid sequence of a HV or CDR present in a mature Camelidae conventional antibody.
  • the term "obtained from” in this context implies a structural relationship, in the sense that the HVs or CDRs of the antibody embody an amino acid sequence (or minor variants thereof) which was originally encoded by a Camelidae immunoglobulin gene. However, this does not necessarily imply a particular relationship in terms of the production process used to prepare the antibody.
  • Camelid-derived c-Met antibodies may be derived from any camelid species, including inter alia, llama, dromedary, alpaca, vicuna, guanaco or camel.
  • Antibodies comprising camelid-derived VH and VL domains, or CDRs thereof, are typically recombinantly expressed polypeptides, and may be chimeric polypeptides.
  • chimeric polypeptide refers to an artificial (non-naturally occurring) polypeptide which is created by juxtaposition of two or more peptide fragments which do not otherwise occur contiguously. Included within this definition are "species" chimeric polypeptides created by juxtaposition of peptide fragments encoded by two or more species, e.g. camelid and human.
  • the entire VH domain and/or the entire VL domain may be obtained from a species in the family Camelidae.
  • the camelid-derived VH domain and/or the camelid-derived VL domain may then be subject to protein engineering, in which one or more amino acid substitutions, insertions or deletions are introduced into the camelid amino acid sequence.
  • These engineered changes preferably include amino acid substitutions relative to the camelid sequence.
  • Such changes include "humanisation” or "germlining" wherein one or more amino acid residues in a camelid-encoded VH or VL domain are replaced with equivalent residues from a homologous human-encoded VH or VL domain.
  • Isolated camelid VH and VL domains obtained by active immunisation of a camelid (e.g. llama) with a target antigen can be used as a basis for engineering antigen binding polypeptides according to the invention.
  • a target antigen e.g., human antigen
  • Isolated camelid VH and VL domains obtained by active immunisation of a camelid (e.g. llama) with a target antigen (e.g., human antigen) can be used as a basis for engineering antigen binding polypeptides according to the invention.
  • Starting from intact camelid VH and VL domains it is possible to engineer one or more amino acid substitutions, insertions or deletions which depart from the starting camelid sequence.
  • substitutions, insertions or deletions may be present in the framework regions of the VH domain and/or the VL domain.
  • the purpose of such changes in primary amino acid sequence may be to reduce presumably unfavourable properties (e.g. immunogenicity in
  • changes in primary amino acid sequence can be engineered in one or more of the hypervariable loops (or CDRs) of a Camelidae VH and/or VL domain obtained by active immunisation. Such changes may be introduced in order to enhance antigen binding affinity and/or specificity, or to reduce presumably unfavourable properties, e.g. immunogenicity in a human host (so-called humanization), sites of potential product heterogeneity and or instability, glycosylation, deamidation, isomerisation, etc., or to enhance some other favourable property of the molecule, e.g. solubility, stability, bioavailability, etc.
  • the invention provides a variant antibody which contains at least one amino acid substitution in at least one framework or CDR region of either the VH domain, VK domain, or ⁇ domain in comparison to a camelid-derived VH domain, VK domain, or ⁇ domain.
  • chimeric antibody molecules comprising camelid-derived VH and VL domains (or engineered variants thereof) and one or more constant domains from a non-camelid antibody, for example human-encoded constant domains (or engineered variants thereof).
  • both the VH domain and the VL domain are obtained from the same species of camelid, for example both VH and VL may be from Lama glama or both VH and VL may be from Lama pacos (prior to introduction of engineered amino acid sequence variation).
  • both the VH and the VL domain may be derived from a single animal, particularly a single animal which has been actively immunised with a target antigen (e.g., human antigen).
  • a target antigen e.g., human antigen
  • Camelidae VH and/or VL domains individual camelid-derived hypervariable loops or CDRs, or combinations thereof, can be isolated from camelid VH/VL domains and transferred to an alternative (i.e. non-Camelidae) framework, e.g. a human VH/VL framework, by CDR grafting.
  • an alternative framework i.e. non-Camelidae framework, e.g. a human VH/VL framework, by CDR grafting.
  • Multi- specific antibodies comprising camelid-derived VH, VK and ⁇ domains, or CDRs thereof, can take various different embodiments in which both paired VH/ ⁇ domains and paired VH/VK domains are present.
  • antibody herein is used in the broadest sense and encompasses, but is not limited to, monoclonal antibodies
  • polyclonal antibodies including full length monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), so long as they exhibit the appropriate
  • a target antigen e.g., human antigen
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations which typically include different antibodies directed against different determinants (epitopes) on the antigen, each monoclonal antibody is directed against a single determinant or epitope on the antigen.
  • Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable domain thereof.
  • Examples of antibody fragments include Fab, Fab', F(ab')2, bi-specific Fab' s, and Fv fragments, diabodies, linear antibodies, single- chain antibody molecules, a single chain variable fragment (scFv).
  • a multispecific antibody of the invention is formed from antibody fragments by linking the fragments in series (see Holliger and Hudson, Nature
  • antibodies comprising camelid-derived VH, ⁇ and VK domains, or CDRs thereof may comprise CHI domains and/or CL domains, the amino acid sequence of which is fully or substantially human.
  • the ⁇ domain is fused to a CL domain of ⁇ isotype (CX).
  • the VK domain is fused to a CL domain of ⁇ isotype (CK).
  • the antigen binding polypeptide of the invention is an antibody intended for human therapeutic use, it is typical for the entire constant region of the antibody, or at least a part thereof, to have fully or substantially human amino acid sequence. Therefore, one or more or any combination of the CHI domain, hinge region, CH2 domain, CH3 domain and CL domain (and CH4 domain if present) may be fully or substantially human with respect to it's amino acid sequence.
  • the CHI domain, hinge region, CH2 domain, CH3 domain and CL domain may all have fully or substantially human amino acid sequence.
  • substantially human refers to an amino acid sequence identity of at least 90%, or at least 95%, or at least 97%, or at least 99% with a human constant region.
  • human amino acid sequence in this context refers to an amino acid sequence which is encoded by a human immunoglobulin gene, which includes germline, rearranged and somatically mutated genes.
  • the invention also contemplates polypeptides comprising constant domains of "human" sequence which have been altered, by one or more amino acid additions, deletions or substitutions with respect to the human sequence, excepting those embodiments where the presence of a "fully human” hinge region is expressly required.
  • a "fully human" hinge region in the antibodies of the invention may be beneficial both to minimise immunogenicity and to optimise stability of the antibody.
  • one or more amino acid substitutions, insertions or deletions may be made within the constant region of the heavy and/or the light chain, particularly within the Fc region. Amino acid substitutions may result in replacement of the substituted amino acid with a different naturally occurring amino acid, or with a non-natural or modified amino acid. Other structural modifications are also permitted, such as for example changes in glycosylation pattern (e.g. by addition or deletion of N- or O-linked glycosylation sites).
  • the antibody of the invention may be desirable to modify the antibody of the invention with respect to its binding properties to Fc receptors, for example to modulate effector function.
  • cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
  • the homodimeric antibody thus generated may have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp. Med. 176: 1191 - 1195 (1992) and Shopes, B. J. Immunol. 148:2918-2922
  • a c-Met antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design 3:219-230 (1989).
  • the invention also contemplates immunoconjugates comprising an antibody as described herein conjugated to a cytotoxic agent such as a chemo therapeutic agent, toxin (e.g., an enzymatic ally active toxin of bacterial, fungal, plant or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • Fc regions may also be engineered for half-life extension, as described by Chan and Carter, Nature Reviews: Immunology, Vol.10, pp301-316, 2010, incorporated herein by reference.
  • the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fey receptor by modifying one or more amino acids.
  • ADCC antibody dependent cellular cytotoxicity
  • the glycosylation of an antibody is modified.
  • an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
  • Glycosylation can be altered to, for example, increase the affinity of the antibody for the target antigen.
  • carbohydrate modifications can be accomplished by; for example, altering one or more sites of glycosylation within the antibody sequence.
  • one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
  • Such aglycosylation may increase the affinity of the antibody for antigen.
  • variant antibodies having an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or a non- fucosylated antibody (as described by Natsume et al., Drug Design Development and Therapy, Vol.3, pp7-16, 2009) or an antibody having increased bisecting GlcNac structures.
  • Such altered glycosylation patterns have been demonstrated to increase the ADCC activity of antibodies, producing typically 10-fold enhancement of ADCC relative to an equivalent antibody comprising a "native" human Fc domain.
  • Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation enzymatic machinery (as described by Yamane-Ohnuki and Satoh, mAbs 1 :3, 230-236, 2009).
  • the invention can, in certain embodiments, encompass chimeric
  • Camelidae/human antibodies and in particular chimeric antibodies in which the VH and VL domains of a binding site are of fully camelid sequence (e.g. Llama or alpaca) and the remainder of the antibody is of fully human sequence.
  • Multispecific antibodies of the invention can include binding sites comprising "humanised” or “germlined” variants of camelid-derived VH and VL domains, or CDRs thereof, and camelid/human chimeric antibodies, in which the VH and VL domains contain one or more amino acid
  • Multi- specific antibodies of the invention may also be CDR-grafted antibodies in which CDRs (or hypervariable loops) derived from a camelid antibody, for example an camelid antibody raised by active immunisation with human protein, or otherwise encoded by a camelid gene, are grafted onto a human VH and VL framework, with the remainder of the antibody also being of fully human origin.
  • CDRs or hypervariable loops
  • Humanised, chimeric and CDR-grafted antibodies as described above, particularly antibodies comprising hypervariable loops or CDRs derived from active immunisation of camelids with a human antigen can be readily produced using conventional recombinant DNA manipulation and expression techniques, making use of prokaryotic and eukaryotic host cells engineered to produce the polypeptide of interest and including but not limited to bacterial cells, yeast cells, mammalian cells, insect cells, plant cells , some of them as described herein and illustrated in the accompanying examples.
  • Camelid-derived antibodies include variants wherein the hypervariable loop(s) or CDR(s) of the VH domain and/or the VL domain are obtained from a conventional camelid antibody raised against a human antigen, but wherein at least one of said
  • Camelid-derived HVs/CDRs which have been engineered in this manner may still exhibit an amino acid sequence which is "substantially identical" to the amino acid sequence of a camelid-encoded HV/CDR.
  • substantially identical may permit no more than one, or no more than two amino acid sequence mis-matches with the camelid- encoded HV/CDR.
  • the camelid-derived antibodies provided herein may be of any isotype.
  • Antibodies intended for human therapeutic use will typically be of the IgA, IgD, IgE IgG, IgM type, often of the IgG type, in which case they can belong to any of the four sub-classes IgGl, IgG2a and b, IgG3 or IgG4. Within each of these sub-classes it is permitted to make one or more amino acid substitutions, insertions or deletions within the Fc portion, or to make other structural modifications, for example to enhance or reduce Fc-dependent functionalities.
  • the multispecific antibodies of the invention comprise at least one binding site which binds to an epitope within the extracellular domain of human c-Met and blocks binding of HGF to the extracellular domain of c-Met, to varying degrees.
  • the ability of the c-Met antibodies provided herein to block binding of HGF to c-Met may be measured by means of a competition assay.
  • c-Met antibodies block binding to HGF to c-Met with an IC 50 of 0.5nM or less.
  • the multi- specific antibodies of the invention comprises at least two binding sites, wherein the first and second binding sites may bind to different (overlapping or non-overlapping) epitopes within the extracellular domain of the human c-Met protein.
  • a multispecific antibody of the invention comprises at least one binding site which binds to an epitope within the SEMA domain of human c- Met.
  • the SEMA domain is contained within amino acid residues 25-515 of human c-Met (amino acid residues 1-491 of the mature protein) and has been recognised in the art as containing a binding site for the c-Met ligand HGF.
  • the cMET binding site may bind to an epitope within the peptide 98-VDTYYDDQLISCGSVNRGTCQRHVFPHNHTA DIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP LHSISVRRLKETK- 199 of human c-Met (SEQ ID NO: 183).
  • the antibody denoted 36C4 and the germlined variants and affinity variants thereof, all bind to an epitope within this peptide region of the SEMA domain. This region of the SEMA domain is significant since it is known to contain a binding site for the c-Met ligand HGF.
  • the multispecific antibody comprises at least one binding site which binds to an epitope within the IPT region of human c-Met.
  • the IPT region is known to include amino acid residues 568-932 of human c-Met ((amino acid residues 544-909 of the mature protein lacking the signal peptide).
  • the IPT region itself is sub-divided into IPT domains 1, 2, 3 and 4.
  • multispecific antibody of the invention may comprise a first binding site which binds to an epitope within IPT domains 1-2 of human c-Met (IPT- 1 comprises amino acid residues 568-656 of human; IPT-2 comprises amino acid residues 657-741 of human c-Met), within IPT domains 2-3 of human c-Met (IPT-2 comprises amino acid residues 657-741 of human c-Met; IPT- 3 comprises amino acid residues 742-838 of human c-Met).
  • the multispecific antibody may comprise a binding site which binds to an epitope within IPT domains 3-4 of c-Met (IPT-3 comprises amino acid residues 742-838 of human c-
  • IPT-4 comprises amino acid residues 839-932 of human c-Met).
  • IPT domains 3-4 have been identified as containing a high affinity binding site for the ligand HGF (see for example EP 2119448 incorporated herein by reference) but to date no antibodies capable of binding to IPT domains 3-4 and antagonising HGF-mediated activation of c-Met have been described. Potent, strictly antagonistic binding sites binding to the IPT domains, and particularly IPT domains 1-2, 2-3 and 3-4, or to the PS I- IPT region of human c-Met are provided herein.
  • these antibodies can exhibit high human homology, as defined herein, and can be provided in recombinant form containing a fully human hinge region and Fc domain, particularly of the human IgGl isotype, without significant loss of antagonist activity or gain of agonist activity.
  • Yet other binding sites provided herein may bind to conformational epitopes with part or all of the recognition site within the IPT region of human c-Met.
  • a multispecific antibody of the invention comprises at least one binding site which binds to an epitope within the region of human c-Met spanning the junction between the PSI domain and IPT domain 1 (PSTIPT1) .
  • the PSI domain of human c-Met spans amino acid residues 492-543 of the mature protein (lacking the signal peptide), whereas IPT domain 1 spans residues 544-632 of mature human c-Met (lacking the signal sequence).
  • the c-Met antibody may bind to an epitope within the amino acid sequence 5 23 - RSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKT RVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVD
  • the multi- specific antibody may comprise a binding site derived from c-Met antibody denoted herein as 48A2, and the germlined variants and affinity variants of 48A2 described herein, which been demonstrated to bind a conformational epitope within this PSI- IPT 1 peptide of human c-Met.
  • Binding of a binding site to an epitope within the PSTIPT1 region, and more specifically binding to the epitope bound by antibody 48 A2 and its variants, may produce an effect both by blocking binding of the c-Met ligand HGF to a binding site within the IPT region and by sterically blocking/hindering the conformational change which normally accompanies binding of HGF to c-Met.
  • a specific therapeutic utility may be achieved by targeting c-Met antibodies to the IPT domains, as defined above, or to junctions between IPT domains and/or to conformational epitopes with all or part of the recognition site within the IPT region of human c-Met.
  • a multispecific antibody of the invention comprises at least one binding site which binds to the SEMA domain of c-MET and at least one binding site which binds to the IPT 1-2 domain of c-MET.
  • a multispecific antibody of the invention may comprise at least one binding site comprising paired VH/ ⁇ domains and at least one binding site comprising paired VH/VK domains.
  • the paired VH/ ⁇ domains and the paired VH/VK domains can be independently selected from the following exemplary pairings.
  • the VH/VK binding site of an antibody of the invention comprises light chain CDRs and heavy chain CDRs from Table 3a and Table3b below.
  • the VH/VK binding site of the antibody of the invention comprises the Vk domain CDRs (SEQ ID NOs 22-24) and the VH domain CDRs (SEQ ID NOs 13-15) of a 38H10 antibody. Said binding site binds to the IPTl-2 domain of c-MET.
  • the VH/VK binding site of the antibody of the invention comprises the Vk domain CDRs (SEQ ID NOs 25-27) and the VH domain CDRs (SEQ ID NOs 16-18) of a 40B8 antibody. Said binding site binds to the IPTl-2 domain of c-MET.
  • the VH/VK binding site of the antibody of the invention comprises the Vk domain CDRs (SEQ ID NOs 86, 23, 87) and the VH domain CDRs (SEQ ID NOs 13-15) of a 48 A2 antibody.
  • VK V kappa
  • the VH/VK binding site of an antibody of the invention comprises VH domain and VK domain sequences from Table 4 below.
  • the VH/VK binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 49) and the VK domain (SEQ ID NO 52) of a 38H10 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 50) and the VK domain (SEQ ID NO:53) of a 40B8 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 49) and the VK domain (SEQ ID NO: 89) of a 48 A2 antibody.
  • the VH/ ⁇ binding site of an antibody of the invention comprises light chain CDRs and heavy chain CDRs from Table 5a and Table 5b below.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 28-30) and the VH domain CDRs (SEQ ID NOs 10-12) of a 20F1 antibody. Said binding site binds to the SEMA domain of c-MET.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 31-33) and the VH domain CDRs (SEQ ID NOs 19-21) of a 36C4 antibody. Said binding site binds to the SEMA domain of c-MET.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 34-36) and the VH domain CDRs (SEQ ID NOs 1-3) of a 12G4 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 37-39) and the VH domain CDRs (SEQ ID NOs 4-6) of a 13E6 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 40-42) and the VH domain CDRs (SEQ ID NOs 7-9) of a 20A11 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 74-76) and the VH domain CDRs (SEQ ID NOs 71-73) of a 34H7 antibody.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 31-33) and the VH domain CDRs (SEQ ID NOs 19, 83 and 21) of a 55A12-54E antibody.
  • the VH/VK binding site of the antibody of the invention comprises the ⁇ domain CDRs (SEQ ID NOs 31-33) and the VH domain CDRs (SEQ ID NOs 19, 84 and 21) of a 53 A 11 antibody.
  • the VH/ ⁇ binding site of an antibody of the invention comprises VH domain and ⁇ domain sequences from Table 6 below.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 45) and the ⁇ domain (SEQ ID NO 56) of a 12G4 antibody.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 46) and the ⁇ domain (SEQ ID NO 57) of a 13E6 antibody.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 47) and the ⁇ domain (SEQ ID NO 58) of a 20Al l antibody.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 51) and the ⁇ domain (SEQ ID NO 55) of a 36C4 antibody.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 88) and the ⁇ domain (SEQ ID NO 55) of a 36C4Q antibody.
  • the VH/ ⁇ binding site of the antibody of the invention comprises the VH domain (SEQ ID NO: 77) and the ⁇ domain (SEQ ID NO 78) of a 34H7 antibody.
  • Camelid conventional antibodies provide an advantageous starting point for the preparation of antibodies with utility as human therapeutic agents due to the following factors, discussed in US 12/497,239 which is incorporated herein by reference: 1) High % sequence homology between camelid VH and VL domains and their human counterparts;
  • the camelid (e.g. llama) platform also provides a significant advantage in terms of the functional diversity of the antibodies which can be obtained.
  • the utility of multispecific antibodies comprising camelid-derived VH and VL
  • V and/or VK domains for human therapy can be improved still further by
  • humanisation or “germlining” of natural camelid VH and VL domains, for example to render them less immunogenic in a human host.
  • the overall aim of humanisation is to produce a molecule in which the VH and VL domains exhibit minimal immunogenicity when introduced into a human subject, whilst retaining the specificity and affinity of the antigen binding site formed by the parental VH and VL domains.
  • VH (or VL) domains is a critical step in the humanisation process, both for selection of camelid amino acid residues to be changed (in a given VH or VL domain) and for selecting the appropriate replacement amino acid residue(s).
  • Step 2 Select specific human germline family member used to germline against.
  • this is the germline with the highest homology or another germline family member from the same family.
  • Step 3 Identify the preferred positions considered for germlining on the basis of the table of amino acid utilisation for the camelid germline that is closest to the selected human germline.
  • Step 4 Try to change amino acids in the camelid germline that deviate from the closest human germline; germlining of FR residues is preferred over CDR residues.
  • b Positions that are deviating from the selected human germline family member but which are used in other germlines of the same family may also be addressed in the germlining process.
  • c. Additional mismatches (e.g. due to additional somatic mutations) towards the selected human germline may also be addressed.
  • the canonical folds may first be determined, which allows the identification of the family of human germline segments with the identical combination of canonical folds for HI and H2 or LI and L2 (and L3). Subsequently the human germline family member that has the highest degree of sequence homology with the Camelidae variable region of interest may be chosen for scoring sequence homology.
  • the output of the program shows the key residue requirements in a datafile. In these datafiles, the key residue positions are shown with the allowed amino acids at each position.
  • the sequence of the variable region of the antibody is given as input and is first aligned with a consensus antibody sequence to assign the Kabat numbering scheme.
  • the analysis of the canonical folds uses a set of key residue templates derived by an automated method developed by Martin and Thornton (Martin et al., J. Mol. Biol. 263:800-815 (1996)).
  • the boundaries of the individual framework regions may be assigned using the IMGT numbering scheme, which is an adaptation of the numbering scheme of Chothia (Lefranc et al., NAR 27: 209-212 (1999); http://imgt.cines.fr).
  • a sequence alignment algorithm such as available via websites like www.expasy.ch/tools/#align can be used, but also manual alignment can also be performed with a limited set of sequences.
  • Human germline light and heavy chain sequences of the families with the same combinations of canonical folds and with the highest degree of homology with the framework regions 1, 2, and 3 of each chain may be selected and compared with the Camelidae variable region of interest; also the FR4 is checked against the human germline JH and JK or JL regions.
  • residues of FR1, FR2 and FR3 are evaluated using the closest match sequence from the human germline family with the identical combination of canonical folds. Only residues different from the closest match or other members of the same family with the same combination of canonical folds are scored (NB - excluding any primer-encoded differences). However, for the purposes of humanization, residues in framework regions identical to members of other human germline families, which do not have the same combination of canonical folds, can be considered for humanization, despite the fact that these are scored "negative" according to the stringent conditions described above.
  • the approach described above can be used to prepare humanised variants of the c- MET binding sites having the amino acid sequences shown as SEQ ID NOs: 1-21, 71-73 or 83-85 (heavy chain CDRs) or having the amino acid sequences shown as SEQ ID NOs: 22-42, 74-76, 86 or 87 (light chain CDRs), and also for humanisation of camelid-derived VH domains having the sequences shown as SEQ ID NOs: 45-51, 77 or 88 and of camelid-derived VL domains having the sequences shown as SEQ ID NOs: 52-58, 78 or 89.
  • humanised variants of VH domains having the amino acid sequences shown as SEQ ID Nos: 45-51, 77 or 88 may include variants in which the amino acid residue(s) occuring at one or more of the positions listed in the following table is/are replaced with an amino acid residue which occurs at the equivalent position in a human VH domain, e.g. a human germline-encoded VH domain.
  • Appropriate amino acid substitutions can be derived by following the general protocol for humanisation described above. Exemplary VH substitutions are provided in Table 7 below. Table 7: List of amino acid residue positions which may be substituted during humanisation of the listed VH domains from c-MET Binding Sites. For each named VH domain, the listed amino acid residues are numbered according to the Kabat numbering system.
  • humanised variants of VL domains having the amino acid sequences shown as SEQ ID Nos: 52-58, 78 or 89 may include variants in which the amino acid residue(s) occurring at one or more of the positions listed in the following table is/are replaced with an amino acid residue which occurs at the equivalent position in a human VL domain, e.g. a human germline-encoded VL domain.
  • Appropriate amino acid substitutions can be derived by following the general protocol for humanisation described above. Exemplary VH substitutions are provided in Table 8 below.
  • Table 8 List of amino acid residue positions which may be substituted during humanisation of the listed VL domains. For each named VL domain, the listed acid residues are numbered according to the Kabat numbering system.
  • a multi- specific antibody of the invention comprises at least one paired VH/ ⁇ binding site wherein the VH and ⁇ domain sequeuences are selected from the germlined variant sequences set forth in Table 9 below.
  • Table 9 amino acid sequences of the VH and ⁇ germlined variants of 36C4 >55A12-54E_VH (SEQ ID NO:92)
  • a multi-specific antibody of the invention comprises at least one paired VH/VK binding site wherein the VH and VK domain sequences are selected from the germlined variant sequences set forth in Table 10 below.
  • the invention also provides a polynucleotide molecules encoding the
  • multispecific antibodies of the invention also expression vectors containing a nucleotide sequences which encode the antibodies of the invention operably linked to regulatory sequences which permit expression of the antigen binding polypeptide in a host cell or cell-free expression system, and a host cell or cell-free expression system containing this expression vector.
  • Polynucleotide molecules encoding the antibodies of the invention include, for example, recombinant DNA molecules.
  • nucleic acid molecules a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5' to 3' direction.
  • nucleic acids or polynucleotides are "isolated.”
  • This term when applied to a nucleic acid molecule, refers to a nucleic acid molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated.
  • an "isolated nucleic acid” may comprise a DNA molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or non-human host organism.
  • isolated polynucleotide refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above. Alternatively, the term may refer to an RNA molecule that has been purified/separated from other nucleic acids with which it would be associated in its natural state (i.e., in cells or tissues).
  • An isolated polynucleotide (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
  • recombinant polynucleotide encoding the various binding sites may be prepared (using standard molecular biology techniques) and inserted into a replicable vector for expression in a chosen host cell, or a cell-free expression system.
  • an expression vector or plasmid encoding the VH and/or VK domain of a first binding site may be mixed with a second expression vector encoding the VH and ⁇ domain of a second binding site.
  • Suitable host cells may be prokaryote, yeast, or higher eukaryote cells, specifically mammalian cells.
  • useful mammalian host cell lines are monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen. Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); mouse Sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980) ); mouse myeloma cells
  • SP2/0-AG14 ATCC CRL 1581; ATCC CRL 8287 or NS0 (HP A culture collections no. 85110503); monkey kidney cells (CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL- 1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci.
  • host cell generally refers to a cultured cell line.
  • the invention also provides a method of producing a c-Met antibody of the invention which comprises culturing a host cell (or cell free expression system) containing polynucleotide (e.g. an expression vector) encoding the c-Met antibody under conditions which permit expression of the c-Met antibody, and recovering the expressed c-Met antibody.
  • a host cell or cell free expression system
  • polynucleotide e.g. an expression vector
  • This recombinant expression process can be used for large scale production of c-Met antibodies according to the invention, including monoclonal antibodies intended for human therapeutic use.
  • Suitable vectors, cell lines and production processes for large scale manufacture of recombinant antibodies suitable for in vivo therapeutic use are generally available in the art and will be well known to the skilled person.
  • a three step column purification process may be employed.
  • antibodies may be purified on a Protein A affinity column to select for only properly assembled antibodies, containing two heavy and two light chains.
  • a number of Protein A purification columns are known in the art, e.g., MabSelect.
  • the purified antibody fraction may then be further purified, using a two-step counter- selection strategy in order to separate mono-specific, parental antibodies from the multi- specific antibodies of the invention.
  • binding agents e.g., antibodies, antibody fragments, e.g., Fabs, scFv antibodies, sdAbs, Nanobodies or VHH antibodies, aptamers, peptides, or alternative protein scaffolds
  • a first binding agent with specificity for a first binding site or specificity is employed to capture the desired multispecific antibody and separate it from a first mixture, thereby generating a partially-purified, second mixture.
  • the second mixture is counter- selected using a second binding agent with specificity for the second binding site of the multi- specific antibody, to obtain a purified preparation of the desired multi- specific antibody.
  • the first and/or second binding agent is antibody or a variant or fragment thereof.
  • the first and second binding agents may be fixed to a solid support to generate affinity chromatography columns.
  • the multispecific antibodies of the invention can be separated from mixtures using a pH gradient or buffer that facilitates differential binding of the antibodies or contaminants to the solid support.
  • the desired multispecific antibody can be separated under conditions which facilitate preferential binding of the multi- specific antibody to the affinity column, followed by elution of the desired multi- specific using an appropriate elution buffer (e.g., 50 mM glycine at pH 2.0).
  • an appropriate elution buffer e.g. 50 mM glycine at pH 2.0.
  • the purification of multispecific antibodies can be facilitated with a modified multispecific antibody by fusing the ⁇ domain of the ⁇ /VH binding site to a first purification tag and fusing the VK domain of the VK/VH binding site to a second purification tag, wherein the first and second purification tag are recognized by different binding agents, e.g., capture antibodies, antibody fragments, sdAbs, aptamers, or alternative protein scaffolds.
  • the purified antibody fraction can then be purified on a first affinity column with affinity for the first purification tag, followed by purification on a second affinity column with affinity for the second purification tag.
  • selection can be performed in the opposite order, with the election on the second affinity column followed by selection on the first affinity column.
  • the first purification tag is a CK domain and the second purification tag is a ⁇ domain, and purification is facilitated with a first anti-CK antibody and an anti-C antibody.
  • the ⁇ and CK domains are of human sequence.
  • Exemplary anti-CK and anti-C antibodies include "Lambda-Select” beads and "Kappa- Select” beads (BAC BV, The Netherlands). The use of kappa and lambda light chains and the subsequent purification with
  • Kappa-Select and Lambda-Select results in results in four antibody combinations, of which only one is a functional bispecific with both parental arms having a light chain capable of binding the target.
  • the remaining three antibodies contain mispaired VH - VL combinations ( Figure 7B).
  • an anti-idiotypic antibody or fragment may be used the separate the desired bispecific from the mispaired VH-VL combinations.
  • Such antibodies recognize the unique epitope or "paratope" formed by the VH/ ⁇ or VHK binding sites of the multispecific antibody.
  • the anti-idiotypic antibody is a VHH, which are highly suitable for affinity purification due to their stability and easy production in
  • Anti-idiotypic VHH are known in the art and include those generated against monoclonal antibodies (Zarebski et al., J Mol Biol (2005) 349: 814 - 824), against human HIV-1 neutralizing human antibody bl2 (Sophie Holuigue, PhD thesis).
  • Competitive elution with antigen can ensure the selection of VHH recognizing the relevant paratope on the desired bispecific antibodies, while the presence of irrelevant human IgG in solution avoids the isolation of VHH against the constant regions.
  • anti-idiotypic camelid-derived binding agents e.g, antibodies
  • anti-idiotypic binding agents can be generated against the antibodies used in the bispecific constructs.
  • Such anti-idiotypic binding agents can be used to facilitate the purification of multispecific antibodies of the invention using a two-step counter-selection strategy in which a first binding specificity is captured with a first anti-idiotypic binding agent in a first purification step followed by capture of a second binding specificity in a second purification step using an second anti- idiotypic binding agent.
  • a bispecific antibody fraction can be applied to a first affinity column comprising a first anti-idiotypic binding agent with affinity for the first binding specificity, followed by purification on a second affinity column comprising a second anti-idiotypic binding agent with affinity for the second binding specificity of the bispecific antibody.
  • selection can be performed in the opposite order, with the election on the second affinity column followed by selection on the first affinity column.
  • Figure 1 illustrates an exemplary anti-idiotypic method for purifying a desired and properly paired bispecific SIMPLE antibody (circled, BsAb) from a mixture of 10 combinations formed by alternative mispairings of light and heavy chains (Figure 1A).
  • Purification employs a two step process in which the mixture is applied to a first anti- idiotypic antibody (All) specifically recognizing only the properly paired VH1/VL1 domains of a first antigen binding site ( Figure IB) to obtain a second mixture of 4 antibodies; followed by application of the second mixture to a second anti-idiotypic antibody (AI2) that specifically recognizes only the properly paired VH2/VL2 domains of the second antigen binding site of the bispecific antibody to obtain the isolated desired BsAb ( Figure 1C).
  • the anti-idiotypic anibodies can be employed in the opposite order ( Figure 2).
  • the anti-idiotypic binding agents may be an anti-idiotype antigen binding polypeptide (e.g. an anti-idiotype antibody or an antigen binding fragment thereof) obtained from a species in the family Camelidae that is immunized with a target antigen comprising the variable region of a multispecific antibody of the invention.
  • the camelid-derived, anti-idiotypic antibody may be a conventional camelid antibody (i.e. a camelid antibody comprising paired VH and VL domains) or a heavy-chain only antibody (i.e. a camelid antibody comprising a VHH domain).
  • the camelid species in which the anti-idiotype antigen binding polypeptide is raised may be the same as the camelid species from which the antibody variable region is/was derived. Accordingly, by way of non-limiting example, one preferred embodiment is a llama-derived anti-idiotype antigen binding polypeptide (e.g. a llama anti-idiotype antibody) which binds to an epitope within the variable region of a llama-derived, multi- specific antibody of the invention.
  • a llama-derived anti-idiotype antigen binding polypeptide e.g. a llama anti-idiotype antibody
  • the epitope in the variable region of the camelid-derived (e.g. llama-derived) antibody to which the anti-idiotype antigen binding polypeptide binds may be located in the VH domain of the camelid-derived (e.g. llama-derived) conventional antibody, or within the VL of the camelid-derived (e.g. llama-derived) conventional antibody, or the epitope may be formed from amino acids within both the VH domain and the VL domain of the camelid-derived (e.g. llama-derived) conventional antibody.
  • the "epitope" for an anti-idiotype antigen binding polypeptide is most typically formed from the CDRs of the antibody variable region to which it binds.
  • variable region of the camelid-derived (e.g. llama-derived) conventional antibody which forms the target antigen for the anti-idiotype antigen binding polypeptide may be derived from a native camelid (e.g. llama) conventional antibody, for example an antibody raised by active immunisation of the camelid (e.g. llama) with the antigen binding site derived from the multispecific antibody, or it may in fact be a synthetic or engineered sequence variant of a native camelid (e.g. llama) conventional antibody.
  • Figure 3 illustrates an exemplary scheme for obtain such camelid-derived anti-idiotypic antibodies in which the first anti-idiotypic antibody is raised by actively immunizing a llama with a llama antibody comprising the first antigen-binding site of a SIMPLE BsAb ( Figure 3A), while the second anti-idiotypic antibody is raise by actively immunizing a llama with a llama antibody comprising the second antigen binding site of the BsbAb ( Figure 3B).
  • the variable region may be presented for immunization in the form of a monospecific antibody or a multispecific antibody.
  • the "variable regions of conventional camelid-derived antibodies” include not only the variable regions of native camelid conventional antibodies, i.e.
  • the sequence comparison window for assessment of % amino acid sequence identity may include the entire VH domain and the entire VL domain.
  • WO 2010/001251 describes the use of camelids (and in particular llamas) as a platform for raising conventional, four-chain, antibodies against a range of target antigens, including human polypeptide targets of therapeutic interest. Described therein are a number of techniques for raising conventional camelid antibodies against target antigens of interest. Once a native camelid (e.g. llama) conventional antibody with appropriate binding specificity for the target antigen has been isolated, it is typical to engineer one or more changes in primary amino acid sequence within the variable domains of the native camelid antibody in order to improve it' s properties, for example to render it more suitable for human therapeutic use.
  • a native camelid e.g. llama
  • Such changes can include amino acid substitutions within the framework regions of the VH domain and/or the VL domain and also amino acid substitutions within one or more of the CDRs within the VH and/or the VL domains that contribute to the antigen binding site.
  • the "epitope" of an anti-idiotype antigen binding polypeptide is most typically formed from the CDRs of the antibody variable region to which it binds. Accordingly, an anti-idiotype antigen binding polypeptide raised by active immunisation of a camelid species (e.g. llama) with the variable regions of a target antibody from the same species (e.g.
  • immunisation with a llama Fab is also expected to bind a germlined variant of those variable regions (e.g. germlined version of the llama Fab), particularly if the amino acid substitutions introduced for the purposes of "germlining" are confined to the framework regions, leaving the CDRs essentially unchanged in terms of sequence and structural
  • anti-idiotypic antibodies suitable for purification of a multispecific antibody of the invention by generating and screening two more anti- idiotypic immune libraries raised against the respective Fab portions of the mulitspecific antibody.
  • the first anti-idiotypic antibody which recognizes the first binding specificity of the multispecific antibody can be selected from a first immune library raised against the first binding specificity (e.g., Fab) of the multispecific antibody
  • the second anti-idiotypic antibody which recognizes a second binding specificity of the multispecific antibody is selected from a second immune library raise against the second binding specificity (e.g., Fab) of the multispecific antibody.
  • the respective immune libraries may be generated by a process comprising the steps of:
  • the antigenic material used for immunisation may be a purified form of the target antigen (i.e., binding specificity), for example recombinantly expressed polypeptide, or an immunogenic fragment thereof.
  • the target antigen such as like isolated cells or tissue preparations expressing or encoding the target antigen, cell lysates, cell supernatants or fractions such as cell membranes, etc., or lipoparticles, beads, vesicles or other particles containing the antigen on their surface, or with a polynucleotide encoding the target antigen (a DNA immunisation).
  • the process will typically involve immunisation of animals of a Camelidae species (including, but limited to, llamas and alpacas), and advantageously these animals will belong to a fully outbred population.
  • transgenic animals e.g. transgenic mice
  • transgenic animals e.g. transgenic mice
  • Peripheral blood lymphocytes or biopsies such as lymph nodes or spleen biopsies may be isolated from the immunised animal and screened for production of camelid antibodies against the target binding specificity. Techniques such as enrichment using panning or FACS sorting may be used at this stage to reduce the complexity of the B cell repertoire to be screened, as illustrated in the examples.
  • Antigen-specific B cells are then selected and used for total RNA extraction and subsequent cDNA synthesis.
  • Nucleic acid encoding the anti-idiotypic antibodies e.g., VHH or conventional
  • Exemplary primers for isolating conventional or VHH anti-idiotypic antibodies are described in WO 2010/001251 and Rovers et al. (Cancer Immunol Immunother. 2007 Mar; 56(3): 303-317), respectively.
  • the nucleic acid amplified in step a) comprises cDNA or genomic DNA prepared from lymphoid tissue of a camelid, said lymphoid tissue comprising one or more B cells, lymph nodes, spleen cells, bone marrow cells, or a combination thereof. Circulating B cells are particularly preferred.
  • Peripheral blood lymphocytes PBLs
  • PBLs can be used as a source of nucleic acid encoding VH and VL domains of conventional camelid antibodies, i.e. there is sufficient quantity of plasma cells (expressing antibodies) present in a sample of PBLs to enable direct amplification. This is advantageous because PBLs can be prepared from a whole blood sample taken from the animal (camelid).
  • tissue biopsies e.g. from spleen or lymph node
  • the sampling procedure can be repeated as often as necessary, with minimal impact on the animal.
  • a particular embodiment of this method may involve: preparing a sample containing PBLs from a camelid, preparing cDNA or genomic DNA from the PBLs and using this cDNA or genomic DNA as a template for amplification of gene segments encoding VHH, VH or VL domains of camelid anti-idiotypic antibodies.
  • the lymphoid tissue e.g. circulating B cells
  • total RNA or mRNA
  • can be prepared from the lymphoid tissue sample e.g. peripheral blood cells or tissue biopsy
  • genomic DNA as a starting material.
  • This aspect of the invention encompasses both a diverse library approach, and a B cell selection approach for construction of the library.
  • a diverse library approach repertoires of VHH, VH and VL-encoding gene segments may be amplified from nucleic acid prepared from lymphoid tissue without any prior selection of B cells.
  • B cells displaying antibodies with desired antigen-binding
  • characteristics may be selected, prior to nucleic acid extraction and amplification of
  • VHH, VH and VL-encoding gene segments are VHH, VH and VL-encoding gene segments.
  • the invention provides a method of producing a library of expression vectors encoding anti- idiotypic camelid antibodies, said method comprising the steps:
  • each gene segment comprising a sequence of nucleotides encoding a VHH domain, a sequence of nucleotide encoding a VH domain or a sequence of nucleotides encoding a VL domain of a camelid cantibody;
  • each expression vector contains a gene segment encoding a VHH domain or a gene segment encoding a VH domain and a gene segment encoding a VL domain and directs expression of an antigen binding polypeptide comprising said VH domain and said VL domain or said VHH domain, whereby a library of expression vectors is obtained characterised in that the antigen binding polypeptide specifically binds to a the binding specificity of a multispecific antibody of the invention.
  • the foregoing methods may be used to prepare libraries of camelid-encoded domains (in particular Llama and alpaca VHH, VH and VL domains), suitable for expression as functional anti-idiotypic antibodies, e.g. in the form of VHH antibodies, scFVs, Fabs or full-length antibodies.
  • Libraries of expression vectors prepared according to the foregoing process, and encoding camelid (including but not limited to Llama or alpaca) anti-idiotypic VHH, VH and VL domains also form part of the subject-matter of the present invention.
  • the invention provides a library of phage vectors encoding anti-idiotypic VHH, Fab or scFV molecules, wherein each Fab or scFV encoded in the library comprises a VH domain of a camelid conventional antibody and a VL domain of a camelid conventional antibody and each VHH molecule comprises the VHH domain of a camelid VHH antibody.
  • the present invention also provides a method of selecting an expression vector encoding an anti-idiotypic binding polypeptide immunoreactive with a binding specificity of a multispecific antibody of the invention, the method comprising steps of:
  • each vector in said library comprises a gene segment encoding a VHH domain or a gene segment encoding a VH domain and a gene segment encoding a VL domain, wherein at least one of said VHH domain, VH domain or said VL domain is from a camelid antibody, and wherein each vector in said library directs expression of an anti-idiotypic binding polypeptide comprising said VH domain and VL domain or said VHH domain;
  • Screening/selection typically involves contacting expression products encoded by clones in the library with a target binding specificity, and selecting one or more clones which encode a anti-idiotypic binding polypeptides exhibiting the desired antigen binding characteristics, i.e. binding to a target binding specificity. .
  • Phage display libraries may be selected on immobilized target binding
  • VHH or Fab format allows affinity driven selection due to its monomeric appearance and its monovalent display on phage, which is not possible for scFv (as a consequence of aggregation and multivalent display on phage) and IgG (bivalent format).
  • Two to three rounds of selections are typically needed to get sufficient enrichment of target specific binders.
  • Affinity driven selections can be performed by lowering the amount of target binding specificity in subsequent rounds of selection, whereas extended washes with non- biotinylated target enables the identification of binders with extremely good affinities.
  • Individual clones taken from the selection outputs may be used for small scale production of anti-idiotypic antigen-binding polypeptides (e.g. antibody fragments) using periplasmic fractions prepared from the cells or the culture supernatants, into which the fragments "leaked” from the cells.
  • Expression may be driven by an inducible promoter (e.g. the lac promoter), meaning that upon addition of the inducer (IPTG) production of the fragment is initiated.
  • IPTG inducer
  • a leader sequence ensures the transport of the fragment into the periplasm, where it is properly folded and the intramolecular disulphide bridges are formed.
  • the resulting crude protein fractions may be used in target binding assays, such as ELISA.
  • target binding assays such as ELISA.
  • phage prepared from individual clones can be used to circumvent the low expression yields of Fabs, which in general give very low binding signals.
  • VHH or Fabs present in periplasmic fractions or partially purified by IMAC on its hexahistidine tag or by protein G can be directly used in bioassays using cells, which are not sensitive to bacterial impurities; alternatively, VHH or Fabs from individual E. coli cells can be recloned in mammalian systems for the expression of Fabs or IgG and subsequently screened in bioassays.
  • the VHH, Fab or scFV encoding region may be recloned into an alternative expression platform, e.g. a bacterial expression vector (identical to the phagemid vector, but without the gene 3 necessary for display on phage), which allows larger amounts of the encoded fragment to be produced and purified.
  • an alternative expression platform e.g. a bacterial expression vector (identical to the phagemid vector, but without the gene 3 necessary for display on phage), which allows larger amounts of the encoded fragment to be produced and purified.
  • the affinity of target binding may be determined for the purified VHH, Fab, or scFV,) by surface plasmon resonance (e.g. Biacore) or via other methods, and the neutralizing potency tested using in vitro receptor - ligand binding assays and cell based assays.
  • Surface plasmon resonance e.g. Biacore
  • Families of antigen-binding, and especially antagonistic Fabs (or scFVs) may be identified on the basis of sequence analysis (mainly of VHH or VH, in particular the length and amino acid sequence of CDR3 of the VH domain).
  • Preferred anti-idiotypic (AI) antibodies of the invention recognize their specific idiotype only when the properly paired VH and VL are present, and not when VH of the first binding site (VH1) is mispaired with the VL of the second antigen binding site (VL2) or when the VH of the second antigen binding site (VH2) is mispaired with the VL of the first binding site (VL1) (see Figure 4).
  • counter selection and screening with purified antibodies containing the enforced wrong combinations of VH and VL can be used to identify the anti-idiotypic antibodies with the desired specificity profile.
  • a counter selection method may be employed to select for VHH from the library that recognize only the properly paired combination (HC1/LC1 or HC2/LC2) and not the product of mispairing (HC1/VL2 or HC2/VL1).
  • Selection of phage directly coated with the desired HC 1 /VL 1 HC2/VL2 may be performed in the presence of excess antibodies from naive (non-immunized) animal (e.g. camelid or man) present in the serum and/or excess of mispaired antibodies.
  • the mispaired antibodies are produced by transfection of HEK cells with the HC and LC of non-paired antibodies (HC1+LC2 or HC2/LC1).
  • chains from a third unrelated antibody ( HC3 and LC3) can be used to form the mispaired antibody
  • bispecific antibodies of the invention can also be derived from art-recognized monospecific therapeutic antibodies and purified with anti-idiotypic antibodies or antibody derived fragments using the procedures described herein.
  • HGF-dependent and HGF independent cancers that can be treated with the antibodies of the invention include, but are not limited to gastric carcinomas, oesophageal carcinomas, medulloblastomas, liver metastases from colon carcinoma, papillary renal carcinomas, head and neck squamous cell carcinomas, thyroid, ovarian, pancreatic, prostate, renal- cell, hepatocellular, breast and colorectal carcinomas, glioblastomas, rhabdomyosarcomas and osteosarcomas.
  • treating means slowing, interrupting, arresting, controlling, stopping, reducing severity of a symptom, disorder, condition or disease, but does not necessarily involve a total elimination of all disease-related symptoms, conditions or disorders.
  • the antibodies described herein may be administered to a human subject in need of treatment in an "effective amount".
  • effective amount refers to the amount or dose of an antibody which, upon single or multiple dose administration to a human patient, provides therapeutic efficacy in the treatment of disease.
  • Therapeutically effective amounts of the antibody can comprise an amount in the range of from about 0.1 mg/kg to about 20 mg/kg per single dose.
  • a therapeutic effective amount for any individual patient can be determined by the healthcare professional by monitoring the effect of the antibody on a biomarker, such as cell surface of the target antigen (e.g., c-Met) in tumour tissues, or a symptom such as tumour regression, etc.
  • the amount of antibody administered at any given time point may be varied so that optimal amounts of antibody, whether employed alone or in combination with any other therapeutic agent, are administered during the course of treatment.
  • compositions comprising such antibodies, in combination with any other cancer treatment, as a combination therapy.
  • pharmaceutical compositions comprising such antibodies, in combination with any other cancer treatment, as a combination therapy.
  • compositions containing one or a combination of c-Met antibodies of the invention, or antigen- binding fragments thereof, formulated with one or more a pharmaceutically acceptable carriers or excipients.
  • Such compositions may include one or a combination of (e.g., two or more different) c- Met antibodies,.
  • a pharmaceutical composition of the invention can comprise a combination of antibodies that bind to different epitopes on human c-Met, e.g. an antibody binding to the SEMA domain of human c-Met combined with an antibody which binds within the IPT domain of human c-Met.
  • Techniques for formulating monoclonal antibodies for human therapeutic use are well known in the art and are reviewed, for example, in Wang et al., Journal of
  • bispecific antibodies of the invention a panel of monoclonal, camelid-derived, anti-c-MET antibodies having paired ⁇ /VH or VK/VH binding sites that recognize different domains of the c-Met target (see Table 11), were utilized.
  • Plasmid encoding antibodies with ⁇ /VH and VK/VH binding sites were mixed in the following ratios:
  • HEK293E cells 50 ml HEK293E cells were transfected with a total of 25 ⁇ g plasmid mixture and the mAbs were produced for 6 days prior to mAb purification with Protein A beads. After purification a mix of the parental mAbs and the specific mAbs were obtained.
  • SEMA-PSI was coated and after blocking with casein, the mAbs were added (samples 1- 6) in dilutions as well as controls of the parental mAbs. After 1 h incubation and washing, either mouse anti-human CK or HRP conjugated goat anti-human Fc was added and incubated for another hour. The mouse anti-human CK was detected with a HRP conjugated donkey anti-mouse antibody. In this way all combinations of functional mAbs binding the SEMA-PSI (parental and bispecific) were detected with the goat anti- human-Fc antibody ( Figure 22), whereas the bispecific mAbs bind with a first arm
  • Bispecific mAbs were produced by mixing 36C4 either with 38H10 or 40B8 plasmids for transfection as can be seen in Figure 23, where the ⁇ /VH binding site of 36C4 is binding to the SEMA-PSI domain and the VK/VH binding site of 38H 10 or 40B8 is binding to the IPT domain. These antibodies were detected with the anti-human CK antibody which binds to a CK domain fused to the VK domain of the VK/VH binding site. No binding was observed for the monospecific 40B8 or 38H10 parental mAbs or for the secondary antibodies, thereby validating the assay for demonstrating bispecific binding.
  • bispecific antibodies were produced from 20F1:38H10 and 20F1:40B8 mixes at lower levels, these could also be detected in the bispecificity ELISA.
  • Example 2 Expression and Purification of Camelid-derived, Bispecific cMET Antibodies using Lambda / Kappa Select Process
  • a three step column purification process was employed. First, antibodies were purified on a ProtA sepharose column to select for only properly assembled Mabs, containing two heavy and two light chains. A purified antibody fraction was then further purified, first on Lambda-Select beads and then Kappa-Select (BAC BV) beads, in thereby separating the parental Mabs from the bispecific Mabs.
  • BAC BV Kappa-Select
  • VHVL36C4 VHVK40B8 plasmid ratio 1: 1: 1: 1
  • Cultures of HEK293E cells were transfected with mixtures of plasmid encoding HC and LC of 36C4 and 38H10/40B8, respectively, or with the enforced wrong combinations of VH and VL of these mAbs. Following transfection, the culture supernatants were harvested and purified on protein A sepharose beads. Subsequently the antibody preparation was further purified on Lambda-Select beads or Kappa-Select beads for the cultures expressing the enforced wrong combinations of VH and VL (transfection 1 to 4), while the antibody fractions for the bispecific antibodies
  • Examples 1 and 2 describe the generation of bispecific constructs containing both camelid-derived VH/VK and VH/ ⁇ binding sites recognizing different domains (SEMA versus IPT) of the cMET receptor.
  • Transfection of HEK293 cells was performed with mixes of plasmids encoding VH and VL of two cMet antibodies and several combinations of SIMPLE antibodies were generated. The presence of bispecific antibodies in the culture supernatants of the transfected cells was
  • the target antigens for this example were two llama-derived monoclonal antibodies (AB 1 and AB2) which specifically bind to a human cytokine. These monoclonal antibodies comprise llama-derived Fab regions (denoted 68F2 and 61H7) formatted with the constant regions (Fc) of a human antibody.
  • 129D3 is a variant derived from 68F2 by the introduction of 13 amino acid substitutions within the framework regions, in order to increase the overall sequence identity up to 95.2% with the closest human germline.
  • 129D3 and 68F2 exhibit the same binding specificity for the target human antigen.
  • the total amino acid sequence identity between 129D3 and 68F2 (across both VH and VL) is 94%.
  • Anti-idiotype Fabs (or mAbs) which bind specifically to AB 1 and AB2 were raised to facilitate purification of bispecific antibodies.
  • the antibodies were first engineered to replace the human constant regions with the constant regions of llama IgGl, ie conventional antibody type in llamas.
  • This technical feature drives the immune response towards V regions and not against the llama Fc, ensuring that the immune response of the llama is focused against the specific CDRs (the idiotype) of AB 1 and AB2 and not against the constant regions of the antibodies.
  • monoclonal antibodies containing the Fc of llama IgGl will exhibit a long half-life in the llama following immunisation, meaning the immunogen is around for a long time helping the immune system to mount a response.
  • Sequences of llama IgGl (heavy chain) and llama CKappa and CLambda are given in PCT publication WO 2011/001251, which is incorporated by reference herein.
  • Llamas received antigen (target mAbs) by injecting intramuscularly in the neck during 6 weeks on once-a-week basis. Antigen was aliquoted in 500 ⁇ fractions for the weekly injection for a single llama. 500 ⁇ contained 100 ⁇ g antigen for the first two weeks. The remaining four weeks each injection contained 50 ⁇ g antigen/500 ⁇ .
  • the antigen was buffered in PBS (phosphate buffered saline). Before injection the antigen was mixed with Incomplete Freund's Adjuvant (IFA). IFA consists of paraffin and mannide mono-oleate. It enhances the lifetime of antigens and enhances transport to critical sites of the immune system. This amplifies the immune response.
  • IFA Incomplete Freund's Adjuvant
  • Peripheral blood lymphocytes were purified by centrifuging on a
  • RNA was converted into random primed cDNA using reverse transcriptase and gene sequences encoding for the variable domain of heavy chain only antibodies
  • VHH VHH
  • the libraries were used to select phages that bind to the different human mAbs using phage-display.
  • the VHH libraries (plasmids) were transformed in bacteria which subsequently were infected with VCSM13 helper phage.
  • the E coli cells produced and secreted phages which displayed a single copy of the VHH fragment encoded by the phagemid genome present in the infected bacterium.
  • the phages were purified from the bacteria using the PEG precipitation method. These phages were used for selections.
  • the mAbs were directly coated at the concentrations of 5 ⁇ g. 0.5 ⁇ g and 0.05 ⁇ g /ml. Selection was performed in the presence of 20% human serum. The outputs of the highest coating concentration were used for the amplification of the rescued phages before using them in a 2 nd round selection under the same conditions, as in the 1 st round, except for the lower mAb concentrations used for the coating (2 ⁇ g /ml, 0.2 ⁇ g /ml and 0.02 ⁇ g /ml).
  • Selection method 1 a method based on counter selection using human serum:
  • the counter selection against human serum is intended to remove from the library VHH that recognize common epitopes on human antibodies.
  • Phage prepared from the library and purified by PEG precipitation was diluted tenfold in 20% normal human serum (containing approximately 3 mg/ml IgGl) / PBS and incubated 30 minutes in a head-over-head rotator prior to transfer of 100 ⁇ of this mixture to wells coated with the antigen whose variable domains have been fused to human constant domains.
  • Selection method 2 a method based on counter selection using human serum and a non-relevant isotypic human monoclonal antibody:
  • a third counter selection method was employed to select for VHH from the library that recognize only the properly paired combination (HC1/LC1 or HC2/LC2) and not the product of mispairing (HC1/VL2 or HC2/VL1). Selection on directly coated 68F2 (HC1/VL1) or 36C4 (HC2/VL2) was done with phage in the presence of excess mispaired antibodies.
  • the mispaired antibodies are produced by transfection of HEK cells with the HC and LC of non-paired antibodies (HC1+LC2 or HC2/LC1). Alternatively another HC3 and LC3 can be used to form the mispaired antibody (HC1+LC3 or
  • mispaired antibodies are purified as conventional antibodies using Protein A binding.
  • VHH families (fam.1 through fam.4) for mAb 68F2 and fam.A through fam.G and some additional orphan sequences for mAb 61H7.
  • VHH representative of the different families were subcloned into the expression plasmid pMEK222, resulting in the addition of a FLAG and a HIS tags at the C terminus of the VHH.
  • the binding specificity of the different VHH was analyzed with ELISA using periplasmic fractions and all of the clones were found to be highly specific.
  • the sequences of all 70 clones from MP-QVQ23 are provided in Figure 7. All the VHH selected in the presence of mismatch counter selection belong to one of the 4 sequence families of anti-mAb 68F2 found during selection without any mismatch counter selection.
  • VHH Based on binding characteristics, a subset of VHH were selected for coupling to sepharose beads:
  • Anti-mAB 68F2 9D3, 9G9, 9A10, 12F6 and 12C11, and
  • VHH were subcloned into pMEK222 to produce VHH extended with a FLAG and HIS tags at the C terminus.
  • the affinity and specificity of the VHH were tested with ELISA in a dose response manner on both cognate mAb and irrelevant mAb.
  • All VHH selected against mAb 68F2 were found to be highly specific.
  • Example 4 - Generation anti-idiotype VHH antibodies to llama anti-human cMET antibodies
  • the target antigens for this example were two llama-derived monoclonal antibodies (AB3 and AB4) which specifically bind to a human cMET. These monoclonal antibodies comprise llama-derived Fab regions (denoted 48A2 and 36C4) formatted with the constant regions (Fc) of a human antibody. These antibodies were employed as antigens in the active immunization of llama and VHH libraries were constructed from the cDNA of immunized llamas using the procedure described in Example 3.2 above.
  • Phage display was used to select phages binding to the mAbs 48A2 and 36C4 from both libraries separately in 2 rounds of selection. 94 clones were picked from the second round selection from a first library resulting in MP-QVQ19, and 94 clones were picked from a second library resulting MP-QVQ20. 47 clones were picked from selection on mAb 36C4 and 47 clones were picked from selection on mAb 48A2. Binding of the VHH to the different mAbs was tested and periplasmic samples were used for the characterization instead of phages. Bound VHH were detected through the Myc-tag present at the C terminus of VHH produced by the phagemid.
  • VHH with high specificity and good binding affinity against mAb 48A2 or mAb 36C4 were selected from both libraries.
  • VHH sequences selected from Library 1 and 2 are provided in Figures 8 and 9, respectively.
  • VHH specific to mAb 48A2 also bound to the germlined version of that mAb (mAb 56F3) while VHH specific to mAb 36C4 also bound to its germlined version (mAb 53E3).
  • VHH against anti-cMET mAbs were also conducted in the presence of mismatched Abs using counter- selection method 3.
  • mAb 36C4 was coated at 5, 0.5 and 0.05 ⁇ g/ml and phages were added to the wells in the presence of 50 ⁇ g/ml mismatches (HC36C4/LC24 and HC103/LC36C4).
  • mAb 48A2 was coated at 5, 0.5 and 0.05 ⁇ g/ml and phages were added to the wells in the presence of 50 ⁇ g/ml mismatches (HC68F2/LC48A2 and HC48A2/LC68F2).
  • 2 nd round selection For the 2 nd round selection 2, 0.2 and 0.02 ⁇ g/ml were coated and phages were added in the presence of 20 ⁇ g/ml mismatches (as for the 1 st round). 2 nd round selection was also performed with the phages selected in the absence of mismatch counter selection in the 1 st round.
  • ELISA using periplasmic fractions was used to study binding specificity of the selected VHH.
  • the binding specificity of the different clones was tested on mAb 36C4 and its germlined mAb (mAb 52E3) and found to bind both forms with equal specificity.
  • the binding specificity of the different clones was tested on mAb 48A2 and its germlined mAb (mAb 56F2). VHHs were found to bind both mAbs with the same specificities.
  • Anti-mAB 36C4 21D4, 21A9, 21F5, and 21H4.
  • VHH 21D4 was found to bind both mAb 36C4 and mAb 48A2.
  • VHH 21F5 and 21H4 appeared to show specificity to mAb 48A2.
  • VHH 21A9 is the only VHH that did not bind mAb 48A2, but is binding to mAb36C4.
  • VHH 21A9 showed some binding to germ line mAb 53E2.
  • Both VHH 22F11 and VHH 22B2 showed good binding to mAb 48 A2 and germ line mAb 56F3.
  • VHH 22B2 showed minor binding to the
  • VHH 12C11 (anti-mAb 68F2); VHH 22F11 (anti-mAb 48A2) and VHH 21A9 (anti-mAb 36C4) were selected for the preparation of affinity purification columns.
  • VHH 12C11 about 2.5 mg VHH 12C11, 8.5 mg VHH 22F11 and 7.6 mg VHH 21A9 were coupled to 1ml sepharose beads. The coupling was efficient. Almost no VHH was detected in the unbound fractions of VHH 12C11 and small amount was found in the unbound fraction of the two other VHHs.
  • a bispecific antibody having anti-cMet and anti-cytokine binding specificities was generated by transfecting host cells with a mix of expression vectors encoding the anti- cytokine antibody 68F2 and the anti-cMET antibody 48 A2. 10 mg of the 68F2/48A2 bispecific antibody sample was injected on a VHH 22F11 (anti-niAb 48A2)
  • Bound mAbs were eluted with 20mM citrate buffer (pH 3.0) containing 150 mM NaCl and neutralized with lOOmM potassium buffer. The eluate was then injected on a VHH 12C11 (anti-niAb 68F2) functionalized column. Bound bispecific mAb was again eluted and neutralized and the different fractions obtained during purification of the bispecific mAb were analyzed using SDS-PAGE.
  • Figure 18 depicts a mass spectrogram illustrating that two preparations of an exemplary cMET BsAbs (68F2/48A2) have mass that is intermediate to that of their parental monospecific cMET (48A2) and anti-cytokine (68F2) antibodies. This data further confirms the purity of the bispecific antibody, e.g. there is no parental antibody present after the two-step purification. .
  • the functionality of the purified bispecific antibody was further confirmed by SPR (Biacore). For this experiment limited amount of cytokine was coated onto a CM5 chip. The bispecific 68F2/48A2 was then injected to bind to the cytokine (900RU, Figure 19B). After injection of the bispecific antibody, cMet was injected and also captured by the bispecific antibody. The difference in binding (900RU for the bsAb and 620RU for cMet) is similar to what is expected when considering the difference in mass between the BsAb ( ⁇ 150kDa) and the cMet (-HOkDA). This demonstrates that the BsAb represents nearly 100% of the total antibody present. 5.3. - Purification of Bispecific Antibody with 2 anti-cMET Binding
  • a bispecific antibody having two different anti-cMet binding specificities was generated by transfecting host cells with a mix of expression vectors encoding the anti- cMET antibodies 36C4 and 48 A2. 10 mg of the 36C4/48A2 bispecific antibody sample was injected on an VHH 22F11 (anti-mAb 48A2) functionalized column. Bound mAbs were eluted with citrate buffer and neutralized with potassium phosphate before injection on a VHH 21A9 (anti-Mab 36C4) -functionalized column. Bound bispecific mAb were eluted and subsequently neutralized. Function of the eluted mAbs was analyzed with ELISA and Biacore.
  • cMET chimera LS5 which contains a mAb 48A2 epitope
  • chimera LP6 which contains the mAb 36C4 epitope
  • bound chimera LP6 was detected using the unique myc-tag using an anti-myc tag antibody and a secondary antibody coupled to HRP.
  • 36C4/48A2 bispecific mAbs and not in the presence of the parental mAb 48A2 or 36C4.
  • the two different 36C4/48A2 bispecific mAbs were obtained by reversing the order of the two chromatography steps on the VHH columns.
  • Figure 16 shows a SDS-PAGE gel stained with Coomassie illustrating the successful purification of desired bispecific anti-cMET antibodies (Bi2 and Bi3) obtained by successive two-step purification on columns with anti-idiotypic VHH antibody fragments. Two light chain bands (equimolar amounts) are visible for Bi2 and Bi3, but only one light chain band is observed for the monospecific bivalent parental antibodies (36C4#9 and 48A2#9).
  • Figure 17 depicts a mass spectrogram illustrating that two preparations of an exemplary cMET BsAb (36C4/48A2) have mass that is intermediate to that of their parental monospecific cMET and ant-cytokine antibodies.
  • This data further confirms the purity of the bispecific antibody, e.g. there is no parental antibody present after the two- step purification.
  • the functionality of the purified bispecific antibody was further confirmed by SPR (Biacore).
  • SPR Biacore
  • the first chimera (cMet chimera 1) contains the llama cMet SEMA domain fused to the human cMet PSI-IPT domains.
  • cMet chimera 2 contains the human cMet SEMA domain fused to the llama cMet PSTIPT domains. Only the 36C4 Fab/mAb (and not 48A2) can bind this chimera.
  • VHH antibodies for the purification of bispecific antibodies.
  • Parental antibodies raised against a human cytokine mAbs 68F2 and 61H7
  • human cMET mAbs 48A2 and 36C4
  • VHH libraries were generated from the RNA isolated from two llamas and phage display was used to select VHH against the human version each parental antibody.
  • Selected VHH were found to discriminate between at least two mAbs recognizing the same antigen. These VHH were found to be highly specific.
  • Three such VHH were selected for application in affinity chromatography: 12C11 directed against mAb 68F2; 21A9 directed against mAb 36C4 and 22F11 directed against mAb 48 A2.
  • the VHH were produced in E. coli from an expression plasmid that fuses a FLAG and a HIS tag at the C terminus, and coupled to NHS-activated Sepharose at
  • VHH coupled Sepharose were poured into columns and used to capture the different mAbs by FPLC.
  • VHH columns were found to capture the cognate mAbs in all their forms (germlined; expressed with a human or llama Fc). Moreover, the columns were highly specific, since they discriminated between different mAb directed against the same antigen.
  • the epitope of the VHH on the mAb is probably formed by amino acid residues residing on both light and heavy chains, since exchanging of light chains to create mismatched mAbs led to loss in binding to the VHH column.
  • bispecific mAb mixes were produced: a mix transfection with the human mAbs 68F2 and 48A2, and a mix transfection with the human mAbs 48A2 and 36C4.
  • Bispecific mAb were successfully purified using two successive chromatography steps on VHH affinity columns. In all, about 600 ⁇ g of 68F2/48A2 bispecific mAb could be purified from 10 mg total IgG from the transfection mix after the successive purification on 22F11 and 12C11 VHH columns.
  • a bit less 36C4/48A2 biscpecific mAb was purified from 10 mg total IgG after successive purification on 12F11 and 21A9 columns (-400 ⁇ g), and after successive purification on 21A9 and 22F11 columns (-200 ⁇ g).
  • bispecific mAbs were found to bind both antigens in an ELISA. Bispecific mAb sample showed binding to both antigens when they were separately coated.
  • bispecific mAb was able to capture one antigen through binding to another antigen, which was coated to an ELISA plate, thereby establishing the bispecific nature of the purified mAb.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Plant Pathology (AREA)
  • Hematology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2012/071866 2011-11-03 2012-11-05 Bispecific antibodies and methods for isolating same Ceased WO2013064701A2 (en)

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201161555286P 2011-11-03 2011-11-03
US13/288,587 2011-11-03
US61/555,286 2011-11-03
US13/288,566 2011-11-03
US13/288,587 US9688773B2 (en) 2010-11-03 2011-11-03 C-Met antibody combinations
US13/288,566 US8637027B2 (en) 2010-11-03 2011-11-03 Anti c-Met antibodies
GB1212940.9A GB2504139B (en) 2012-07-20 2012-07-20 Antibodies to highly conserved targets produced by the immunisation of Camelidae species
GB1212940.9 2012-07-20

Publications (2)

Publication Number Publication Date
WO2013064701A2 true WO2013064701A2 (en) 2013-05-10
WO2013064701A3 WO2013064701A3 (en) 2013-07-18

Family

ID=46881721

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/EP2012/071866 Ceased WO2013064701A2 (en) 2011-11-03 2012-11-05 Bispecific antibodies and methods for isolating same
PCT/EP2013/065350 Ceased WO2014013075A2 (en) 2012-07-20 2013-07-19 Antibodies to highly conserved targets

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/065350 Ceased WO2014013075A2 (en) 2012-07-20 2013-07-19 Antibodies to highly conserved targets

Country Status (10)

Country Link
US (2) US20150191548A1 (OSRAM)
EP (1) EP2875048A2 (OSRAM)
JP (1) JP2015524404A (OSRAM)
CN (1) CN104520317A (OSRAM)
AU (1) AU2013291937A1 (OSRAM)
CA (1) CA2877446A1 (OSRAM)
GB (1) GB2504139B (OSRAM)
IL (1) IL236525A0 (OSRAM)
IN (1) IN2015DN00091A (OSRAM)
WO (2) WO2013064701A2 (OSRAM)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015044386A1 (en) * 2013-09-26 2015-04-02 Ablynx Nv Bispecific nanobodies
WO2016026943A1 (en) * 2014-08-20 2016-02-25 Argen-X N.V Asymmetric multispecific antibodies
WO2016156465A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptides
WO2016156475A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin b
WO2016156474A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin a
WO2016183222A1 (en) * 2015-05-12 2016-11-17 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
CN107613974A (zh) * 2015-03-16 2018-01-19 塞尔德克斯医疗公司 抗‑met抗体及其使用方法
EP2686347B1 (en) * 2011-03-16 2018-05-02 argenx BVBA Antibodies to cd70
WO2018093866A1 (en) * 2016-11-16 2018-05-24 Regeneron Pharmaceuticals, Inc. Anti-met antibodies, bispecific antigen binding molecules that bind met, and methods of use thereof
WO2019122409A1 (en) 2017-12-22 2019-06-27 Argenx Bvba Bispecific antigen binding construct
US11623952B2 (en) 2019-06-21 2023-04-11 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US11667719B2 (en) 2019-06-21 2023-06-06 Sorriso Pharmaceuticals, Inc. VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases
US11684677B2 (en) 2016-09-30 2023-06-27 Sorriso Pharmaceuticals, Inc. Compositions
US11896682B2 (en) 2019-09-16 2024-02-13 Regeneron Pharmaceuticals, Inc. Radiolabeled MET binding proteins for immuno-PET imaging and methods of use thereof
WO2024086852A1 (en) 2022-10-21 2024-04-25 Diagonal Therapeutics Inc. Heteromeric agonistic antibodies to il-18 receptor
US12030949B2 (en) 2018-02-15 2024-07-09 argenx BV Multispecific antibodies against IL-5 and IL-4R
WO2024211796A1 (en) 2023-04-07 2024-10-10 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to activin a receptor like type 1 (alk1)
WO2024211807A1 (en) 2023-04-07 2024-10-10 Diagonal Therapeutics Inc. Hinge-modified bispecific antibodies
WO2024243048A1 (en) 2023-05-19 2024-11-28 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to il12 receptor
US12173054B2 (en) 2015-03-31 2024-12-24 Sorriso Pharmaceuticals, Inc. Polypeptides
US12234279B2 (en) 2015-03-31 2025-02-25 Sorriso Pharmaceuticals, Inc. Peptide construct having a protease-cleavable linker
WO2025090519A1 (en) 2023-10-23 2025-05-01 Diagonal Therapeutics Inc. Heteromeric agonistic antibodies to il-18 receptor
WO2025213061A2 (en) 2024-04-04 2025-10-09 Ethyreal Bio, Inc. Anti-tshr antibodies and uses thereof
WO2026044000A1 (en) 2024-08-20 2026-02-26 Ethyreal Bio, Inc. Multispecific antibodies and methods of use thereof
US12570736B2 (en) 2019-06-21 2026-03-10 Sorriso Pharmaceuticals, Inc. Compositions
WO2026080748A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. Bone morphogenetic protein receptor type 2 (bmprii) antibodies
WO2026080757A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. Activin receptor type ii a/b (actriia/b) antibodies
WO2026080752A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. De novo antibodies to activin a receptor like type 1 (alk1)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10793829B2 (en) 2010-07-26 2020-10-06 Trianni, Inc. Transgenic mammals and methods of use thereof
US10662256B2 (en) 2010-07-26 2020-05-26 Trianni, Inc. Transgenic mammals and methods of use thereof
RU2580017C2 (ru) 2010-07-26 2016-04-10 Трианни, Инк. Трансгенные животные и способы применения
WO2017095939A1 (en) 2015-12-03 2017-06-08 Trianni, Inc. Enhanced immunoglobulin diversity
AU2017213633B2 (en) 2016-02-04 2023-08-03 Trianni, Inc. Enhanced production of immunoglobulins
GB201612337D0 (en) * 2016-07-15 2016-08-31 Argen-X N V Ant-il-22r antibodies
WO2018103093A1 (zh) * 2016-12-09 2018-06-14 深圳华大基因研究院 骆驼科抗体可变区免疫组库构建的引物组合及应用
US20240068004A1 (en) * 2022-08-15 2024-02-29 Mbrace Therapeutics, Inc. Cell-free methods of producing antibodies to intracellular targets

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
EP2119448A1 (en) 2008-05-14 2009-11-18 Metheresis Translational Research SA High affinity binding site of HGFR and methods for identification of antagonists thereof
WO2010001251A2 (en) 2008-07-02 2010-01-07 Argen-X B.V. Antigen binding polypeptides
US20100254989A1 (en) 2009-04-07 2010-10-07 Birgit Bossenmaier Bispecific Anti ErbB1 / Anti c Met Antibodies

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3683278B2 (ja) * 1995-12-20 2005-08-17 ザ ユニバーシティ オブ ケンタッキー リサーチ ファウンデーション マウスモノクローナル抗イディオタイプ抗体11d10およびその使用方法
EP1668035A2 (en) * 2003-09-11 2006-06-14 Critical Therapeutics, Inc. Monoclonal antibodies against hmgb1
CN101132811B (zh) * 2004-10-22 2012-05-30 米迪缪尼有限公司 抗hmgb1的高亲和力抗体及其用法
US8444976B2 (en) * 2008-07-02 2013-05-21 Argen-X B.V. Antigen binding polypeptides
SG187908A1 (en) * 2010-08-20 2013-03-28 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
EP2119448A1 (en) 2008-05-14 2009-11-18 Metheresis Translational Research SA High affinity binding site of HGFR and methods for identification of antagonists thereof
WO2010001251A2 (en) 2008-07-02 2010-01-07 Argen-X B.V. Antigen binding polypeptides
US20100254989A1 (en) 2009-04-07 2010-10-07 Birgit Bossenmaier Bispecific Anti ErbB1 / Anti c Met Antibodies

Non-Patent Citations (38)

* Cited by examiner, † Cited by third party
Title
CARON ET AL., J. EXP. MED., vol. 176, 1992, pages 1191 - 1195
CHAN; CARTER, NATURE REVIEWS: IMMUNOLOGY, vol. 10, 2010, pages 301 - 316
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIA ET AL., J. MOL. BIOL., vol. 227, 1992, pages 799 - 817
GRAHAM ET AL., J. GEN. VIROL., vol. 36, 1977, pages 59
HOLLIGER; HUDSON, NATURE BIOTECHNOL., vol. 23, 2005, pages 1126 - 36
KABAT EA ET AL.: "Sequences of Proteins of Immunological Interest.", 1991, NIH
KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616
KABAT ET AL., SEQUENCES OF PROTEIN OF IMMUNOLOGICAL INTEREST., 1991
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th Ed.", 1991, NATIONAL INSTITUTES OF HEALTH
LEFRANC ET AL., NAR, vol. 27, 1999, pages 209 - 212
LEFRANC ET AL., NAR, vol. 27, 1999, pages 209 - 212, Retrieved from the Internet <URL:http://imgt.cines.fr>
LINDHOFER ET AL., J IMMUNOL., vol. 155, 1995, pages 1246 - 1252
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MARTIN ET AL., J. MOL. BIOL., vol. 263, 1996, pages 800 - 815
MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MERCHANT ET AL., NATURE BIOTECHNOLOGY, vol. 16, 1998, pages 677 - 681
MOREA ET AL., METHODS, vol. 20, 2000, pages 267 - 279
NATSUME ET AL., DRUG DESIGN DEVELOPMENT AND THERAPY, vol. 3, 2009, pages 7 - 16
ONO ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 387 - 395
QU, CLIN. CANCER RES., vol. 5, 1999, pages 3095 - 3100
ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083
ROVERS ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 56, no. 3, March 2007 (2007-03-01), pages 303 - 317
SHOPES, B., J. IMMUNOL., vol. 148, 1992, pages 2918 - 2922
STEVENSON ET AL., ANTI-CANCER DRUG DESIGN, vol. 3, 1989, pages 219 - 230
TOMLINSON ET AL., EMBO J., vol. 14, 1995, pages 4628 - 38
TOMLINSON ET AL., EMBO J., vol. 14, 1995, pages 4628 - 4638
TRAMONTANO ET AL., J. MOL. BIOL, vol. 215, 1990, pages 175 - 182
TRAMONTANO ET AL., PROTEINS, vol. 6, 1989, pages 382 - 94
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DER NEUT, SCIENCE, vol. 317, 2007, pages 1554
VERHEESEN ET AL., BBA, vol. 1624, 2003, pages 21 - 28
WANG ET AL., JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 96, 2007, pages L-26
WILLIAMS ET AL., J. MOL. BIOL., vol. 264, 1996, pages 220 - 232
WILLIAMS ET AL., J. MOL. BIOL., vol. 264, 1996, pages 220 - 32
YAMANE-OHNUKI; SATOH, MABS 1, vol. 3, 2009, pages 230 - 236
ZAREBSKI ET AL., J MOL BIOL, vol. 349, 2005, pages 814 - 824

Cited By (57)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2686347B1 (en) * 2011-03-16 2018-05-02 argenx BVBA Antibodies to cd70
WO2015044386A1 (en) * 2013-09-26 2015-04-02 Ablynx Nv Bispecific nanobodies
WO2016026943A1 (en) * 2014-08-20 2016-02-25 Argen-X N.V Asymmetric multispecific antibodies
US11649295B2 (en) 2014-08-20 2023-05-16 argenx BV Asymmetric multispecific antibodies
US10487156B2 (en) 2014-08-20 2019-11-26 Argenx Bvba Asymmetric multispecific antibodies
US11884734B2 (en) 2015-03-16 2024-01-30 Celldex Therapeutics, Inc. Anti-MET antibodies and methods of use thereof
EP3270918A4 (en) * 2015-03-16 2018-10-24 Celldex Therapeutics, Inc. Anti-met antibodies and methods of use thereof
CN113150147A (zh) * 2015-03-16 2021-07-23 塞尔德克斯医疗公司 抗-met抗体及其使用方法
CN107613974A (zh) * 2015-03-16 2018-01-19 塞尔德克斯医疗公司 抗‑met抗体及其使用方法
US10633438B2 (en) 2015-03-31 2020-04-28 Vhsquared Limited Polypeptides
US12234279B2 (en) 2015-03-31 2025-02-25 Sorriso Pharmaceuticals, Inc. Peptide construct having a protease-cleavable linker
WO2016156474A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin a
EP4089113A1 (en) 2015-03-31 2022-11-16 Sorriso Pharmaceuticals, Inc. Polypeptides
US12173054B2 (en) 2015-03-31 2024-12-24 Sorriso Pharmaceuticals, Inc. Polypeptides
WO2016156465A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptides
WO2016156475A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin b
EP3885368A1 (en) * 2015-05-12 2021-09-29 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
US12158473B2 (en) 2015-05-12 2024-12-03 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
WO2016183222A1 (en) * 2015-05-12 2016-11-17 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
AU2016261854B2 (en) * 2015-05-12 2022-05-26 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
AU2022203033B2 (en) * 2015-05-12 2025-06-26 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
JP2022171730A (ja) * 2015-05-12 2022-11-11 リジェネロン・ファーマシューティカルズ・インコーポレイテッド 多量体タンパク質の純度の決定
US10520511B2 (en) 2015-05-12 2019-12-31 Regeneron Pharmaceuticals, Inc. Multimeric protein purity determination
US11684677B2 (en) 2016-09-30 2023-06-27 Sorriso Pharmaceuticals, Inc. Compositions
IL266599B1 (en) * 2016-11-16 2023-08-01 Regeneron Pharma Anti-met antibodies, met-binding protein binding molecules, and methods of using them
AU2017362967B2 (en) * 2016-11-16 2024-10-10 Regeneron Pharmaceuticals, Inc. Anti-MET antibodies, bispecific antigen binding molecules that bind MET, and methods of use thereof
US12545735B2 (en) 2016-11-16 2026-02-10 Regeneron Pharmaceuticals, Inc. Anti-met antibodies, bispecific antigen binding molecules that bind met, and methods of use thereof
TWI782930B (zh) * 2016-11-16 2022-11-11 美商再生元醫藥公司 抗met抗體,結合met之雙特異性抗原結合分子及其使用方法
IL266599B2 (en) * 2016-11-16 2023-12-01 Regeneron Pharma Anti-MET Antibodies, MET-Binding Insufficiency-Binding Molecules, and Methods of Using Them
JP2022044698A (ja) * 2016-11-16 2022-03-17 リジェネロン・ファーマシューティカルズ・インコーポレイテッド 抗met抗体、metに結合する二重特異性抗原結合分子およびその使用方法
WO2018093866A1 (en) * 2016-11-16 2018-05-24 Regeneron Pharmaceuticals, Inc. Anti-met antibodies, bispecific antigen binding molecules that bind met, and methods of use thereof
JP2020509027A (ja) * 2016-11-16 2020-03-26 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. 抗met抗体、metに結合する二重特異性抗原結合分子およびその使用方法
US11142578B2 (en) 2016-11-16 2021-10-12 Regeneron Pharmaceuticals, Inc. Anti-MET antibodies, bispecific antigen binding molecules that bind MET, and methods of use thereof
US12071486B2 (en) 2017-12-22 2024-08-27 argenx BV Bispecific antigen binding construct
AU2018387829B2 (en) * 2017-12-22 2024-12-19 Argenx Bvba Bispecific antigen binding construct
EP4495142A3 (en) * 2017-12-22 2025-05-07 Argenx BVBA Bispecific antigen binding construct
WO2019122409A1 (en) 2017-12-22 2019-06-27 Argenx Bvba Bispecific antigen binding construct
EP4495142A2 (en) 2017-12-22 2025-01-22 Argenx BVBA Bispecific antigen binding construct
US12030949B2 (en) 2018-02-15 2024-07-09 argenx BV Multispecific antibodies against IL-5 and IL-4R
US11623952B2 (en) 2019-06-21 2023-04-11 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US11667719B2 (en) 2019-06-21 2023-06-06 Sorriso Pharmaceuticals, Inc. VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases
US12247079B2 (en) 2019-06-21 2025-03-11 Sorriso Pharmaceuticals, Inc. Polynucleotides encoding, and method of making, a polypeptide comprising a VHH which binds interleukin-receptor (IL-7R)
US12570736B2 (en) 2019-06-21 2026-03-10 Sorriso Pharmaceuticals, Inc. Compositions
US12559552B2 (en) 2019-06-21 2026-02-24 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US12605473B2 (en) 2019-09-16 2026-04-21 Regeneron Pharmaceuticals, Inc. Methods for making radiolabeled anti-MET binding proteins
US11896682B2 (en) 2019-09-16 2024-02-13 Regeneron Pharmaceuticals, Inc. Radiolabeled MET binding proteins for immuno-PET imaging and methods of use thereof
WO2024086852A1 (en) 2022-10-21 2024-04-25 Diagonal Therapeutics Inc. Heteromeric agonistic antibodies to il-18 receptor
US12473367B2 (en) 2023-04-07 2025-11-18 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to activin a receptor like type 1 (ALK1)
WO2024211796A1 (en) 2023-04-07 2024-10-10 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to activin a receptor like type 1 (alk1)
WO2024211807A1 (en) 2023-04-07 2024-10-10 Diagonal Therapeutics Inc. Hinge-modified bispecific antibodies
WO2024243048A1 (en) 2023-05-19 2024-11-28 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to il12 receptor
WO2025090519A1 (en) 2023-10-23 2025-05-01 Diagonal Therapeutics Inc. Heteromeric agonistic antibodies to il-18 receptor
WO2025213061A2 (en) 2024-04-04 2025-10-09 Ethyreal Bio, Inc. Anti-tshr antibodies and uses thereof
WO2026044000A1 (en) 2024-08-20 2026-02-26 Ethyreal Bio, Inc. Multispecific antibodies and methods of use thereof
WO2026080748A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. Bone morphogenetic protein receptor type 2 (bmprii) antibodies
WO2026080757A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. Activin receptor type ii a/b (actriia/b) antibodies
WO2026080752A2 (en) 2024-10-09 2026-04-16 Diagonal Therapeutics Inc. De novo antibodies to activin a receptor like type 1 (alk1)

Also Published As

Publication number Publication date
IN2015DN00091A (OSRAM) 2015-05-29
WO2013064701A3 (en) 2013-07-18
EP2875048A2 (en) 2015-05-27
JP2015524404A (ja) 2015-08-24
US20150191548A1 (en) 2015-07-09
WO2014013075A2 (en) 2014-01-23
CN104520317A (zh) 2015-04-15
GB2504139A (en) 2014-01-22
WO2014013075A3 (en) 2014-12-18
CA2877446A1 (en) 2014-01-23
GB2504139B (en) 2014-12-31
IL236525A0 (en) 2015-02-26
US20180016351A1 (en) 2018-01-18
GB201212940D0 (en) 2012-09-05
AU2013291937A1 (en) 2015-01-22

Similar Documents

Publication Publication Date Title
US11649295B2 (en) Asymmetric multispecific antibodies
US9688773B2 (en) C-Met antibody combinations
DK2310413T3 (en) Camelide-derived antigen-binding polypeptides
JP2015524404A (ja) 高度に保存された標的に対するラクダ科動物由来の配列を含む抗体
US20160207996A1 (en) Antibodies to complex targets
IL295996A (en) Miniature guidance and navigation control (minignc) of antibody-like proteins and methods of production and use thereof
JP7657591B2 (ja) 二重特異性抗原結合コンストラクト
Anna et al. Anti C-met Antibodies-granted patent (Canada)
JP2025532482A (ja) Egfrを標的とする二重エピトープ四価抗体
US20260028399A1 (en) Human-like target-binding proteins
Zhu Dual-targeting bispecific antibodies as new therapeutic modalities for cancer
JP2018064561A (ja) ラクダ科動物由来の抗原結合ポリペプチド
Tchistiakova et al. Antibody Fragments and Alternate Protein Scaffolds

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12780503

Country of ref document: EP

Kind code of ref document: A2

122 Ep: pct application non-entry in european phase

Ref document number: 12780503

Country of ref document: EP

Kind code of ref document: A2