WO2013021212A2 - Novel compositions and uses thereof - Google Patents

Novel compositions and uses thereof Download PDF

Info

Publication number
WO2013021212A2
WO2013021212A2 PCT/GB2012/051955 GB2012051955W WO2013021212A2 WO 2013021212 A2 WO2013021212 A2 WO 2013021212A2 GB 2012051955 W GB2012051955 W GB 2012051955W WO 2013021212 A2 WO2013021212 A2 WO 2013021212A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
alopecia
polypeptide
composition according
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2012/051955
Other languages
English (en)
French (fr)
Other versions
WO2013021212A3 (en
Inventor
Jan Alenfall
Pontus DUNÉR
Anna HULTGÅRDH NILSSON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Follicum AB
Original Assignee
Follicum AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2844749A priority Critical patent/CA2844749C/en
Priority to PL16169698T priority patent/PL3087999T3/pl
Priority to US14/237,108 priority patent/US9381149B2/en
Priority to AU2012293448A priority patent/AU2012293448B2/en
Priority to KR1020147006108A priority patent/KR101992282B1/ko
Priority to ES12768879.4T priority patent/ES2576299T3/es
Priority to JP2014524449A priority patent/JP6049718B2/ja
Priority to DK12768879.4T priority patent/DK2741761T3/en
Priority to BR112014003051-0A priority patent/BR112014003051B1/pt
Priority to RU2014108819/10A priority patent/RU2604797C2/ru
Priority to CN201280049850.XA priority patent/CN103930125B/zh
Priority to EP16169698.4A priority patent/EP3087999B1/en
Application filed by Follicum AB filed Critical Follicum AB
Priority to HK14111213.2A priority patent/HK1197540B/en
Priority to EP12768879.4A priority patent/EP2741761B1/en
Publication of WO2013021212A2 publication Critical patent/WO2013021212A2/en
Anticipated expiration legal-status Critical
Publication of WO2013021212A3 publication Critical patent/WO2013021212A3/en
Priority to US15/184,290 priority patent/US10137169B2/en
Priority to US16/176,201 priority patent/US10517932B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0014Skin, i.e. galenical aspects of topical compositions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/14Macromolecular materials
    • A61L27/22Polypeptides or derivatives thereof, e.g. degradation products
    • A61L27/227Other specific proteins or polypeptides not covered by A61L27/222, A61L27/225 or A61L27/24
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/50Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L27/54Biologically active materials, e.g. therapeutic substances
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/50Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L27/58Materials at least partially resorbable by the body
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/50Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L27/60Materials for use in artificial skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/14Drugs for dermatological disorders for baldness or alopecia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/24Drugs for disorders of the endocrine system of the sex hormones
    • A61P5/26Androgens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q7/00Preparations for affecting hair growth
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/74Biological properties of particular ingredients
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/80Process related aspects concerning the preparation of the cosmetic composition or the storage or application thereof
    • A61K2800/91Injection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/40Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices characterised by a specific therapeutic activity or mode of action
    • A61L2300/412Tissue-regenerating or healing or proliferative agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2430/00Materials or treatment for tissue regeneration
    • A61L2430/18Materials or treatment for tissue regeneration for hair reconstruction
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2430/00Materials or treatment for tissue regeneration
    • A61L2430/34Materials or treatment for tissue regeneration for soft tissue reconstruction

Definitions

  • the present invention relates to agents for stimulating hair growth in mammals.
  • compositions comprising a modified osteopontin polypeptide, and the pharmaceutical and cosmetic use thereof for stimulating hair growth in mammals (including humans).
  • Hair growth is cyclical, occurring in three stages: anagen, the active growth phase; catagen, the degenerative phase; and telogen, the resting phase. After telogen, the old hair fibre is shed and a new hair is generated as part of the repeating cycle.
  • Alopecia or hair loss, occurs in both men and women, and is attributed to numerous causes including aging, hormone levels, stress, and chemotherapy. In these circumstances, more and more hair follicles remain in the telogen stage, resulting in a gradual decrease of the hair fibre length and diameter, finally reaching a stage of partial or complete baldness.
  • Alopecia areata Various types of hair loss are known, including alopecia areata, androgenetic alopecia, anagen effluvium, self-induced hair loss, telogen effluvium, and scarring alopecia.
  • Alopecia areata thought to be an auto-immune disorder, begins with hair loss in a rounded patch on the scalp.
  • Alopecia areata includes mild patchy hair loss on the scalp, as well the loss of all scalp hair, known as alopecia totalis, and the loss of all scalp and body hair, known as alopecia universalis.
  • Androgenetic alopecia including male and female pattern baldness, is thought to be caused by a combination of genetic predisposition, aging, and androgen hormone levels.
  • Androgenetic alopecia is associated with increased androgen stimulation, which adversely affects the hair follicles.
  • Increased androgen stimulation can be produced by, among other mechanisms, elevated levels of 5-alpha-reductase, an enzyme that converts testosterone to dihydrotestosterone.
  • Anagen effluvium is hair loss due to chemicals or radiation, such as chemotherapy or radiation treatment for cancer.
  • Self-induced hair loss includes hair loss caused by conscious or unconscious self-inflicted damage to the hair. Two common types of self-induced hair loss are trichotillomania, or hair loss that results when someone continually pulls or plucks out his own hair, and traction alopecia, which is caused by hairstyles such as ponytails or braids that continually pull at the hair.
  • Telogen effluvium is stress-related hair loss caused by events such as, for example, surgery, child birth, or pregnancy termination. Further causes of telogen effluvium include the use of oral contraceptives or other prescription drugs, thyroid abnormality, diabetes, lupus, and emotional stress. Scarring alopecia includes hair loss caused by infection and inflammation of the hair follicles, and hair loss caused by burns or other trauma. Hair loss is a widespread problem that is considered by some to be cosmetically unappealing and often causes emotional distress to the individual concerned. As a consequence, there is great demand for alopecia treatments. Many compositions have been tested for their ability to stimulate hair growth, for example, by promoting or prolonging anagen.
  • compositions include potassium channel openers, such as minoxidil (Regaine RTM., Pharmacia Corp.) and diazoxide; 5-alpha-reductase inhibitors, such as finasteride (Propecia RTM., Merck & Co.); and the immunosuppressant cyclosporin A.
  • the first aspect of the invention provides a composition for stimulating hair growth in a mammal comprising:
  • the active component of the compositions of the invention is derived from a naturally-occurring osteopontin protein (i.e. the polypeptide comprises an amino acid sequence corresponding to that of a modified, for example mutated, version of a naturally-occurring osteopontin protein).
  • Osteopontin also known as bone sialoprotein I (BSP-1 or BNSP), early T-lymphocyte activation (ETA-1), secreted phosphoprotein 1 (SPP1), 2ar and Rickettsia resistance (Ric), is a gene product which is conserved in several mammalian species.
  • the gene has seven exons, spans 5 kilobases in length and in humans it is located on the long arm of chromosome 4 region 13 (4q13).
  • the protein is composed of ⁇ 300 amino acids residues and is rich in acidic residues: 30-36% are either aspartic or glutamic acid.
  • Osteopontin has ⁇ 30 attached carbohydrate residues, including 10 sialic acid residues, which are attached to the protein during post-translational modification in the Golgi apparatus.
  • Osteopontin was first discovered as a novel sialoprotein in bone anchoring osteoclasts onto the mineralized bone matrix (Franzen & Heinegard, 1985, Biochem. J. 232(3)715- 24).
  • the name osteopontin comes from the presence of the protein in bone (osteo-) and its ability to form a bridge (-pons) between bone cells and the mineral phase.
  • Sequence analysis and subsequent structural studies showed osteopontin to be a 32 kDa glycoprotein composed of a highly acidic region of some ten aspartic acid residues thought to mediate the mineral binding properties of osteopontin.
  • osteopontin molecule there is also a cell attachment domain mediated through an R-G-D sequence (Oldberg et al., 1986, Proc. Natl. Acad. Sci. USA 83(23):8819-23).
  • Osteopontin is constitutively expressed in osteoblasts and in several epithelial cell types, resulting in osteopontin being secreted into many body fluids. Bone is the only tissue type where osteopontin is deposited and from where it can be recovered in large amounts. The expression of osteopontin can also be induced in vascular smooth muscle cells, in different cancer cell types and among inflammatory cells (specifically macrophages and T lymphocytes). Several important cellular functions have been attributed to osteopontin such as adhesion, proliferation, migration, anti-apoptosis and chemo attraction.
  • RGD cell- adhesion domain which interacts with different integrins, mainly with ⁇ 3 but also ⁇ 1 , and ⁇ 5 (for review see Scatena et al., 2007, Arterio. Thromb. Vase. Biol. 27:2302- 2309).
  • osteopontin has emerged as a potent cytokine capable of modulating several cell types involved in inflammation and immune responses.
  • the broad range of functions being attributed to osteopontin has been puzzling and cannot all be explained by the single cell-binding RGD sequence.
  • the explanation came when an eleven amino acid peptide in osteopontin R 145 -G-D-S-L-A-Y-G-L-R-S 155 (SEQ ID NO:122) (corresponding to amino acids 144 to 154 of UniProt code P10923) was identified and later functionally mapped.
  • a characterising feature of the osteopontin-derived polypeptide in the compositions of the invention is that the RGD domain naturally present in osteopontin is inactivated such that it is non-functional (at least in part).
  • inactivation of the RGD domain may prevent the osteopontin-derived polypeptide from binding to one or more of the integrins which bind the naturally occurring osteopontin protein.
  • modified osteopontin polypeptide we include polypeptides corresponding to a modified form of a naturally-occurring osteopontin protein in which the RGD domain is non-functional (at least in part), as well as fragments and variants thereof which retain a hair-stimulatory property of the 'full length' modified osteopontin.
  • the nonfunctional RGD domain of the modified osteopontin polypeptide may be unable to bind integrin ⁇ 3 (see Scatena et a/., supra).
  • the naturally-occurring osteopontin protein is mammalian, e.g. human.
  • the modified osteopontin polypeptides present in the compositions of the invention are capable of stimulating hair growth in mammals.
  • the polypeptide is capable of stimulating the growth of human hair.
  • the polypeptide is capable of stimulating the growth of hair in vivo.
  • the polypeptide is capable of stimulating the growth of hair in vivo with greater efficacy than wildtype human osteopontin.
  • greater efficacy'' in this context, we include a quicker onset of action and/or efficacy at a lower dose and/or greater maximum effect (e.g. greater number of new follicles or density of hair).
  • the polypeptide is capable of stimulating the growth of hair in vivo with a quicker onset of action and a greater maximum hair growth effect than wildtype human osteopontin at the same dose (e.g. see Example B).
  • the stimulation of hair growth may be mediated by an effect of existing hair follicles and/or by inducing the formation of new hair follicles.
  • the modified osteopontin polypeptide is capable of stimulating existing hair follicles (for example, by prolonging the anagen phase and/or by shortening the telogen phase such that the resting follicles become active).
  • the polypeptide is capable of inducing the formation of new hair follicles, or stem cells for producing the same.
  • Naturally-occurring osteopontin proteins are typically around 300 amino acids in length.
  • the modified osteopontin polypeptides present in the compositions of the invention may vary from this length.
  • the polypeptide is fewer than 500 amino acids in length, for example fewer than 400, 350, 340, 330, 320, 310, 300, 290, 280, 270, 260, 250, 200, 150, 100, 50, 40, 30, 20, 15, 10 or fewer amino acids in length.
  • the polypeptide is between 250 and 350 amino acids in length, for example between 280 and 300 amino acids in length (e.g. 293 amino acids in length).
  • the polypeptide is between 10 and 20 amino acids in length, for example between 12 and 18 amino acids in length ⁇ e.g. 15 amino acids in length).
  • modified osteopontin polypeptides lack the active tri-peptide sequence "arginine-glycine-aspartic acid" normally found in naturally-occurring osteopontin proteins. It will be appreciated that this RGD domain may be inactivated by a number of different strategies.
  • the RGD domain is mutated at one or more amino acids in the modified osteopontin polypeptide, such that it contains one or more deletions, substitutions and/or additions, or combinations thereof, relative to a naturally-occurring osteopontin protein.
  • the RGD domain may be deleted, at least in part, such that the arginine and/or glycine and/or aspartic acid residue is absent.
  • the RGD domain may be substituted at one or more amino acids.
  • the arginine and/or glycine and/or aspartic acid residue may be substituted with another amino acid. Such substitutions may be conservative or non- conservative.
  • the RGD domain may be inactivated by a combination of substitutions and deletions, including: (a) substitution of the arginine residue and deletion of the glycine and aspartic acid residues;
  • substitution of the arginine and glycine residues and deletion of the aspartic acid residue for example, the -RGD- tripeptide can be replaced with the dipeptide sequence -DI-);
  • the tripeptide -RGD- sequence is replaced by the dipeptide -Dl- sequence.
  • inactivation of the RGD sequence may result in a conformational change in the osteopontin polypeptide (relative to the corresponding naturally-occurring osteopontin protein), which leads to the creation/exposure of a new site to the surrounding milieu.
  • the modified osteopontin polypeptide comprises or consists of the amino acid sequence of SEQ ID NO:1 (in which the region encompassing the inactivated RGD domain is underlined):
  • SEQ ID NO: 1 or a fragment, variant, derivative or fusion thereof (or a fusion of said fragment, variant or derivative) which retains (at least in part) a hair growth stimulatory activity of the amino acid sequence of SEQ ID NO:1.
  • 'amino acid' as used herein includes the standard twenty genetically-encoded amino acids and their corresponding stereoisomers in the 'D' form (as compared to the natural 'L' form), omega-amino acids and other naturally-occurring amino acids, unconventional amino acids (e.g., ⁇ , ⁇ -disubstituted amino acids, N-alkyl amino acids, etc.) and chemically derivatised amino acids (see below).
  • each encoded amino acid residue is represented by a single letter designation, corresponding to the trivial name of the conventional amino acid.
  • the amino acid sequences disclosed herein are provided in the N-terminus to C-terminus direction.
  • the modified osteopontin polypeptides used in the compositions of the invention comprise or consist of L-amino acids.
  • the polypeptide may comprise or consist of a fragment of the amino acid sequence of SEQ ID NO: 1 , or a variant thereof.
  • fragment we include at least 6 contiguous amino acids of the amino acid sequence of SEQ ID NO: 1 , for example at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 100, 150, 200, 210, 220, 230, 240, 250, 255, 260, 265, 270, 275, 280, 285, 286, 287, 288, 289 290, 291 or 292 contiguous amino acids of SEQ ID NO: 1.
  • the fragment comprises or consists of the inactivated RGD domain sequence of SEQ ID NO:2, namely:
  • the fragment may comprise or consist of an amino acid sequence according to any one SEQ ID NOs: 5 to 62.
  • the polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 5.
  • the polypeptide comprises or consists of a variant of the amino acid sequence of SEQ ID NO: 1 , or of a fragment thereof.
  • polypeptide does not share 100% amino acid sequence identity with SEQ ID NO: 1 , i.e. one or more amino acids of SEQ ID NO: 1 must be mutated.
  • the polypeptide may comprise or consist of an amino acid sequence with at least 50% identity to the amino acid sequence of SEQ ID NO: 1 , more preferably at least 60%, 70% or 80% or 85% or 90% identity to said sequence, and most preferably at least 95%, 96%, 97%, 98% or 99% identity to said amino acid sequence.
  • Percent identity can be determined by methods well known in the art, for example using the LALIGN program (Huang and Miller, Adv. Appl. Math. (1991) 12:337-357) at the Expasy facility site (http://www.ch.embnet.org/software/l-ALIGN form.html) using as parameters the global alignment option, scoring matrix BLOSUM62, opening gap penalty -14, extending gap penalty -A.
  • the percent sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
  • mutated we mean that the amino acid at the specified position is altered compared to the amino acid in the polypeptide according to SEQ ID NO: 1.
  • an amino acid at a specified position may be deleted, substituted or may be the site of an insertion/addition of one or more amino acids. It will be appreciated by persons skilled in the art that the substitutions may be conservative or non-conservative.
  • the amino acid at a specified position may be chemically modified (derivatised); see below.
  • the variant polypeptide comprises or consists of an amino acid sequence of SEQ ID NO: 1 , or a fragment thereof, in which one or more amino acids is conservatively substituted.
  • conservatively substituted we mean a substitution of one amino acid with another with similar properties (size, hydrophobicity, etc), such that the function of the polypeptide is not significantly altered.
  • conservative substitutions is intended combinations such as Gly, Ala; Val, lie, Leu; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr.
  • the variant comprises or consists of the inactivated RGD domain sequence of SEQ ID NO:2, namely: DISLAYGLRS SEQ ID NO: 2
  • the variant polypeptide may also comprise one or more additional amino acids, inserted at the N- and/or C-terminus and/or internally within the amino acid sequence of SEQ ID NO:1.
  • the polypeptide may comprise or consist of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or 20 additional amino acids at the N- and/or C-terminus and/or internally.
  • the variant polypeptide is non-naturally occurring.
  • the modified osteopontin polypeptide is a species homologue of the amino acid sequence of SEQ ID NO: 1.
  • the polypeptide may comprise or consist of the amino acid sequence of a modified human osteopontin protein, or fragment thereof, in which an RGD domain is inactivated.
  • Suitable human osteopontin protein sequences are well known in the art, for example see Database Accession Nos. AAA59974.1 , AAC28619.1 , AAA86886.1.
  • the modified osteopontin polypeptide may comprise or consist of the amino acid sequence of SEQ ID NO:3 (in which the region encompassing the inactivated RGD domain is underlined) MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVAT LNPDPSQKQNLLAPQTLPSKSNESH DHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVV PTVDTYDGDISVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDS RGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLW DPKSKEEDKHLKFRISHELDSASSEVN SEQ ID NO: 3 or a fragment, variant, derivative or fusion thereof (or a fusion of said fragment, variant or derivative) which retains the
  • the fragment or variant comprises or consists of the inactivated RGD domain sequence of SEQ ID NO:4, namely:
  • the fragment or variant may comprise or consist of an amino acid sequence according to any one SEQ ID NOs: 63 to 120 (as detailed below).
  • the polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 63.
  • the modified osteopontin polypeptide comprises or consists of a derivative of the amino acid sequence of SEQ ID NO: 1 or 3, or of a fragment, variant or fusion thereof.
  • the derivative comprises the inactivated RGD domain sequence of SEQ ID NO:3 or 4.
  • the polypeptide may comprise or consist of a derivative of the amino acid sequence of SEQ ID NO: 5 or 63
  • Chemical derivatives of one or more amino acids may be achieved by reaction with a functional side group.
  • derivatised molecules include, for example, those molecules in which free amino groups have been derivatised to form amine hydrochlorides, p-toluene sulphonyl groups, carboxybenzoxy groups, i-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
  • Free carboxyl groups may be derivatised to form salts, methyl and ethyl esters or other types of esters and hydrazides.
  • Free hydroxyl groups may be derivatised to form O-acyl or O-alkyI derivatives.
  • Also included as chemical derivatives are those peptides which contain naturally occurring amino acid derivatives of the twenty standard amino acids.
  • 4-hydroxyproline may be substituted for proline
  • 5-hydroxylysine may be substituted for lysine
  • 3-methylhistidine may be substituted for histidine
  • homoserine may be substituted for serine and ornithine for lysine.
  • Derivatives also include peptides containing one or more additions or deletions as long as the requisite activity is maintained.
  • Other included modifications are amidation, amino terminal acylation (e.g. acetylation or thioglycolic acid amidation), terminal carboxylamidation (e.g. with ammonia or methylamine), and the like terminal modifications.
  • peptidomimetic compounds may also be useful, which mimic the conformation and desirable features of the modified osteopontin polypeptides detailed above.
  • 'polypeptide' we include peptidomimetic compounds which have the hair growth stimulatory activity of the polypeptide of SEQ ID NO: 1.
  • the polypeptides of the invention include not only molecules in which amino acid residues are joined by peptide (-CO-NH-) linkages but also molecules in which the peptide bond is reversed.
  • retro-inverso peptidomimetics may be made using methods known in the art, for example such as those described in Meziere et al. (1997) J. Immunol. 159, 3230-3237, which is incorporated herein by reference. This approach involves making pseudopeptides containing changes involving the backbone, and not the orientation of side chains. Retro-inverse peptides, which contain NH-CO bonds instead of CO-NH peptide bonds, are much more resistant to proteolysis.
  • the polypeptide of the invention may be a peptidomimetic compound wherein one or more of the amino acid residues are linked by a -y(CH 2 NH)- bond in place of the conventional amide linkage.
  • the peptide bond may be dispensed with altogether provided that an appropriate linker moiety which retains the spacing between the carbon atoms of the amino acid residues is used; it may be advantageous for the linker moiety to have substantially the same charge distribution and substantially the same planarity as a peptide bond.
  • polypeptide may conveniently be blocked at its N- or C- terminus so as to help reduce susceptibility to exoproteolytic digestion.
  • a presumed bioactive conformation may be stabilised by a covalent modification, such as cyclisation or by incorporation of lactam or other types of bridges, for example see Veber et a/., 1978, Proc. Natl. Acad. Sci. USA 75:2636 and Thursell et a/., 1983, Biochem. Biophys. Res. Comm. 111:166, which are incorporated herein by reference.
  • exemplary polypeptides of the invention comprise terminal cysteine amino acids.
  • Such a polypeptide may exist in a heterodetic cyclic form by disulphide bond formation of the mercaptide groups in the terminal cysteine amino acids or in a homodetic form by amide peptide bond formation between the terminal amino acids.
  • cyclising small peptides through disulphide or amide bonds between the N- and C- terminal region cysteines may circumvent problems of specificity and half-life sometime observed with linear peptides, by decreasing proteolysis and also increasing the rigidity of the structure, which may yield higher specificity compounds.
  • Polypeptides cyclised by disulphide bonds have free amino and carboxy-termini which still may be susceptible to proteolytic degradation, while peptides cyclised by formation of an amide bond between the N-terminal amine and C-terminal carboxyl and hence no longer contain free amino or carboxy termini.
  • the peptides of the present invention can be linked either by a C- N linkage or a disulphide linkage.
  • heterodetic linkages may include, but are not limited to formation via disulphide, alkylene or sulphide bridges.
  • Methods of synthesis of cyclic homodetic peptides and cyclic heterodetic peptides, including disulphide, sulphide and alkylene bridges, are disclosed in US 5,643,872, which is incorporated herein by reference.
  • Other examples of cyclisation methods includes cyclization through click chemistry, epoxides, aldehyde-amine reactions, as well as and the methods disclosed in US 6,008,058, which is incorporated herein by reference.
  • Such terminal modifications are useful, as is well known, to reduce susceptibility by proteinase digestion and therefore to prolong the half-life of the peptides in solutions, particularly in biological fluids where proteases may be present.
  • Polypeptide cyclisation is also a useful modification because of the stable structures formed by cyclisation and in view of the biological activities observed for cyclic peptides.
  • polypeptide of the first aspect of the invention is cyclic.
  • polypeptide is linear.
  • the modified osteopontin polypeptide comprises one or more amino acids modified or derivatised by PEGylation, amidation, esterification, acylation, acetylation and/or alkylation.
  • the modified osteopontin polypeptide may be glycosylated at one or more amino acids.
  • the polypeptide may retain one or more of the glycosylation sites of the corresponding ('parent') osteopontin protein, to which may be attached a carbohydrate group.
  • the modified osteopontin polypeptide comprises or consists of a fusion of the amino acid sequence of SEQ ID NO: 1 or 3, or of a fragment or variant thereof.
  • polypeptide may comprise a fusion of the amino acid sequence of SEQ ID NO: 5 or 63
  • polypeptide By 'fusion' of a polypeptide we include an amino acid sequence corresponding to SEQ ID NO: 1 or 3 (or a fragment or variant thereof) fused to any other polypeptide.
  • the said polypeptide may be fused to a polypeptide such as glutathione-S- transferase (GST) or protein A in order to facilitate purification of said polypeptide. Examples of such fusions are well known to those skilled in the art.
  • GST glutathione-S- transferase
  • the said polypeptide may be fused to an oligo-histidine tag such as His6 or to an epitope recognised by an antibody such as the well-known Myc tag epitope. Fusions to any variant or derivative of said polypeptide are also included in the scope of the invention.
  • the fusion may comprise a further portion which confers a desirable feature on the said polypeptide of the invention; for example, the portion may be useful in augmenting or prolonging the hair growth stimulatory effect.
  • the fusion comprises human serum albumin or similar protein (as disclosed in US 2009/0005312, the disclosures of which are incorporated herein by reference).
  • the fused portion may be a lipophilic molecule or polypeptide domain that is capable of promoting cellular uptake of the polypeptide, as known to those skilled in the art.
  • the modified osteopontin polypeptide comprises or consists of tandem repeats of an amino acid sequence.
  • the polypeptide may comprise or consist of tandem repeats of SEQ ID NO: 2 and/or 4 (or combinations thereof), which may be directly adjacent each other or separated by one or more intervening amino acids.
  • polypeptide may comprise or consist of tandem repeats of the amino acid sequence of SEQ ID NO: 5 or 63.
  • the modified osteopontin polypeptide simply comprises or consists of the amino acid sequence of SEQ ID NO: 1 or 3.
  • the polypeptide may consist of the polypeptide according to SEQ ID NO: 1 or 3.
  • the modified osteopontin polypeptide simply comprises or consists of the amino acid sequence of SEQ ID NO: 5 or 63.
  • the polypeptide may consist of the polypeptide according to SEQ ID NO: 5 or 63.
  • Modified osteopontin polypeptides suitable for use in the compositions of the invention may be made by in vitro cell-based expression methods well known to persons skilled in the art (for example, see Sambrook & Russell, 2000, Molecular Cloning, A Laboratory Manual, Third Edition, Cold Spring Harbor, New York, which is incorporated herein by reference). The choice of expression vector and host cell to be used may depend on a number of factors. For example, if the modified osteopontin polypeptide is to be glycosylated, a mammalian expression system will be required.
  • Suitable expression vectors and host cells are commercially available from many sources.
  • the modified osteopontin polypeptides may be synthesised by known means, such as liquid phase and solid phase synthesis (for example, t-Boc solid-phase peptide synthesis and BOP-SPPS).
  • liquid phase and solid phase synthesis for example, t-Boc solid-phase peptide synthesis and BOP-SPPS.
  • the present invention also includes pharmaceutically and/or cosmetically acceptable acid or base addition salts of the above described modified osteopontin polypeptides.
  • the acids which are used to prepare the pharmaceutically and/or cosmetically acceptable acid addition salts of the aforementioned base compounds useful in this invention are those which form non-toxic acid addition salts, i.e.
  • salts containing pharmaceutically and/or cosmetically acceptable anions such as the hydrochloride, hydrobromide, hydroiodide, nitrate, sulphate, bisulphate, phosphate, acid phosphate, acetate, lactate, citrate, acid citrate, tartrate, bitartrate, succinate, maleate, fumarate, gluconate, saccharate, benzoate, methanesulphonate, ethanesulphonate, benzenesulphonate, p-toluenesulphonate and pamoate [i.e. 1,1'-methylene-bis-(2-hydroxy-3 naphthoate)] salts, among others.
  • anions such as the hydrochloride, hydrobromide, hydroiodide, nitrate, sulphate, bisulphate, phosphate, acid phosphate, acetate, lactate, citrate, acid citrate, tartrate, bitartrate, succinate, maleate, fumarate, glucon
  • Pharmaceutically and/or cosmetically acceptable base addition salts may also be used to produce pharmaceutically and/or cosmetically acceptable salt forms of the modified osteopontin polypeptides.
  • the chemical bases that may be used as reagents to prepare pharmaceutically and/or cosmetically acceptable base salts of the present compounds that are acidic in nature are those that form non-toxic base salts with such compounds.
  • Such non-toxic base salts include, but are not limited to those derived from such pharmaceutically and/or cosmetically acceptable cations such as alkali metal cations (e.g. potassium and sodium) and alkaline earth metal cations (e.g. calcium and magnesium), ammonium or water-soluble amine addition salts such as N- methylglucamine-(meglumine), and the lower alkanolammonium and other base salts of pharmaceutically acceptable organic amines, among others.
  • alkali metal cations e.g. potassium and sodium
  • alkaline earth metal cations e.g. calcium and magnesium
  • modified osteopontin polypeptides of the invention may be lyophilised for storage and reconstituted in a suitable carrier prior to use. Any suitable lyophilisation method (e.g. spray drying, cake drying) and/or reconstitution techniques can be employed. It will be appreciated by those skilled in the art that lyophilisation and reconstitution can lead to varying degrees of activity loss and that use levels may have to be adjusted upward to compensate.
  • lyophilisation and reconstitution can lead to varying degrees of activity loss and that use levels may have to be adjusted upward to compensate.
  • the lyophilised (freeze dried) polypeptide loses no more than about 20%, or no more than about 25%, or no more than about 30%, or no more than about 35%, or no more than about 40%, or no more than about 45%, or no more than about 50% of its activity (prior to lyophilisation) when rehydrated.
  • the modified osteopontin polypeptides are provided in the form of a composition comprising the polypeptide and a pharmaceutically acceptable and/or cosmetically acceptable excipient, carrier or diluent, selected with regard to the intended route of administration and standard pharmaceutical or cosmetic practice (for example, see Remington: The Science and Practice of Pharmacy, 19 th edition, 1995, Ed. Alfonso Gennaro, Mack Publishing Company, Pennsylvania, USA, which is incorporated herein by reference).
  • pharmaceutically acceptable is included that the formulation is sterile and pyrogen free.
  • Suitable pharmaceutical carriers are well known in the art of pharmacy.
  • the carrier(s) must be "acceptable” in the sense of being compatible with the compound of the invention and not deleterious to the recipients thereof.
  • the carriers will be water or saline which will be sterile and pyrogen free; however, other acceptable carriers may be used.
  • pharmaceutically acceptable carrier and “pharmaceutically acceptable excipient” includes any compound(s) used in forming a part of the formulation that is intended to act merely as a carrier, i.e., not intended to have biological activity itself.
  • the pharmaceutically acceptable carrier or excipient is generally safe, non-toxic, and neither biologically nor otherwise undesirable.
  • a pharmaceutically acceptable carrier or excipient as used herein includes both one and more than one such carrier or excipient.
  • cosmetically acceptable is used to denote formulations suitable for use as cosmetic products.
  • Suitable cosmetic carriers are well known in the art, such as those commonly used in shampoos, lotions, creams and other such products.
  • the excipient may be one or more of carbohydrates, polymers, lipids and minerals.
  • carbohydrates include lactose, sucrose, mannitol, and cyclodextrines, which are added to the composition, e.g.,, for facilitating lyophilisation.
  • polymers are starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate, polyethylenglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone, all of different molecular weight, which are added to the composition, e.g., for viscosity control, for achieving bioadhesion, or for protecting the lipid from chemical and proteolytic degradation.
  • lipids are fatty acids, phospholipids, mono-, di-, and triglycerides, ceramides, sphingolipids and glycolipids, all of different acyl chain lenght and saturation, egg lecithin, soy lecithin, hydrogenated egg and soy lecithin, which are added to the composition for reasons similar to those for polymers.
  • minerals are talc, magnesium oxide, zinc oxide and titanium oxide, which are added to the composition to obtain benefits such as reduction of liquid accumulation or advantageous pigment properties.
  • the term "diluent" is intended to mean an aqueous or non-aqueous solution with the purpose of diluting the peptide in the pharmaceutical preparation.
  • the diluent may be one or more of saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil).
  • the diluent may also function as a buffer.
  • buffer is intended to mean an aqueous solution containing an acid-base mixture with the purpose of stabilising pH.
  • buffers are Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, phosphate, carbonate, acetate, citrate, glycolate, lactate, borate, ACES, ADA, tartrate, AMP, AMPD, AMPSO, BES, CABS, cacodylate, CHES, DIPSO, EPPS, ethanolamine, glycine, HEPPSO, imidazole, imidazolelactic acid, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO and TES.
  • the composition may comprise an adjuvant.
  • adjuvant is intended to mean any compound added to the formulation to increase the biological effect of the peptide.
  • the adjuvant may be one or more of zinc, copper or silver salts with different anions, for example, but not limited to fluoride, chloride, bromide, iodide, tiocyanate, sulfite, hydroxide, phosphate, carbonate, lactate, glycolate, citrate, borate, tartrate, and acetates of different acyl composition.
  • compositions of the invention may also be in the form of biodegradable microspheres.
  • Aliphatic polyesters such as poly(lactic acid) (PLA), poly(glycolic acid) (PGA), copolymers of PLA and PGA (PLGA) or poly(carprolactone) (PCL), and polyanhydrides have been widely used as biodegradable polymers in the production of microspheres. Preparations of such microspheres can be found in US 5,851,451 and in EP0213303.
  • compositions of the invention may also be in the form of polymer gels, where polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate,
  • polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate,
  • the modified osteopontin polypeptides may be formulated at various concentrations, depending on the efficacy/toxicity of the particular polypeptide being used.
  • the composition comprises the modified osteopontin polypeptide at a concentration of between 1 nM and 1 M, for example between 0.1 ⁇ and 1 mM, 1 ⁇ and 100 ⁇ , between 5 ⁇ and 50 ⁇ , between 10 ⁇ and 50 ⁇ , between 20 ⁇ and 40 ⁇ and optionally about 30 ⁇ .
  • compositions may comprise a lower concentration of a modified osteopontin polypeptide, for example between 0.0025 ⁇ and 1 ⁇ .
  • compositions of the invention may be administered by a variety of routes, for example topical, transdermal, parenteral or oral administration.
  • compositions of the invention are suitable for topical administration or intracutaneous administration.
  • compositions of the invention may be administered topically to the skin (e.g. scalp).
  • the composition may be provided in the form of an ointment containing the active polypeptide suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene compound, emulsifying wax and water.
  • the polypeptide can be formulated as a suitable lotion or cream, suspended or dissolved in, for example, a mixture of one or more of the following: mineral oil, sorbitan monostearate, a polyethylene glycol, liquid paraffin, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
  • composition for topical administration may comprise a penetration enhancer (for example, as described in Osborne & Henke, 1997, Pharmaceutical Technology, November: 58-82 and Pathan & Setty, 2009, Tropical Journal of Pharmaceutical Research 8 (2): 173-179, the disclosures of which are incorporated herein by reference).
  • a penetration enhancer for example, as described in Osborne & Henke, 1997, Pharmaceutical Technology, November: 58-82 and Pathan & Setty, 2009, Tropical Journal of Pharmaceutical Research 8 (2): 173-179, the disclosures of which are incorporated herein by reference).
  • compositions of the invention may be administered parenterally, for example intracutaneously.
  • Such compositions are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
  • the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary.
  • suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well known to those skilled in the art.
  • compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
  • the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described. It may be beneficial to use a sustained-release system, such as microsphere formulations, for delivering the modified osteopontin polypeptides.
  • compositions can be administered by a surgically implanted device that releases the active polypeptide directly to the required site (i.e. the epidermis).
  • compositions of the invention may also be delivered by transdermal methodologies.
  • EPT electroporation therapy
  • iontophoresis systems can be employed for the administration of proteins and polypeptides.
  • a device is used to deliver a pulsed electric field to cells, resulting in the increased permeability of the cell membranes to the drug and significant enhancement of intracellular drug delivery.
  • An alternative transdermal method utilises small particles of up to 30 microns in diameter on the surface of the skin experience electrical pulses identical or similar to those used in electroporation.
  • the particles are driven through the stratum corneum and into deeper layers of the skin.
  • the particles can be loaded or coated with drugs or genes or can simply act as "bullets" that generate pores in the skin through which the drugs can enter.
  • Suitable methods for administration of the polypeptides and compositions of the invention are well known in the art, for example, see Therapeutic Protein and Peptide Formulation and Delivery, Zahra Shahrokh ef al. (Eds), 1997, American Chemical Society, ISBN13: 9780841235281.
  • a second aspect of the invention provides a polypeptide comprising or consisting of the amino acid sequence of SEQ ID NO: 63 or a fragment, variant, derivative or fusion thereof (or a fusion of said fragment, variant or derivative) which retains a hair growth stimulatory activity of the amino acid sequence of SEQ ID NO: 63.
  • the polypeptide is isolated (e.g. outside the mammalian body).
  • fragment fragment, variant, variant, derivative, derivative or fusion are as defined above in relation to the first aspect of the invention.
  • the polypeptide is a fragment of human osteopontin comprising an RGD domain which is inactivated (by substitution or deletion of one or more of the amino acids of the RGD domain and/or by addition of one or more amino acids within the RGD domain).
  • the three amino acids of the "R-G-D" domain of the wildtype human osteopontin protein may be replaced by two amino acids, "D-l”.
  • the fragment is between five and thirty amino acids in length, for example between ten and twenty amino acids in length.
  • polypeptide may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 5 to 62, or fragment, variant, derivative or fusion thereof.
  • PNGDISLAYGLRS SEQ ID NO: 13 Preferred 12-amino acid peptides:
  • the polypeptide comprises or consists of an amino acid sequence of SEQ ID NO: 5.
  • the polypeptide comprises or consists of a variant of an amino acid sequence of SEQ ID NO: 5.
  • polypeptide may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 63 to 120, or a fragment, variant, derivative or fusion thereof.
  • the polypeptide comprises or consists of an amino acid sequence of SEQ ID NO: 63.
  • polypeptides of the invention may be for medical use in the treatment or prevention of a disease or condition associated with hair loss (as described in detail below).
  • the invention further provides the use of a polypeptide of the invention for stimulating hair growth in a mammal, wherein the use is cosmetic or commercial (as described in detail below).
  • a third aspect of the invention provides compositions according to the first aspect of the invention for use in stimulating hair growth in a mammal.
  • compositions may be for use in stimulating existing hair follicles and/or inducing the growth of new hair follicles (or stem cells for producing the same).
  • the composition is for use in the treatment or prevention of a disease or condition associated with hair loss, such as alopecia.
  • Alopecia is typically associated with the loss of anagen hairs. However, it will be appreciated that the compositions of the invention may also be used for treatment of conditions associated with the loss of telogen hairs. In one embodiment, the alopecia is selected from the group consisting of:
  • the alopecia may be androgenic alopecia.
  • the alopecia may be anagen effluvium. This condition, resulting from the early entry of hairs into the telogen phase, may be due to a variety of causes, including eating disorders, fever, childbirth, chronic illness, major surgery, anemia, severe emotional disorders, crash diets, hypothyroidism, and drugs.
  • the hair loss is induced by radiotherapy and/or chemotherapy agents.
  • hair loss is a common and distressing side effect of treatment with chemotherapeutic drugs such as cisplatin, etoposide and paclitaxel.
  • the mammal is a human.
  • a related, fourth aspect of the invention provides the use of a modified osteopontin polypeptide as defined above in relation to the first aspect of the invention in the preparation of a medicament for stimulating hair growth in a mammal.
  • the medicament may be for stimulating existing hair follicles and/or inducing the growth of new hair follicles (or stem cells for producing the same).
  • the medicament is for the treatment or prevention of a disease or condition associated with hair loss, such as alopecia (e.g. associated with the loss of anagen hairs).
  • alopecia is selected from the group consisting of:
  • the alopecia may be androgenic alopecia.
  • the alopecia may be anagen effluvium, e.g. induced by radiotherapy and/or chemotherapy (see above).
  • the mammal is a human.
  • a related, fifth aspect of the invention provides a method for stimulating hair growth in a mammal comprising administering an effective amount of a modified osteopontin polypeptide as defined above in relation to the first aspect of the invention.
  • the method may be for stimulating existing hair follicles and/or inducing the growth of new hair follicles (or stem cells for producing the same).
  • the polypeptide composition of the invention is administered to the patient in an effective amount.
  • This is a predetermined quantity of active material calculated to produce the desired therapeutic effect.
  • the amount of a compound may vary depending on its specific activity. Suitable dosage amounts may contain a predetermined quantity of active composition calculated to produce the desired therapeutic effect in association with the required diluent.
  • compositions of the invention a therapeutically effective amount of the active component is provided.
  • a therapeutically effective amount can be determined by the ordinary skilled medical or veterinary worker based on patient characteristics, such as age, weight, sex, condition, complications, other diseases, etc., as is well known in the art.
  • the method is for the treatment or prevention of a disease or condition associated with hair loss, such as alopecia (e.g. associated with the loss of anagen hairs).
  • alopecia e.g. associated with the loss of anagen hairs.
  • the alopecia is selected from the group consisting of:
  • the alopecia may be androgenic alopecia.
  • the alopecia may be anagen effluvium, e.g. induced by radiotherapy and/or chemotherapy (see above).
  • the mammal is a human.
  • composition of the first aspect of the invention are not limited to medical uses but may also be used as cosmetic agents (in the sense that they do not provide any physical health improvement, as such, but merely provide an aesthetic benefit to the mammal).
  • a sixth aspect of the invention provides the use of a composition according to the first aspect of the invention for stimulating hair growth in a mammal, wherein the use is cosmetic.
  • the cosmetic composition may be for stimulating existing hair follicles and/or inducing the growth of new hair follicles (or stem cells for producing the same).
  • the cosmetic composition is used for the treatment or prevention of baldness, which may be associated with a receding hairline and/or thinning hair.
  • compositions are not limited to use on the scalp, but may also be applied elsewhere on the body (including to the face to encourage the growth of a beard, eyelashes, eyebrows, efc.)
  • the mammal is a human.
  • the compositions of the invention may be used on their own or in combination with other therapeutic or cosmetic agents.
  • the compositions of the invention may be used in a combination therapy with existing treatments to prevent loss of existing hair and/or to stimulate growth of new hair, for example potassium channel openers, such as minoxidil (Regaine RTM., Pharmacia Corp.) and diazoxide; 5-alpha-reductase inhibitors, such as finasteride (Propecia RTM., Merck & Co.); and the immunosuppressant cyclosporin A.
  • potassium channel openers such as minoxidil (Regaine RTM., Pharmacia Corp.) and diazoxide
  • 5-alpha-reductase inhibitors such as finasteride (Propecia RTM., Merck & Co.)
  • the immunosuppressant cyclosporin A for example potassium channel openers, such as minoxidil (Regaine RTM., Pharmacia Corp.) and diazoxide;
  • compositions of the invention may be used in vivo, ex vivo or in vitro.
  • the compositions may be used to stimulate hair growth ex vivo, for example in a skin explant prior to grafting of the skin on to the mammal.
  • the compositions may be used to grow hair follicles in vitro, e.g. in cell culture, which may then be transplanted to a patient.
  • a further aspect of the invention provides the use of a polypeptide according to the first aspect of the invention for stimulating hair growth in vitro or ex vivo.
  • the polypeptide is used to stimulate the growth of hair follicles (or stem cell precursors of the same).
  • a still further aspect of the invention provides a method for making a composition according to the first aspect of the invention, the method comprising admixing a modified osteopontin polypeptide in which an RGD domain is inactivated with a pharmaceutically acceptable and/or cosmetically acceptable excipient, carrier or diluent.
  • Figure 1 shows a schematic representation of the sampling area of skin on the mice.
  • Figure 2 is a representative photograph of a cross section of skin from a mouse 48 hours after being treated with a modified osteopontin polypeptide. Follicles within the epidermis are indicated by the arrow. The linear density of the follicles was 18.3 follicles per mm (598 follicles in 32.65 mm of epidermis).
  • Figure 3 is a representative photograph of a cross section of skin from a mouse 48 hours after being treated with a negative control composition. Follicles within the epidermis are indicated by the arrow. The linear density of the follicles was 11.7 follicles per mm (379 follicles in 32.50 mm of epidermis).
  • Figure 4 shows representative photographs of (a) a control-treated animal on day 14 having a hair growth score of 0, (b) an animal treated with exemplary 'full length' polypeptide "Cx" (corresponding to SEQ ID NO: 1 but without the initial sixteen amino acid signal peptide, 60 nM) on day 14 having a hair growth score of 1.5 (c) an animal treated with exemplary short peptide "FOL-004" (SEQ ID NO: 5, 60 nM) on day 5 having a hair growth score of 2.5 and (d) an animal treated with exemplary short peptide "FOL- 005" (SEQ ID NO: 5, 63 nM) on day 5 having a hair growth score of 2.0.
  • exemplary short peptide "FOL- 005" SEQ ID NO: 5, 63 nM
  • Figure 5 shows the effect of exemplary 'full length' polypeptide "Cx" and polypeptides SEQ ID NOs: 5 and 63 of the invention on hair growth.
  • Figure 6 shows the effect of exemplary polypeptide SEQ ID NO: 5 on hair growth, as compared to the corresponding polypeptide SEQ ID NO: 121 from wildtype mouse osteopontin.
  • the modified osteopontin polypeptide sequence SEQ ID NO:1 was cloned into a pCEP4 expression vector by the use of Xhol and BamHI restriction enzyme sites.
  • the pCEP4 expression vector contains an ampicillin resistance gene for expression in bacteria and a hygromycin resistance gene for expression in eukaryotic EBNA cells.
  • the polypeptide containing vector were transformed into competent XL-10 bacteria cells, multiplied and isolated with Qiagen midi prep kit. Isolated vectors were then transfected into human EBNA cells by the use of Fugene transfection reagent according to manufacture protocol (Invitrogen).
  • Polypeptides produced by pCEP4 plasmid contain an inserted His-tag, which is used to facilitate the isolation with Ni-sepharose gel chromatography (Invitrogen). Collected medium was diluted with binding buffer (20mM sodium phosphate, 500mM sodium chloride, pH 7.8), Ni-sepharose suspension was added before incubation on shaker overnight at 4°C. The Ni-sepharose gel was pelleted by centrifugation at 1000g for seven minutes and poured into a BioRad disposable mini column. Unbound proteins were removed with binding buffer followed by washing buffer (20mM sodium phosphate, 500mM sodium chloride, pH 6.0). Polypeptides were eluated from the column with 500mM imidazole.
  • the study consisted of four experimental groups each containing five male wtC57BL/6N mice. On day -1 the necks of all participating mice were shaved carefully in squares of approx. 1.5 x 1.0 cm and small remaining hairpieces were removed. On the following day (day 0), each animal received four intracutaneous injections of 25 ⁇ each at separate locations (each approx. 0.5 x 0.5 cm) within the shaved rectangle (see Figure 1).
  • Each animal received two injections of 25 ⁇ of a composition comprising an exemplary modified osteopontin polypeptide of SEQ ID NO:1 ("Test polypeptide” or “Cx”, 60 nmol/l in PBS) and two negative control injections of 25 ⁇ PBS (according to the scheme outlined in Table 1).
  • Sample preparation delivered stock solution was diluted 15x with PBS to obtain the 60n working solution before injection
  • Route of administration intracutaneously Frequency of administration single application on day 0
  • the data show that treatment with the exemplary modified osteopontin polypeptide of SEQ ID NO: 1 increases the number of hair follicles/mm epidermis by about 60%.
  • mice (C57BU6) were used at an age of 6 to 8 weeks. Overview of study design
  • Figure 4 shows representative photographs of (a) a control-treated animal on day 14 having a hair growth score of 0, (b) an animal treated with exemplary 'full length' polypeptide "Cx" (SEQ ID NO: 1, 60 nM) on day 14 having a hair growth score of 1.5 (c) an animal treated with exemplary short peptide "FOL-004" (SEQ ID NO: 5, 60 nM) on day 5 having a hair growth score of 2.5 and (d) an animal treated with exemplary short peptide "FOL-005" (SEQ ID NO: 5, 63 nM) on day 5 having a hair growth score of 2.0.
  • VDVPNGRGDSLAYGLR [SEQ ID NO: 121]
  • This sequence is a fragment of wildtype mouse osteopontin, and corresponds to the region of the protein from which "FOL-004" is derived (i.e. "FOL-004" is a mutated version of wildtype fragment " FOL-001").
  • Peptide FOL-001 (SEQ ID NO: 121) produced a delayed but detectable hair growth effect in mice, which became evident at about day 9 and reached a plateau at a score of about 1.3.
  • Example B Following completion of the term of hair growth assessment for Example B, the animals were euthanized and dorsal skin peeled and removed for observation of the internal surface. Histological analysis
  • the hair growth cycle consists of three phases: a resting telogen phase (C57BU6 skin is a pale pink colour), an active hair growth anagen phase (where the skin becomes dark gray or black), and finally a catagen phase (where hair growth stops, and the skin transitions back to the telogen phase, returning to a pale pink colour).
  • a resting telogen phase C57BU6 skin is a pale pink colour
  • an active hair growth anagen phase where the skin becomes dark gray or black
  • a catagen phase where hair growth stops, and the skin transitions back to the telogen phase, returning to a pale pink colour.
  • telogen phase the test polypeptide was administered by subcutaneous/topical route.
  • a good hair growth promoter triggers the transition from the resting telogen phase to the active anagen phase, and thus a transition from light skin to dark skin. This dark pigmentation may result from the collection of melanin in the hair follicles, in preparation for new hair growth during the anagen phase. Melanin synthesis of follicular melanocytes is strictly coupled to the anagen phase, ceases during catagen and is absent in telogen phase. Hence a good hair growth promoter causes blackening of dorsal skin.
  • the dorsal skin of the animals was then excised out by peeling and the peeled skin reversed and observed for the induction of melanogenesis indicated by visual blackening. Histological analysis reveals number of follicles and skin thickness. A good hair growth promoter increases no. of follicles in sub cutis and skin thickness.
  • the exemplary mutated osteopontin polypeptides of the invention showed pronounced induction of anagen, as evidenced by an increase in the number of hair follicles in the subcutis and/or enhanced skin thickness.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Dermatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Oral & Maxillofacial Surgery (AREA)
  • Transplantation (AREA)
  • Birds (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Cosmetics (AREA)
PCT/GB2012/051955 2011-08-10 2012-08-10 Novel compositions and uses thereof Ceased WO2013021212A2 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
CN201280049850.XA CN103930125B (zh) 2011-08-10 2012-08-10 具有失活rgd域的修饰的骨桥蛋白肽及其用途
US14/237,108 US9381149B2 (en) 2011-08-10 2012-08-10 Compositions and uses thereof
AU2012293448A AU2012293448B2 (en) 2011-08-10 2012-08-10 Novel compositions and uses thereof
KR1020147006108A KR101992282B1 (ko) 2011-08-10 2012-08-10 불활성화된 rgd 도메인을 갖는 변형된 오스테오폰틴 펩티드 및 이의 용도
ES12768879.4T ES2576299T3 (es) 2011-08-10 2012-08-10 Péptidos de osteopontina modificados que tienen un dominio RGD inactivado
JP2014524449A JP6049718B2 (ja) 2011-08-10 2012-08-10 新規組成物及びその使用
DK12768879.4T DK2741761T3 (en) 2011-08-10 2012-08-10 Modified osteopontin polypeptides which have an inactivated RGD domain
BR112014003051-0A BR112014003051B1 (pt) 2011-08-10 2012-08-10 Polipeptídeo, composição para estimular o crescimento de cabelo e uso dos mesmos
RU2014108819/10A RU2604797C2 (ru) 2011-08-10 2012-08-10 Новые композиции и их применение
CA2844749A CA2844749C (en) 2011-08-10 2012-08-10 Novel compositions and uses thereof
PL16169698T PL3087999T3 (pl) 2011-08-10 2012-08-10 Zmodyfikowane peptydy osteopontyny ze zdezaktywowaną domeną rgd i ich zastosowanie
EP16169698.4A EP3087999B1 (en) 2011-08-10 2012-08-10 Modified osteopontin peptides having an inactivated rgd domain and uses thereof
HK14111213.2A HK1197540B (en) 2011-08-10 2012-08-10 Modified osteopontin peptides having an inactivated rgd domain
EP12768879.4A EP2741761B1 (en) 2011-08-10 2012-08-10 Modified osteopontin peptides having an inactivated rgd domain
US15/184,290 US10137169B2 (en) 2011-08-10 2016-06-16 Compositions and uses thereof
US16/176,201 US10517932B2 (en) 2011-08-10 2018-10-31 Compositions and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1113770.0A GB2493540A (en) 2011-08-10 2011-08-10 Agents for stimulating hair growth in mammals
GB1113770.0 2011-08-10

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/237,108 A-371-Of-International US9381149B2 (en) 2011-08-10 2012-08-10 Compositions and uses thereof
US15/184,290 Continuation US10137169B2 (en) 2011-08-10 2016-06-16 Compositions and uses thereof

Publications (2)

Publication Number Publication Date
WO2013021212A2 true WO2013021212A2 (en) 2013-02-14
WO2013021212A3 WO2013021212A3 (en) 2014-04-17

Family

ID=44735704

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2012/051955 Ceased WO2013021212A2 (en) 2011-08-10 2012-08-10 Novel compositions and uses thereof

Country Status (15)

Country Link
US (3) US9381149B2 (https=)
EP (2) EP2741761B1 (https=)
JP (1) JP6049718B2 (https=)
KR (1) KR101992282B1 (https=)
CN (1) CN103930125B (https=)
AU (1) AU2012293448B2 (https=)
BR (1) BR112014003051B1 (https=)
CA (1) CA2844749C (https=)
DK (2) DK2741761T3 (https=)
ES (2) ES2576299T3 (https=)
GB (1) GB2493540A (https=)
PL (2) PL3087999T3 (https=)
RU (1) RU2604797C2 (https=)
TR (1) TR201910685T4 (https=)
WO (1) WO2013021212A2 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015159099A1 (en) * 2014-04-17 2015-10-22 Follicum Ab Compositions comprising osteopontin derivatives for the inhibition of hair growth
US10066212B2 (en) 2015-08-06 2018-09-04 Seoul National University R&Db Foundation Method for preparing induced pluripotent stem cells using synthetic peptide
US10137169B2 (en) 2011-08-10 2018-11-27 Follicum Ab Compositions and uses thereof
US10815283B2 (en) 2017-05-04 2020-10-27 Follicum Ab Peptides for treatment of diabetes
US20220273765A1 (en) * 2019-04-24 2022-09-01 Follicum Ab Topical formulation
WO2023218094A1 (en) * 2022-05-13 2023-11-16 Coegin Pharma Ab Agents inducing vascularisation
WO2023218095A1 (en) * 2022-05-13 2023-11-16 Coegin Pharma Ab Agents for stimulating tissue regeneration

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6548126B2 (ja) * 2014-11-27 2019-07-24 国立大学法人大阪大学 Iii型コラーゲン産生促進剤
WO2018175630A1 (en) * 2017-03-23 2018-09-27 The Regents Of The University Of California Stimulation of hair growth by senescent cells and senescence associated secretory phenotype
KR102091567B1 (ko) * 2018-06-15 2020-03-20 인하대학교 산학협력단 오스테오폰틴 단백질 단편을 유효성분으로 함유하는 뇌손상 예방 또는 치료용 약학 조성물
US20220002343A1 (en) * 2018-11-07 2022-01-06 Follicum Ab Peptide fragments for treatment of diabetes
IL300592A (en) * 2020-02-25 2023-04-01 Amplifica Inc Preparations and methods to stimulate hair growth
AU2022335599A1 (en) * 2021-08-25 2024-03-07 Amplifica Holdings Group, Inc. Compositions and methods for stimulating hair growth
KR20260034660A (ko) * 2023-06-20 2026-03-11 앰플리피카 홀딩스 그룹 인코포레이티드 모발 성장을 촉진하기 위한 조성물 및 방법

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
US5643872A (en) 1989-10-23 1997-07-01 Smithkline Beecham Corporation Cyclic anti-aggregatory peptides
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
US6008058A (en) 1993-06-18 1999-12-28 University Of Louisville Cyclic peptide mixtures via side chain or backbone attachment and solid phase synthesis
US20090005312A1 (en) 2003-12-18 2009-01-01 Novo Nordisk A/S Novel glp-1 analogues linked to albumin-like agents

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5756094A (en) 1991-03-27 1998-05-26 Trustees Of The University Of Pennsylvania Methods for stimulating follicular growth
US5753612A (en) 1992-10-27 1998-05-19 Yissum Research Development Co. Of The Hebrew University Of Jerusalem Pharmaceutical composition and method for inhibiting hair growth by administration of activin or activin agonists
EP0821592A4 (en) 1995-04-20 2000-03-01 Univ Pennsylvania COMPOSITIONS AND METHODS FOR REGULATING HAIR GROWTH
US6884772B1 (en) 1999-10-21 2005-04-26 Kao Corporation Depilatories and agents for external use
AU4256901A (en) 2000-03-23 2001-10-03 Glaxo Group Limited Method of screening for inhibitors of osteopontin
US6428967B1 (en) * 2000-05-01 2002-08-06 Board Of Regents, The University Of Texas System LDL receptor signaling pathways
AU2002220920A1 (en) * 2000-12-08 2002-06-18 Oxford Biomedica (Uk) Limited Method for identification of genes involved in specific diseases
US20040234524A1 (en) * 2001-04-05 2004-11-25 Toshimitsu Uede Anti-osteopontin antibody and use thereof
CZ20033109A3 (en) * 2001-05-17 2004-06-16 Applied Research Systems Ars Holding N.V. Use of osteopontin for the treatment and/or prevention of neurologic diseases
JP5059412B2 (ja) * 2004-01-06 2012-10-24 ノボザイムス アクティーゼルスカブ アリシクロバシラスsp.のポリペプチド
AR048024A1 (es) 2004-03-05 2006-03-22 Bayer Cropscience Gmbh Plantas con actividad aumentada de distintas enzimas fosforilantes del almidon
RU2309730C2 (ru) * 2006-04-18 2007-11-10 Леонид Юрьевич Брежнев Средство для стимуляции роста волос, его варианты и способ его получения
WO2008086449A2 (en) * 2007-01-09 2008-07-17 Oregon Health & Science University Synthetic osteopontin peptides and methods of use
GB2493540A (en) 2011-08-10 2013-02-13 Follicum Ab Agents for stimulating hair growth in mammals

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
US5643872A (en) 1989-10-23 1997-07-01 Smithkline Beecham Corporation Cyclic anti-aggregatory peptides
US6008058A (en) 1993-06-18 1999-12-28 University Of Louisville Cyclic peptide mixtures via side chain or backbone attachment and solid phase synthesis
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
US20090005312A1 (en) 2003-12-18 2009-01-01 Novo Nordisk A/S Novel glp-1 analogues linked to albumin-like agents

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
"Fonnulation and Delivery", 1997, AMERICAN CHEMICAL SOCIETY
"Remington: The Science and Practice of Pharmacy", 1995, MACK PUBLISHING COMPANY
FRANZEN; HEINEGARD, BIOCHEM. J., vol. 232, no. 3, 1985, pages 715 - 24
HUANG; MILLER, ADV. APPL. MATH., vol. 12, 1991, pages 337 - 357
MEZIERE, J. IMMUNOL., vol. 159, 1997, pages 3230 - 3237
OLDBERG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, no. 23, 1986, pages 8819 - 23
OSBORNE; HENKE, PHARMACEUTICAL TECHNOLOGY, November 1997 (1997-11-01), pages 58 - 82
PATHAN; SETTY, TROPICAL JOURNAL OF PHARMACEUTICAL RESEARCH, vol. 8, no. 2, 2009, pages 173 - 179
SAMBROOK; RUSSELL: "Molecular Cloning, A Laboratory Manual", 2000, COLD SPRING HARBOR
SCATENA ET AL., ARTERIO. THROMB. VASC. BIOL., vol. 27, 2007, pages 2302 - 2309
THURSELL ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 111, 1983, pages 166
VEBER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 2636

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10137169B2 (en) 2011-08-10 2018-11-27 Follicum Ab Compositions and uses thereof
US10517932B2 (en) 2011-08-10 2019-12-31 Follicum Ab Compositions and uses thereof
WO2015159099A1 (en) * 2014-04-17 2015-10-22 Follicum Ab Compositions comprising osteopontin derivatives for the inhibition of hair growth
CN106413734A (zh) * 2014-04-17 2017-02-15 富力卡姆股份公司 用于抑制毛发生长的包含骨桥蛋白衍生物的组合物
US10066212B2 (en) 2015-08-06 2018-09-04 Seoul National University R&Db Foundation Method for preparing induced pluripotent stem cells using synthetic peptide
US10815283B2 (en) 2017-05-04 2020-10-27 Follicum Ab Peptides for treatment of diabetes
US20220273765A1 (en) * 2019-04-24 2022-09-01 Follicum Ab Topical formulation
WO2023218094A1 (en) * 2022-05-13 2023-11-16 Coegin Pharma Ab Agents inducing vascularisation
WO2023218095A1 (en) * 2022-05-13 2023-11-16 Coegin Pharma Ab Agents for stimulating tissue regeneration

Also Published As

Publication number Publication date
RU2014108819A (ru) 2015-09-20
US9381149B2 (en) 2016-07-05
EP3087999A1 (en) 2016-11-02
GB201113770D0 (en) 2011-09-21
DK2741761T3 (en) 2016-08-15
ES2576299T3 (es) 2016-07-06
US20150018273A1 (en) 2015-01-15
US10137169B2 (en) 2018-11-27
US20160317620A1 (en) 2016-11-03
KR20140083977A (ko) 2014-07-04
CA2844749C (en) 2020-07-14
CN103930125A (zh) 2014-07-16
PL2741761T3 (pl) 2017-01-31
CN103930125B (zh) 2017-11-03
BR112014003051A2 (pt) 2019-04-02
HK1197540A1 (zh) 2015-01-23
ES2740826T3 (es) 2020-02-06
DK3087999T3 (da) 2019-07-29
PL3087999T3 (pl) 2019-09-30
WO2013021212A3 (en) 2014-04-17
JP2014525394A (ja) 2014-09-29
EP2741761B1 (en) 2016-05-18
BR112014003051B1 (pt) 2022-01-04
KR101992282B1 (ko) 2019-06-24
CA2844749A1 (en) 2013-02-14
US20190192631A1 (en) 2019-06-27
JP6049718B2 (ja) 2016-12-21
GB2493540A (en) 2013-02-13
US10517932B2 (en) 2019-12-31
EP2741761A2 (en) 2014-06-18
RU2604797C2 (ru) 2016-12-10
AU2012293448B2 (en) 2016-04-07
AU2012293448A1 (en) 2014-02-27
TR201910685T4 (tr) 2019-08-21
EP3087999B1 (en) 2019-05-08

Similar Documents

Publication Publication Date Title
US10517932B2 (en) Compositions and uses thereof
CA2032059C (en) Wound treatment employing biologically active peptides
CN101111222A (zh) 刺激胶原蛋白合成和/或kgf表达的方法
KR101809209B1 (ko) 두피의 건강 개선을 위한 화장료 조성물 및 이의 제조방법
US20110269694A1 (en) Novel anti-aging peptides and cosmetic and/or pharmaceutical composition containing same
US20110269695A1 (en) Novel anti-aging peptides and cosmetic and/or pharmaceutical composition containing same
US20170143605A1 (en) Compositions Comprising Osteopontin Derivatives for the Inhibition of Hair Growth
WO2013148377A1 (en) Methods for modulating hair growth using truncated laminin-511
KR20140140396A (ko) 피부 주름 개선 및 미백용 조성물
WO2008089234A2 (en) Natural polypeptides for oral health care
HK1230068A1 (en) Modified osteopontin peptides having an inactivated rgd domain and uses thereof
HK1230068B (en) Modified osteopontin peptides having an inactivated rgd domain and uses thereof
HK1197540B (en) Modified osteopontin peptides having an inactivated rgd domain
KR20200128919A (ko) 트롤록스-펩타이드 결합체 및 그의 용도

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 2012768879

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2844749

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014524449

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2012293448

Country of ref document: AU

Date of ref document: 20120810

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20147006108

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014108819

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14237108

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014003051

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014003051

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140207