WO2012131076A1 - BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 - Google Patents
BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 Download PDFInfo
- Publication number
- WO2012131076A1 WO2012131076A1 PCT/EP2012/055897 EP2012055897W WO2012131076A1 WO 2012131076 A1 WO2012131076 A1 WO 2012131076A1 EP 2012055897 W EP2012055897 W EP 2012055897W WO 2012131076 A1 WO2012131076 A1 WO 2012131076A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- single variable
- immunoglobulin single
- dii4
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)C(***)C(C(C1C)(C23*4(C(C)**)C(C)CCC4C12C3(*)C(*)C(*)C(*)C(*)C(*)C(*)C(*)C*)N=O)O Chemical compound CC(C)C(***)C(C(C1C)(C23*4(C(C)**)C(C)CCC4C12C3(*)C(*)C(*)C(*)C(*)C(*)C(*)C(*)C*)N=O)O 0.000 description 3
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the invention relates to the field of human therapy, in particular cancer therapy and agents and compositions useful in such therapy.
- Anti-angiogenesis therapies have become an important treatment option for several types of tumors. These therapies have focused on blocking the VEGF pathway (Ferrara et al., Nat Rev Drug Discov. 2004 May;3(5):391 -400.) by neutralizing VEGF (Avastin) or its receptors (Sutent and Sorafinib). Recent studies in mice have shown, that Angiopoietin2 (Ang2), a ligand of the Tie2 receptor, controls vascular remodeling by enabling the functions of other angiogenic factors, such as VEGF.
- Ang2 Angiopoietin2
- Ang2 is primarily expressed by endothelial cells, strongly induced by hypoxia and other angiogenic factors and has been demonstrated to regulate tumor vessel plasticity, allowing vessels to respond to VEGF and FGF2 (Marchin et al., Nat Rev Mol Cell Biol. 2009 Mar; 10(3): 165-77.). Consistent with this role, the deletion or inhibition of Ang2 results in reduced angiogenesis (Falcon et al., Am J Pathol. 2009 Nov; 175(5):2159-70.). Elevated Ang2 serum concentrations have been reported for patients with colorectal cancer, NSCLC and melanoma (Goede et al., Br J Cancer.
- the Ang-Tie system consists of 2 receptors (Tie1 and Tie2) and 3 ligands (Ang1 , Ang2 and Ang4) (Augustin et al., Nat Rev Mol Cell Biol. 2009 Mar; 10(3): 165-77.).
- Tie2 and Ang2 are the best studied members of this family, Tie1 is an orphan receptor and the role of Ang4 for vascular remodelling still needs to be defined.
- Ang2 and Ang1 mediate opposing functions upon Tie2 binding and activation.
- Ang2- mediated Tie2 activation results in endothelial cell activation, pericyte dissociation, vessel leakage and induction of vessel sprouting.
- Ang1 signaling maintains vessel integrity by recruitment of pericytes, thereby maintaining endothelial cell quiescence.
- Angiopoietin 2 (Ang2) is a secreted, 66 kDa ligand for the Tie2 receptor tyrosine kinase (Augustin et al., Nat Rev Mol Cell Biol. 2009 Mar; 10(3): 165-77.).
- Ang2 consists of an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain, the latter is required for Tie2 interaction.
- Ang2 is primarily expressed by endothelial cells and strongly induced by hypoxia and other angiogenic factors, including VEGF. Tie2 is found on endothelial cells, haematopoietic stem cells and tumor cells. Ang2- Tie2 has been demonstrated to regulate tumor vessel plasticity, allowing vessels to respond to VEGF and FGF2.
- Ang2 In vitro Ang2 has been shown to act as a modest mitogen, chemoattractant and inducer of tube formation in human umbilical vein endothelial cells (HUVEC). Ang2 induces tyrosine phosphorylation of ectopically expressed Tie2 in fibroblasts and promotes downstream signaling events, such as phosphorylation of ERK-MAPK, AKT and FAK in HUVEC. An antagonistic role of Ang2 in Ang1 -induced endothelial cell responses has been described.
- Ang2 -deficiency has been shown to result in a profound lymphatic patterning defect in mice. Although the loss of Ang2 is dispensable for embryonic vascular endothelial dysfunction
- Ang2 -deficient mice have persistent vascular defects in the retina and kidney. Together with the dynamic pattern of Ang2 expression at sites of
- angiogenesis for example ovary
- Ang2 controls vascular remodeling by enabling the functions of other angiogenic factors, such as VEGF.
- Ang2-Tie2 The Ang2-Tie2 system exerts crucial roles during the angiogenic switch and later stages of tumor angiogenesis. Ang2 expression is strongly up-regulated in the tumor- associated endothelium. Reduced growth of tumors has been observed when implanted into Ang2 -deficient mice, especially during early stages of tumor growth. Therapeutic blocking of Ang2 with Ang2 mAbs has shown broad efficacy in a variety of tumor xenograft models.
- angiogenesis is implicated in the pathogenesis of a number of disorders, including solid tumors and metastasis.
- angiogenesis appears to be crucial for the transition from hyperplasia to neoplasia, and for providing nourishment for the growth and metastasis of the tumor.
- Folkman et al Nature 339 -58 (1989), which allows the tumor cells to acquire a growth advantage compared to the normal cells. Therefore, anti-angiogenesis therapies have become an important treatment option for several types of tumors. These therapies have focused on blocking the VEGF pathway (Ferrara et al., Nat Rev Drug Discov. 2004 May;3(5):391 -400.
- Notch signaling pathway is important for cell-cell communication, which involves gene regulation mechanisms that control multiple cell differentiation processes during embryonic development and in adult organisms. Notch signaling is dysregulated in many cancers, e.g. in T-cell acute lymphoblastic leukemia and in solid tumors (Sharma et al. 2007, Cell Cycle 6 (8): 927-30; Shih et al., Cancer Res. 2007 Mar 1 ;67(5): 1879-82).
- DII4 (or Delta like 4 or delta-like ligand 4) is a member of the Delta family of Notch ligands.
- the extracellular domain of DII4 is composed of an N-terminal domain, a Delta/Serrate/Lag-2 (DSL) domain, and a tandem of eight epidermal growth factor (EGF)-like repeats.
- DSL Delta/Serrate/Lag-2
- EGF epidermal growth factor
- the EGF domains are recognized as comprising amino acid residues 218-251 (EGF-1 ; domain 1 ), 252-282 (EGF-2; domain 2), 284-322 (EGF-3; domain 3), 324-360 (EGF-4; domain 4), and 362-400 (EGF-5; domain 5), with the DSL domain at about amino acid residues 173-217 and the N-terminal domain at about amino acid residues 27-172 of hDII4 (WO 2008/076379).
- DII4 exhibits highly selective expression by vascular endothelium, in particular in arterial endothelium (Shutter et al. (2000) Genes
- DII4 is induced by VEGF and is a negative feedback regulator that restrains vascular sprouting and branching. Consistent with this role, the deletion or inhibition of DII4 results in excessive angiogenesis (Scehnet et al, Blood. 2007 Jun 1 ; 109(1 1 ):4753-60). This unrestrained angiogenesis paradoxically decreases tumor growth due to the formation of non-productive vasculature, even in tumors resistant to anti-VEGF therapies (Thurston et al, Nat Rev Cancer. 2007 May;7(5):327-31 ;
- VEGF and DII4 are shown to provide superior anti-tumor activity compared to anti-VEGF alone in xenograft models of multiple tumor types (Noguera-Troise et ai, Nature. 2006 Dec 21 ; 444(7122): 1032-7;
- WO2008076379 and OPM-21 M18 (OncoMed) (Hoey et ai, Cell Stem Cell. 2009 Aug 7; 5(2): 168-77), both fully human DII4 antibodies; YW152F (Genentech), a humanized DII4 antibody (Ridgway et ai, Nature. 2006 Dec 21 ; 444(7122): 1083-7); DII4-FC (Regeneron, Sanofi-Aventis), a recombinant fusion protein composed of the extracellular region of DII4 and the Fc region of human lgG1 (Noguera-Troise et ai, Nature. 2006 Dec 21 ;444(7122)).
- MAbs monoclonal antibodies
- fusion proteins have several shortcomings in view of their therapeutic application: To prevent their degradation, they must be stored at near freezing temperatures. Also, since they are quickly digested in the gut, they are not suited for oral administration. Another major restriction of MAbs for cancer therapy is poor transport, which results in low concentrations and a lack of targeting of all cells in a tumor.
- bispecific binding molecules preferably bispecific immunoglobulins, preferably immunoglobulin single variable domains like VHHs and domain antibodies, which comprises at least one DLL4- binding component and at least one Ang2-binding component in a single molecule.
- These bispecific binding molecules may preferably comprise a further binding component, preferably a binding omponent binding to serum albumin.
- a bispecific binding molecule of the invention essentially comprises (i) at least one DII4-binding component specifically binding to at least one epitope of DII4 and (ii) at least one Ang2-binding component specifically binding to at least an epitope of Ang2, wherein the components are linked to each other in such a way that they simultaneously bind to DII4 and Ang2 or that they bind to either DII4 or Ang2 at a time.
- the two components comprise one or more immunoglobulin single variable domains that may be, independently of each other, VHHs or domain antibodies, and/or any other sort of immunoglobulin single variable domains, such as VL domains, as defined herein, provided that each of these immunoglobulin single variable domains will bind the antigen, i.e. DII4 or Ang2, respectively.
- the immunoglobulin single variable domains are of the same type, in particular, all immunoglobulin single variable domains are VHHs or domain antibodies.
- all immunoglobulin single variable domains are VHHs, preferably humanized (or "sequence-optimized", as defined herein) VHHs.
- the invention relates to bispecific binding molecules comprising an (optionally humanized or sequence-optimized) anti-DII4 VHH and an (optionally humanized or sequence-optimized) anti-Ang2 VHH.
- the teaching herein may be applied analogously to bispecific binding molecules including other anti-DII4 or anti-Ang2 immunoglobulin single variable domains, such as domain antibodies.
- the invention relates to nucleic acids encoding the bispecific binding molecules of the invention as well as host cells containing same.
- the invention further relates to a product or composition containing or comprising at least one bispecific binding molecule of the invention and optionally one or more further components of such compositions.
- the invention further relates to methods for preparing or generating the bispecific binding molecules, nucleic acids, host cells, products and compositions described herein.
- the invention further relates to applications and uses of the bispecific binding molecules, nucleic acids, host cells, products and compositions described herein, as well as to methods for the prevention and/or treatment for diseases and disorders that can be modulated by inhibition of DII4.
- the Ang2-binding component of the bispecific binding molecules according to the present invention binds to Ang2 with a potency at least 5,000 times higher, preferably 10,000 times higher than to Ang1 or Ang4. This will largely avoid blocking activation of Ang1 -mediated signalling, which would counter the intended anti-angiogenetic effect.
- the DLL4-binding component of the bi-specific binding molecules according to the present invention binds to DLL4-A with an affinity of at least 1 ,000 times higher than to DIM , Jaggedl and preferably also against Jagged2. Due to this selectivity unwanted side reactions can be avoided.
- the bispecific binding molecules of the present invention are provided as linked VHH domains.
- Such molecules are significantly smaller than conventional antibodies and have thus the potential for penetrating into a tumor deeper than such conventional antibodies. This benefit is further accentuated by the specific sequences disclosed herein after being free of glycosylation sites.
- bispecific binding molecule refers to a molecule comprising at least one Ang2-binding molecule (or “Ang2-binding component”) and at least one DII4-binding molecule (or “DII4-binding component”).
- a bispecific binding molecule may contain more than one Ang2-binding molecule and/or more than one DII4-binding molecule, i.e. in the case that the bispecific binding molecule contains a biparatopic (as defined below) Ang2-binding molecule and/or a biparatopic DII4-binding molecule, in the part of the molecule that binds to Ang2 or to DII4, i.e.
- Ang2-binding component or anti-Ang2 component
- DII4-binding component or anti-DII4 component
- the word “bispecific” in this context is however not to be construed as to exclude further binding components with binding specificity to molecules other than DII4 and Ang2 from the bispecific binding molecule.
- Non-limiting examples of such further binding components are binding components binding to serum albumin.
- immunoglobulin and immunoglobulin sequence whether used herein to refer to a heavy chain antibody or to a
- conventional 4-chain antibody - are used as general terms to include both the full- size antibody, the individual chains thereof, as well as all parts, domains or fragments thereof (including but not limited to antigen-binding domains or fragments such as VHH domains or VH/VL domains, respectively).
- sequence as used herein (for example in terms like “immunoglobulin sequence”, “antibody sequence”, “(single) variable domain sequence”, “VHH sequence” or “protein sequence), should generally be understood to include both the relevant amino acid sequence as well as nucleic acid sequences or nucleotide sequences encoding the same, unless the context requires a more limited interpretation.
- domain (of a polypeptide or protein) as used herein refers to a folded protein structure which has the ability to retain its tertiary structure independently of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins, and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
- immunoglobulin domain refers to a globular region of an antibody chain (such as e.g. a chain of a conventional 4-chain antibody or of a heavy chain antibody), or to a polypeptide that essentially consists of such a globular region. Immunoglobulin domains are characterized in that they retain the
- An immunoglobulin domain comprises (a) variable domain(s), i.e., one or more immunoglobulin variable domains.
- immunoglobulin variable domain means an amino acid sequence of amino acids
- immunoglobulin domain essentially consisting of four "framework regions” which are referred to in the art and hereinbelow as “framework region 1 " or "FR1 "; as
- framework region 2 or"FR2
- framework region 3 or "FR3”
- framework region 4" or "FR4, respectively; which framework regions are interrupted by three “complementarity determining regions” or “CDRs”, which are referred to in the art and hereinbelow as “complementarity determining region 1 "or “CDR1 "; as
- immunoglobulin variable domain can be indicated as follows: FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. It is the immunoglobulin variable domain(s) that confer specificity to an antibody for the antigen by carrying the antigen-binding site.
- immunoglobulin single variable domains like VHHs and domain antibodies are preferred.
- immunoglobulin single variable domain means an immunoglobulin variable domain which is capable of specifically binding to an epitope of the antigen without pairing with an additional variable immunoglobulin domain.
- immunoglobulin single variable domains in the meaning of the present invention are “domain antibodies”, such as the immunoglobulin single variable domains VH and VL (VH domains and VL domains).
- immunoglobulin single variable domains are "VHH domains” (or simply “VHHs”) from camelids, as defined hereinafter.
- the antigen-binding domain of a conventional 4-chain antibody such as an IgG, IgM, IgA, IgD or IgE molecule; known in the art
- a conventional 4-chain antibody such as an IgG, IgM, IgA, IgD or IgE molecule; known in the art
- a Fab fragment, a F(ab')2 fragment, an Fv fragment such as a disulphide linked Fv or a scFv fragment, or a diabody (all known in the art) derived from such conventional 4- chain antibody would normally not be regarded as an immunoglobulin single variable domain, as, in these cases, binding to the respective epitope of an antigen would normally not occur by one (single) immunoglobulin domain but by a pair of
- VHH domains such as light and heavy chain variable domains, i.e. by a VH-VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective antigen.
- VHH domains also known as VHHs, V H H domains, VHH antibody fragments, and VHH antibodies, have originally been described as the antigen binding
- immunoglobulin (variable) domain of "heavy chain antibodies” i.e. of "antibodies devoid of light chains”; Hamers-Casterman C, Atarhouch T, Muyldermans S,
- VHH domain has been chosen in order to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “V H domains” or “VH domains”) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as "V L domains" or “VL domains").
- VHH domains can specifically bind to an epitope without an additional antigen binding domain (as opposed to VH or VL domains in a conventional 4-chain antibody, in which case the epitope is recognized by a VL domain together with a VH domain).
- VHH domains are small, robust and efficient antigen recognition units formed by a single immunoglobulin domain.
- VHH domain VHH, V H H domain, VHH antibody fragment, VHH antibody, as well as “Nanobody®” and “Nanobody® domain”
- Neanobody being a trademark of the company Ablynx N.V.; Ghent;
- VHH immunoglobulin single variable domain
- a immunoglobulin single variable domain e.g. a VHH
- Kabat et al. Sequence of proteins of immunological interest
- US Public Health Services NIH Bethesda, MD, Publication No. 91
- VHH domains from Camelids, as shown e.g. in Figure 2 of Riechmann and Muyldermans, J. Immunol. Methods 231 , 25-38 (1999). According to this numbering,
- - FR1 comprises the amino acid residues at positions 1 -30,
- - CDR1 comprises the amino acid residues at positions 31 -35
- - FR2 comprises the amino acids at positions 36-49
- - CDR2 comprises the amino acid residues at positions 50-65
- - FR3 comprises the amino acid residues at positions 66-94
- - CDR3 comprises the amino acid residues at positions 95-102, and
- - FR4 comprises the amino acid residues at positions 103-1 13.
- the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering).
- the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence.
- the total number of amino acid residues in a VHH domain will usually be in the range of from 1 10 to 120, often between 1 12 and 1 15. It should however be noted that smaller and longer sequences may also be suitable for the purposes described herein.
- Immunoglobulin single variable domains e.g. VHHs and domain antibodies, according to the preferred embodiments of the invention, have a number of unique structural characteristics and functional properties which makes them highly advantageous for use in therapy as functional antigen-binding molecules.
- VHH domains which have been
- immunoglobulin single variable domains as defined herein, like VHHs or VHs (or VLs) - either alone or as part of a larger polypeptide, e.g. a biparatopic molecule - offer a number of significant advantages:
- immunoglobulin single variable domains can be expressed from a single nucleic acid molecule and do not require any post-translational modification (like glycosylation; immunoglobulin single variable domains can easily be engineered into multivalent and multispecific formats (as further discussed herein); immunoglobulin single variable domains have high specificity and affinity for their target, low inherent toxicity and can be administered via alternative routes than infusion or injection; immunoglobulin single variable domains are highly stable to heat, pH, proteases and other denaturing agents or conditions and, thus, may be prepared, stored or transported without the use of refrigeration equipments; immunoglobulin single variable domains are easy and relatively inexpensive to prepare, both on small scale and on a manufacturing scale.
- immunoglobulin single variable domains can be produced using microbial fermentation (e.g. as further described below) and do not require the use of mammalian expression systems, as with for example conventional antibodies; immunoglobulin single variable domains are relatively small (approximately 15 kDa, or 10 times smaller than a conventional IgG) compared to
- conventional 4-chain antibodies and antigen-binding fragments thereof show high(er) penetration into tissues (including but not limited to solid tumors and other dense tissues) and can be administered in higher doses than such conventional 4-chain antibodies and antigen-binding fragments thereof;
- VHHs have specific so-called “cavity-binding properties" (inter alia due to their extended CDR3 loop, compared to VH domains from 4-chain antibodies) and can therefore also access targets and epitopes not accessible to conventional 4-chain antibodies and antigen-binding fragments thereof;
- VHHs have the particular advantage that they are highly soluble and very stable and do not have a tendency to aggregate (as with the mouse-derived antigen-binding domains described by Ward et al., Nature 341 : 544-546 (1989)).
- the immunoglobulin single variable domains of the invention are not limited with respect to a specific biological source from which they have been obtained or to a specific method of preparation.
- obtaining VHHs may include the following steps: (1 ) isolating the VHH domain of a naturally occurring heavy chain antibody; or screening a library comprising heavy chain antibodies or VHHs and isolating VHHs therefrom;
- the immunoglobulin single variable domains of the invention or present in the polypeptides of the invention are VHH domains with an amino acid sequence that essentially corresponds to the amino acid sequence of a naturally occurring VHH domain, but that has been "humanized” or “sequence- optimized” (optionally after affinity-maturation), i.e.
- a humanized VHH domain may contain one or more fully human framework region sequences, and, in an even more specific embodiment, may contain human framework region sequences derived from the human germline Vh3 sequences DP- 29, DP-47, DP-51 , or parts thereof, or be highly homologous thereto, optionally combined with JH sequences, such as JH5.
- a humanization protocol may comprise the replacement of any of the VHH residues with the corresponding framework 1 , 2 and 3 (FRI, FR2 and FR3) residues of germline VH genes such as DP 47, DP 29 and DP 51 ) either alone or in combination.
- Suitable framework regions (FR) of the immunoglobulin single variable domains of the invention can be selected from those as set out e.g.
- KERE immunoglobulin single variable domains having the amino acid sequence G-L-E-W at about positions 44 to 47, and their respective humanized counterparts.
- a humanized VHH domain may contain one or more fully human framework region sequences.
- a humanizing substitution for VHHs belonging to the 103 P,R,S- group and/or the GLEW-group is 108Q to 108L.
- Methods for humanizing immunoglobulin single variable domains are known in the art.
- Binding immunoglobulin single variable domains with improved properties in view of therapeutic application may be obtained from individual binding molecules by techniques known in the art, such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, humanizing, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing, also termed "sequence optimization", as described herein.
- affinity maturation for example, starting from synthetic, random or naturally occurring immunoglobulin sequences
- CDR grafting humanizing, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing, also termed "sequence optimization", as described herein.
- sequence optimization for example, made to standard handbooks, as well as to the
- a binding molecule with increased affinity may be obtained by affinity- maturation of another binding molecule, the latter representing, with respect to the affinity-matured molecule, the "parent" binding molecule.
- VHH domains derived from camelids can be "humanized” (also termed “sequence-optimized” herein, “sequence-optimizing” may, in addition to humanization, encompass an additional modification of the sequence by one or more mutations that furnish the VHH with improved properties, such as the removal of potential post translational modification sites) by replacing one or more amino acid residues in the amino acid sequence of the original VHH sequence by one or more of the amino acid residues that occur at the corresponding position(s) in a VH domain from a conventional 4-chain antibody from a human being.
- a humanized VHH domain can contain one or more fully human framework region sequences, and, in an even more specific embodiment, can contain human framework region sequences derived from DP-29, DP-47, DP-51 , or parts thereof, optionally combined with JH sequences, such as JH5.
- Domain antibodies also known as “Dab”s and “dAbs” (the terms “Domain antibodies”
- Antibodies and "dAbs” being used as trademarks by the GlaxoSmithKline group of companies) have been described in e.g. Ward, E.S., et al:. "Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli"; Nature 341 : 544-546 (1989); Holt, L.J. et al.: “Domain antibodies: proteins for therapy”; TRENDS in Biotechnology 21 (1 1 ): 484-490 (2003); and WO2003/002609.
- Domain antibodies essentially correspond to the VH or VL domains of antibodies from non-camelid mammals, in particular human 4-chain antibodies.
- specific selection for such antigen binding properties is required, e.g. by using libraries of human single VH or VL domain sequences.
- Domain antibodies have, like VHHs, a molecular weight of approximately 13 to approximately 16 kDa and, if derived from fully human sequences, do not require humanization for e.g. therapeutical use in humans. As in the case of VHH domains, they are well expressed also in prokaryotic expression systems, providing a significant reduction in overall manufacturing cost.
- epitopes refer to the part of a macromolecule, such as a polypeptide, that is recognized by antigen-binding molecules, such as conventional antibodies or the polypeptides of the invention, and more particularly by the antigen-binding site of said molecules. Epitopes define the minimum binding site for an immunoglobulin, and thus represent the target of specificity of an immunoglobulin.
- a polypeptide such as an immunoglobulin, an antibody, an immunoglobulin single variable domain of the invention, or generally an antigen-binding molecule or a fragment thereof
- a polypeptide that can "bind to” or “specifically bind to”, that "has affinity for” and/or that "has specificity for” a certain epitope, antigen or protein (or for at least one part, fragment or epitope thereof) is said to be “against' or “directed against' said epitope, antigen or protein or is a "binding" molecule with respect to such epitope, antigen or protein.
- DII4-binding component may also be referred to as "DII4-neutralizing".
- the term "specificity" refers to the number of different types of antigens or epitopes to which a particular antigen-binding molecule or antigen-binding protein (such as an immunoglobulin single variable domain of the invention) molecule can bind.
- the specificity of an antigen-binding molecule can be determined based on its affinity and/or avidity.
- the affinity represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD), is a measure for the binding strength between an epitope and an antigen-binding site on the antigen- binding protein: the lesser the value of the KD, the stronger the binding strength between an epitope and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD).
- affinity can be determined in a manner known per se, depending on the specific antigen of interest.
- Avidity is the measure of the strength of binding between an antigen-binding molecule (such as an immunoglobulin, an antibody, an immunoglobulin single variable domain or a polypeptides containing it and the pertinent antigen. Avidity is related to both the affinity between an epitope and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecule.
- the part of an antigen-binding molecule that recognizes the epitope is called a paratope.
- DII4-binding molecule or "Ang2-binding molecule” includes anti-DII4 or anti-Ang2 antibodies, anti-DII4 antibody or anti-Ang2 antibody fragments, "anti-DII4 antibody-like molecules” or “anti-Ang2 antibody-like molecules”, as defined herein, and conjugates with any of these.
- Antibodies include, but are not limited to, monoclonal and chimerized monoclonal antibodies.
- the term consumerantibody encompasses complete immunoglobulins, like monoclonal antibodies produced by recombinant expression in host cells, as well as antibody fragments or "antibody-like molecules", including single-chain antibodies and linear antibodies, so- called “SMIPs" ("Small Modular Immunopharmaceuticals"), as e.g described in WO 02/056910;
- Antibody-like molecules include immunoglobulin single variable domains, as defined herein.
- Other examples for antibody-like molecules are immunoglobulin super family antibodies (IgSF), or CDR-grafted molecules.
- Ang2-binding molecule or “DII4-binding molecule” respectively, refers to both monovalent target-binding molecules (i.e. molecules that bind to one epitope of the respective target) as well as to bi- or multivalent binding molecules (i.e. binding molecules that bind to more than one epitope, e.g. "biparatopic” molecules as defined hereinbelow).
- Ang2(or DII4)-binding molecules containing more than one Ang2(or DII4)-binding immunoglobulin single variable domain are also termed "formatted" binding molecules, they may, within the target-binding component, in addition to the immunoglobulin single variable domains, comprise linkers and/or moieties with effector functions, e.g. half-life-extending moieties like albumin-binding immunoglobulin single variable domains, and/or a fusion partner like serum albumin and/or an attached polymer like PEG.
- biparatopic Ang2(or DII4)-binding molecule or "biparatopic
- immunoglobulin single variable domain as used herein shall mean a binding molecule comprising a first immunoglobulin single variable domain and a second immunoglobulin single variable domain as herein defined, wherein the two molecules bind to two non-overlapping epitopes of the respective antigen.
- the biparatopic binding molecules are composed of immunoglobulin single variable domains which have different specificities with respect to the epitope.
- the part of an antigen-binding molecule such as an antibody or an immunoglobulin single variable domain of the invention that recognizes the epitope is called a paratope.
- a formatted binding molecule may, albeit less preferred, also comprise two identical immunoglobulin single variable domains or two different immunoglobulin single variable domains that recognize the same or overlapping epitopes or their respective antigen.
- the two immunoglobulin single variable domains may bind to the same or an overlapping epitope in each of the two monomers that form the VEGF dimer.
- the binding molecules of the invention will bind with a dissociation constant (K D ) of 10E-5 to 10E-14 moles/liter (M) or less, and preferably 10E-7 to 10E-14 moles/liter (M) or less, more preferably 10E-8 to 10E-14 moles/liter, and even more preferably 10E-1 1 to 10E-13, as measured e.g. in a Biacore or in a Kinexa assay), and/or with an association constant (K A ) of at least 10E7 ME-1 , preferably at least 10E8 ME-1 , more preferably at least 10E9 ME-1 , such as at least 10E1 1 ME-1 .
- K D value greater than 10E-4 M is generally considered to indicate non-specific binding.
- a polypeptide of the invention will bind to the desired antigen, i.e. VEGF or DII4, respectively, with a K D less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
- K D less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
- Specific binding of an antigen-binding protein to an antigen or epitope can be determined in any suitable manner known per se, including, for example, the assays described herein,
- amino acid residues will be indicated according to the standard three-letter or one- letter amino acid code, as generally known and agreed upon in the art.
- amino acid difference refers to insertions, deletions or substitutions of the indicated number of amino acid residues at a position of the reference sequence, compared to a second sequence.
- substitution(s) will preferably be conservative amino acid substitution(s), which means that an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide.
- conservative amino acid substitutions are well known in the art, for example from WO 98/49185, wherein conservative amino acid substitutions preferably are substitutions in which one amino acid within the following groups (i) - (v) is
- Phe, Tyr and Trp Particularly preferred conservative amino acid substitutions are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gin or into His; Asp into Glu;Cys into Ser; Gin into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gin; lie into Leu or into Val; Leu into lie or into Val; Lys into Arg, into Gin or into Glu; Met into Leu, into Tyr or into lie; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser;Trp into Tyr; Tyr into Trp or into Phe; Val into lie or into Leu.
- a polypeptide or nucleic acid molecule is considered to be "(in) essentially isolated (form)" - for example, when compared to its native biological source and/or the reaction medium or cultivation medium from which it has been obtained - when it has been separated from at least one other component with which it is usually associated in said source or medium, such as another protein/polypeptide, another nucleic acid, another biological component or macromolecule or at least one contaminant, impurity or minor component.
- a polypeptide or nucleic acid molecule is considered “essentially isolated” when it has been purified at least 2-fold, in particular at least 10-fold, more in particular at least 100-fold, and up to 1000-fold or more.
- a polypeptide or nucleic acid molecule that is "in essentially isolated form” is preferably essentially homogeneous, as determined using a suitable technique, such as a suitable chromatographical technique, such as polyacrylamide gel electrophoresis.
- Sequence identity between two DII4-binding molecule sequences or between two Ang2-binding molecule sequences indicates the percentage of amino acids that are identical between the sequences. It may be calculated or determined as described in paragraph f) on pages 49 and 50 of WO 2008/020079. “Sequence similarity” indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions.
- An "affinity-matured" DII4-binding molecule or Ang2-binding molecule in particular a VHH or a domain antibody, has one or more alterations in one or more CDRs which result in an improved affinity for DII4 or Ang2, as compared to the respective parent DII4-binding molecule or Ang2-binding molecule.
- Afffinity-matured DII4-binding molecules or Ang2-binding molecules of the invention may be prepared by methods known in the art, for example, as described by Marks et al., 1992, Biotechnology 10:779-783, or Barbas, et al., 1994, Proc. Nat. Acad. Sci, USA 91 : 3809-3813.; Shier et al., 1995, Gene 169:147-155; Yelton et al., 1995, Immunol. 155: 1994-2004;
- an "amino acid sequences of SEQ ID NO: x” includes, if not otherwise stated, an amino acid sequence that is 100% identical with the sequence shown in the respective SEQ ID NO: x; a) amino acid sequences that have at least 80% amino acid identity with the sequence shown in the respective SEQ ID NO: x; b) amino acid sequences that have 3, 2, or 1 amino acid differences with the sequence shown in the respective SEQ ID NO: x.
- the terms “cancer” and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation.
- cancers to be treated with a bispecific binding molecule of the invention include but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers, as suggested for treatment with DII4 antagonists in US 2008/0014196, include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous
- carcinoma of the lung cancer of the peritoneum, hepatocellular cancer,
- pancreatic cancer pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic
- Neoplasties include but are not limited those described above.
- Non-neoplastic disorders include, but are not limited to, as suggested for treatment with DII4 antagonists in US 2008/0014196, undesired or aberrant hypertrophy, arthritis, rheumatoid arthritis (RA), psoriasis, psoriatic plaques, sarcoidosis, atherosclerosis, atherosclerotic plaques, diabetic and other proliferative retinopathies including retinopathy of prematurity, retrolental fibroplasia, neovascular glaucoma, age-related macular degeneration, diabetic macular edema, corneal
- neovascularization corneal graft neovascularization, corneal graft rejection, retinal/choroidal neovascularization, neovascularization of the angle (rubeosis), ocular neovascular disease, vascular restenosis, arteriovenous malformations (AVM), meningioma, hemangioma, angiofibroma, thyroid hyperplasias (including Grave's disease), corneal and other tissue transplantation, chronic inflammation, lung inflammation, acute lung injury/ ARDS, sepsis, primary pulmonary hypertension, malignant pulmonary effusions, cerebral edema (e.g., associated with acute stroke/ closed head injury/ trauma), synovial inflammation, pannus formation in RA, myositis ossificans, hypertropic bone formation, osteoarthritis (OA), refractory ascites, polycystic ovarian disease, endometriosis, 3 rd spacing of fluid diseases (pancreatitis,
- the present invention relates to a bispecific binding molecule comprising at least one DII4-binding component and at least one Ang2-binding component.
- the present invention relates to a bispecific binding molecule comprising at least one DII4-binding component and at least one Ang2- binding component which further comprises at least a further binding component, preferably a serum albumin binding component (serum albumin binding molecule).
- the serum albumin binding component of the binding molecule of the present invention is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said immunoglobulin single variable domains, wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 522, 525, 528, 531 , 534, 537, or 540.
- said one or more immunoglobulin single variable domain of the serum albumin binding component contain a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 522, 525, 528, 531 , 534, 537, or 540; a CDR1 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs: 520, 523, 526; 529, 532, 535, or 538; c. a CDR2 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs: 521 , 524, 527, 530, 533, 536, or 539.
- said one or more immunoglobulin single variable domains of the serum albumin binding component are VHHs, preferably having an amino acid sequence shown in SEQ ID NOs: 98 or 519.
- said DII4-binding component and said
- Ang2-binding component comprise at least one DII4-binding immunoglobulin single variable domain and at least one Ang2-binding immunoglobulin single variable domain, respectively.
- each of said immunoglobulin single variable domains has four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively.
- the anti-DII4 and/or the anti-Ang2 component contained in the bispecific binding molecules of the invention may include two (or more) anti-DII4 (or anti-Ang2, respectively) immunoglobulin single variable domains, wherein the immunoglobulin single variable domains are directed against different epitopes within the DII4 (or Ang2) target.
- the two immunoglobulin single variable domains in a bispecific binding molecule will have different antigen specificity and therefore different CDR sequences.
- bivalent binding molecules are also named "biparatopic single domain antibody constructs" (if the immunoglobulin single variable domains consist or essentially consist of single domain antibodies), or "biparatopic VHH constructs” (if the immunoglobulin single variable domains consist or essentially consist of VHHs), respectively, as the two immunoglobulin single variable domains will include two different paratopes.
- one or both of the binding molecules may be bivalent; e.g. the Ang2-binding component may be biparatopic and the DII4-binding component may be one immunoglobulin single variable domain, or the Ang2-binding component may be one immunoglobulin single variable domain and the DII4-binding component may be biparatopic.
- bispecific binding molecules of the invention it is preferably the Ang2-binding component that contains a bivalent Ang2-binding immunoglobulin single variable domain, e.g. a biparatopic VHH.
- the DII4-binding component comprises at least a variable domain with four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively, wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in a) SEQ ID NOs: 1 to 166 and 458, b) SEQ ID NOs: 333 to 353, or c) SEQ ID NOs: 375 to 395.
- amino acid sequence a selected from a first group of SEQ ID NOs: 1 to166 and 458, is contained as partial sequence in a corresponding amino acid sequence selected from a second group of sequences shown in Table 5 and in SEQ ID NO: 167 to 332 and 459.
- said DII4-binding component is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said
- immunoglobulin single variable domains wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in a) SEQ ID NOs: 1 to 166 and 458, b) SEQ ID NOs: 333 to 353, or c) SEQ ID NOs: 375 to 395.
- said immunoglobulin single variable domain has a) a CDR3 with an amino acid sequence selected a said first group of
- the immunoglobulin single variable domain is a VHH.
- the VHH has an amino acid sequence selected from amino acid sequences shown in Table 5 and in SEQ ID NOs: 167 to 332 and 459.
- the Ang2-binding component comprises at least a variable domain with four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively, wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 491 , 494, 497, 500, 503, 506, 509, 512, 515, or 518.
- said Ang2-binding component is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said
- immunoglobulin single variable domains wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1 , CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 491 , 494, 497, 500, 503, 506, 509, 512, 515, or 518
- said immunoglobulin single variable domain of the Ang2-binding component contains a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 491 , 494, 497, 500, 503, 506, 509, 512, 515, or 518 (see also Table 36); b. a CDR1 with an amino acid sequences that is contained, as indicated in Table 22-A or 28, as partial sequence in a sequence selected from a second group of amino acid sequences shown SEQ ID NOs: 489, 492, 495, 498, 501 , 504,
- VHH preferably having amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 479, 480, 481 , 482, 483, 484, 485, 486, 487, or 488.
- the immunoglobulin single variable domain of the Ang2-binding component has been obtained by affinity maturation or humanization of an immunoglobulin single variable domain as described herein.
- the present invention also relates to a VHH which has been obtained by affinity maturation or humanization of a VHH of the Ang2-binding component as described herein.
- the present invention thus also relates to an Ang2-binding VHH with an amino acid sequence selected from acid sequences shown in SEQ ID NOs: 479, 480, 481 , 482, 483, 484, 485, 486, 487, or 488.
- DII4-and/or Ang2-binding components with improved properties in view of therapeutic application may be obtained from individual DII4- or Ang2-binding components of the invention by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, humanizing, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing.
- affinity maturation for example, starting from synthetic, random or naturally occurring immunoglobulin sequences
- CDR grafting CDR grafting
- humanizing humanizing
- combining fragments derived from different immunoglobulin sequences PCR assembly using overlapping primers
- similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing.
- a DII4-binding component of the invention with increased affinity is obtained by affinity-maturation of another DII4-binding component, the latter representing, with respect to the affinity-matured molecule, the "parent" DII4-binding component.
- affinity-maturation of another DII4-binding component representing, with respect to the affinity-matured molecule, the "parent" DII4-binding component.
- a DII4-or Ang2-binding molecule of the invention is an immunoglobulin single variable domain that has been obtained by affinity maturation of a parent immunoglobulin single variable domain defined above.
- the invention relates to an immunoglobulin single variable domain obtained by affinity-maturation of a VHH.
- Suitable parent DII4-binding components for affinity maturation are, by way of example, the above-described VHHs with amino acid sequences shown in SEQ ID NOs: 167 to 332 and 459.
- Suitable parent Ang2-binding components for affinity maturation are, by way of example, the above-described VHHs with amino acid sequences shown in SEQ ID NOs:479, 480, 481 , 482, 483, or 484.
- the invention also relates to Ang2-binding molecules that have been obtained by affinity maturation and/or sequence optimization of an above-defined VHH, e.g. to a VHH that has been obtained by sequence optimization of a VHH having an amino acid sequence shown as SEQ ID NOs: 482, 483, 484, 485, 486, 487, 488.
- the "source” amino acid sequences that were used to generate the latter VHHs are shown in SEQ ID NOs: 479, 480, or 481 .
- these amino acid sequences are suitable Ang2-binding components that can be applied in the binding molecules of the present invention.
- the binding molecule of the present invention preferably comprises at least one serum albumin binding component.
- Particularly preferred binding molecules thus have at least one DII4-binding component, at least one Ang2- binding component and at least one serum albumin binding component.
- the order of these three binding components could be any possible order such as the order set out in Figure 16 or 23, e.g., the DII4-, Ang2-or serum albumin binding component can be N-terminal or C-terminal.
- "00042", “00045” or “00050” as referred to in the legend of Figure 16 stand for Ang2-binding components
- “00018” stands for a DII4-binding component
- AB1 1 stands for a serum albumin binding component. None of them is to be construed to a specific sequence, but stands for a Ang2-, DII4- and serum albumin binding component in general when used in the context of possible set-ups of binding molecules of the present invention.
- the serum albumin binding component is in between the DII4- and Ang2-binding component (or vice versa), while it is particularly preferred that at least one Ang2-binding component is N-terminal, followed by at least one serum albumin binding component, followed by at least one DII4-binding component at the C-Terminus.
- This set-up is shown to be specifically useful.
- the present invention relates thus in a preferred aspect to binding molecules comprising at least one DII4-binding component, at least one Ang2-binding
- At least one binding component when used herein includes that a binding molecule of the present invention may contain one, two, three, four or five Ang2-, DII4, and/or serum albumin binding components (i.e., entities/units) which are preferably represented by an immunoglobulin singly variable domain as described herein.
- the invention relates to a DII4 immunoglobulin single variable domain that has been obtained by affinity maturation of a VHH with an amino acid sequence shown in SEQ ID NO: 197.
- said immunoglobulin single variable domain that is derived from a VHH with the amino acid sequence shown in SEQ ID NO: 197 is selected from immunoglobulin single variable domains with amino acid sequences shown in SEQ ID NOs: 354 to 374.
- the immunoglobulin single variable domain is a VHH with an amino acid sequence shown in SEQ ID NO: 358.
- the immunoglobulin single variable domain has been obtained by humanization of a VHH with an amino acid sequence shown in SEQ ID NO: 358.
- the immunoglobulin single variable domain is a VHH with an amino acid sequence shown in SEQ ID NO: 356.
- the invention relates to an immunoglobulin single variable domain that has been obtained by humanization of a VHH with an amino acid sequence shown in SEQ ID NO: 356.
- the invention relates to an immunoglobulin single variable domain that has been obtained by affinity maturation of a VHH with an amino acid sequence shown in SEQ ID NO: 224.
- said immunoglobulin single variable domain derived from a VHH with the amino acid sequence shown in SEQ ID NO: 224 is selected from immunoglobulin single variable domains with amino acid sequences shown in SEQ ID NOs: 396 to 416.
- the immunoglobulin single variable domain is a VHH with an amino acid sequence shown in SEQ ID NO: 402.
- the immunoglobulin single variable domain has been obtained by humanization of the VHH with the amino acid sequence shown in SEQ ID NO: 402.
- the immunoglobulin single variable domain is a VHH with an amino acid sequence shown in SEQ ID NO: 416.
- the immunoglobulin single variable domain has been obtained by humanization of the immunoglobulin single variable domain with the amino acid sequence shown in SEQ ID NO: 416
- the immunoglobulin single variable domain is a VHH with an amino acid sequence shown in SEQ ID NO:407.
- the immunoglobulin single variable domain has been obtained by humanization of the immunoglobulin single variable domain with the amino acid sequence shown in SEQ ID NO: 413.
- the immunoglobulin single variable domain is a VH domain, as defined herein.
- the representatives of the class of DII4-and/or Ang2- binding immunoglobulin single variable domains of the invention or present in the polypeptides of the invention have amino acid sequences that correspond to the amino acid sequence of a naturally occurring VH domain that has been "camelized", i.e. by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring variable heavy chain from a conventional 4-chain antibody by one or more amino acid residues that occur at the corresponding position(s) in a VHH domain of a heavy chain antibody.
- This can be performed in a manner known per se, which will be clear to the skilled person, and reference is additionally be made to WO 1994/04678.
- Such camelization may preferentially occur at amino acid positions which are present at the VH-VL interface and at the so-called Camelidae Hallmark residues (see for example also WO 1994/04678).
- a detained description of such "humanization” and “camelization” techniques and preferred framework region sequences consistent therewith can additionally be taken from e.g. pp. 46 and pp. 98 of WO 2006/040153 and pp. 107 of WO 2006/122786.
- the DII4-or Ang2-binding components of the invention e.g. immunoglobulin single variable domains and or polypeptides containing them, have specificity for DII4 or Ang2, respectively, in that they comprise one or more immunoglobulin single variable domains specifically binding to one or more epitopes within the DII4 or Ang2 molecule, respectively.
- Specific binding of an DII4-and/or Ang2 binding component to its antigen DII4 or Ang2, respectively, can be determined in any suitable manner known per se, including, for example, the assays described herein, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme
- a DII4-binding component of the invention e.g. an immunoglobulin single variable domain
- the immunoglobulin single variable domains of the invention or polypeptides containing them preferably bind to human DII4, if intended for therapeutic purposes in humans.
- immunoglobulin single variable domains that bind to DII4 from another mammalian species, or polypeptides containing them are also within the scope of the invention.
- An immunoglobulin single variable domain of the invention binding to one species form of DII4 may cross-react with DII4 from one or more other species.
- immunoglobulin single variable domains of the invention binding to human DII4 may exhibit cross reactivity with DII4 from one or more other species of primates and/or with DII4 from one or more species of animals that are used in animal models for diseases, for example monkey (in particular Cynomolgus or Rhesus), mouse, rat, rabbit, pig, dog or) and in particular in animal models for diseases and disorders associated with DII4-mediated effects on angiogenesis (such as the species and animal models mentioned herein).
- Immunoglobulin single variable domains of the invention that show such cross-reactivity are advantageous in a research and/or drug development, since it allows the immunoglobulin single variable domains of the invention to be tested in acknowledged disease models such as monkeys, in particular Cynomolgus or Rhesus, or mice and rats. The same is true for Ang2.
- the DII4-binding components of the invention are not limited to or defined by a specific domain or an antigenic determinant of DII4 against which they are directed.
- a DII4-binding component recognizes an epitope in a region of the DII4 of interest that has a high degree of identity with human DII4.
- an immunoglobulin single variable domain of the invention recognizes an epitope which is, totally or in part, located within the EGF-2 domain, which shows a high identity between human and mouse. The same is true for Ang2.
- the invention relates to a DII4- binding component, in particular an immunoglobulin single variable domain or a polypeptide containing same, wherein said immunoglobulin single variable domain is selected from the group that binds to an epitope that is totally or partially contained within the EGF-2 domain that corresponds to amino acid residues 252-282 of SEQ ID NO: 417.
- a polypeptide of the invention is a biparatopic molecule as defined herein, which contains more than one immunoglobulin single variable domain of the invention, at least one of the immunoglobulin single variable domain components binds to the epitope within the EGF-2 domain, as defined above.
- an immunoglobulin single variable domain of the invention binds to DII4 and/or Ang2 with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM (as determined by Surface Plasmon Resonance analysis, as described in Example 5.7).
- the immunoglobulin single variable domains of the invention have IC50 values, as measured in a competition ELISA assay as described in Example 5.1 . in the range of 10 "6 to 10 "10 moles/litre or less, more preferably in the range of 10 "8 to 10 "10 moles/litre or less and even more preferably in the range of 10 "9 to 10 "10 moles/litre or less.
- DII4-binding immunoglobulin single variable domains of the invention or polypeptides containing them bind to DII4 with an dissociation constant (K D ) of 10 "5 to 10 "12 moles/liter (M) or less, and preferably 10 "7 to 10 "12 moles/liter (M) or less and more preferably 10 "8 to 10 "12 moles/liter (M), and/or with an association constant (K A ) of at least 10 7 M "1 , preferably at least 10 8 M “1 , more preferably at least 10 9 M “1 , such as at least 10 12 M "1 ; and in particular with a K D less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
- K D and K A values of the immunoglobulin single variable domain of the invention against DII4 can be
- the invention relates to DII4-binding components comprising two or more immunoglobulin single variable domains that bind to the antigen DII4 or Ang2, respectively, at different non-overlapping epitopes. More specifically, such polypeptide of the invention essentially consists of or comprises (i) a first
- such polypeptide of the invention comprises or essentially consists of two or more immunoglobulin single variable domains that are directed against at least two different epitopes present in DII4/Ang2, wherein said immunoglobulin single variable domains are linked to each other in such a way that they are capable of simultaneously binding DII4/Ang2.
- polypeptide of the invention can also be regarded as a "bivalent” or “multivalent” immunoglobulin construct, and especially as a “multivalent immunoglobulin single variable domain construct", in that the polypeptide contains at least two binding sites for DII4/Ang2.
- Such DII4-binding component of the invention includes (at least) two anti-DII4 immunoglobulin single variable domains, wherein (the) two immunoglobulin single variable domains are directed against different epitopes within the DII4 molecule.
- these two immunoglobulin single variable domains will have a different antigen specificity and therefore different CDR sequences.
- polypeptides of the invention will herein also be named "biparatopic polypeptides", or “biparatopic single domain antibody constructs” (if the immunoglobulin single variable domains consist or essentially consist of single domain antibodies), or "biparatopic VHH constructs” (if the immunoglobulin single variable domains consist or essentially consist of VHHs), respectively, as the two immunoglobulin single variable domains will include two different paratopes.
- Ang2 mutatis mutandis.
- the polypeptide of the invention includes more than two anti-DII4 immunoglobulin single variable domains, i.e. three, four or even more anti-DII4 immunoglobulin single variable domains
- at least two of the anti-DII4 immunoglobulin single variable domains are directed against different epitopes within the DII4 molecule, wherein any further immunoglobulin single variable domain may bind to any of these two different epitopes and/or a further epitope present in the DII4 molecule.
- Ang2 mutatis mutandis.
- the two or more immunoglobulin single variable domains can be, independently of each other, VHs or VHHs, and/or any other sort of immunoglobulin single variable domains, such as VL domains, as defined herein, provided that these immunoglobulin single variable domains will bind the antigen, i.e. DII4 or Ang2, respectively.
- the detailed description of the binding components is primarily provided for the DII4- binding component. However, all features and options outlined herein for the DII4- binding component also apply equivalently for the Ang2-binding component, mutatis mutandis.
- the binding molecules present in the bispecific binding molecules may be connected with each other directly (i.e. without use of a linker) or via a linker.
- the linker is preferably a linker peptide and will be selected so as to allow binding of the two different binding molecules to each of non-overlapping epitopes of the targets, either within one and the same target molecule, or within two different molecules.
- linkers within the Ang2- or the DII4-binding component will inter alia depend on the epitopes and, specifically, the distance between the epitopes on the target to which the immunoglobulin single variable domains bind, and will be clear to the skilled person based on the disclosure herein, optionally after some limited degree of routine experimentation.
- Two binding molecules may be linked to each other via an additional VHH or domain antibody, respectively (in such binding molecules, the two or more immunoglobulin single variable domains may be linked directly to said additional immunoglobulin single variable domain or via suitable linkers).
- an additional VHH or domain antibody may for example be a VHH or domain antibody that provides for an increased half-life.
- the latter VHH or domain antibody may be one that is capable of binding to a (human) serum protein such as (human) serum albumin or (human) transferrin.
- the two or more immunoglobulin single variable domains that bind to the respective target may be linked in series (either directly or via a suitable linker) and the additional VHH or domain antibody (which may provide for increased half-life) may be connected directly or via a linker to one of these two or more aforementioned immunoglobulin sequences.
- Suitable linkers are described herein in connection with specific polypeptides of the invention and may - for example and without limitation - comprise an amino acid sequence, which amino acid sequence preferably has a length of 9 or more amino acids, more preferably at least 17 amino acids, such as about 20 to 40 amino acids.
- the upper limit is not critical but is chosen for reasons of convenience regarding e.g. biopharmaceutical production of such polypeptides.
- the linker sequence may be a naturally occurring sequence or a non-naturally occurring sequence. If used for therapeutic purposes, the linker is preferably non- immunogenic in the subject to which the bispecific binding molecule of the invention is administered.
- One useful group of linker sequences are linkers derived from the hinge region of heavy chain antibodies as described in WO 1996/34103 and WO 1994/04678. Other examples are poly-alanine linker sequences such as Ala- Ala- Ala.
- linker sequences are Gly/Ser linkers of different length such as (gly x ser y ) z linkers, including (gly 4 ser) 3 , (gly ser) , (gly 4 ser), (gly 3 ser), gly 3 , and (gly 3 ser 2 ) 3 .
- linkers are shown in Figures 40 and 48, e.g. the linkers
- GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS 35GS; SEQ ID NO: 90; GGGGSGGGS (9GS; SEQ ID NO: 91 );
- the linker sequence preferably includes an amino acid residue, such as a cysteine or a lysine, allowing such modification, e.g. PEGylation, in the linker region.
- linkers useful for PEGylation are:
- GGGGCGGGS ("GS9,C5", SEQ ID NO:93);
- linker may also be a poly(ethylene glycol) moiety, as shown in e.g. WO 2004/081026.
- the immunoglobulin single variable domains are linked to each other via another moiety (optionally via one or two linkers), such as another polypeptide which, in a preferred but non-limiting embodiment, may be a further immunoglobulin single variable domain as described above.
- another moiety may either be essentially inactive or may have a biological effect such as improving the desired properties of the polypeptide or may confer one or more additional desired properties to the polypeptide.
- the moiety may improve the half-life of the protein or polypeptide, and/or may reduce its immunogenicity or improve any other desired property.
- a bispecific binding molecule of the invention includes, especially when intended for use or used as a therapeutic agent, a moiety which extends the half-life of the polypeptide of the invention in serum or other body fluids of a patient.
- the term "half-life" is defined as the time it takes for the serum concentration of the (modified) polypeptide to reduce by 50%, in vivo, for example due to degradation of the polypeptide and/or clearance and/or sequestration by natural mechanisms.
- such half-life extending moiety can be covalently linked to or fused to an immunoglobulin single variable domain and may be, without limitation, an Fc portion, an albumin moiety, a fragment of an albumin moiety, an albumin binding moiety, such as an anti-albumin immunoglobulin single variable domain, a transferrin binding moiety, such as an anti-transferrin immunoglobulin single variable domain, a polyoxyalkylene molecule, such as a polyethylene glycol molecule, an albumin binding peptide or a hydroxyethyl starch (HES) derivative.
- an immunoglobulin single variable domain may be, without limitation, an Fc portion, an albumin moiety, a fragment of an albumin moiety, an albumin binding moiety, such as an anti-albumin immunoglobulin single variable domain, a transferrin binding moiety, such as an anti-transferrin immunoglobulin single variable domain, a polyoxyalkylene molecule, such as a polyethylene glycol molecule,
- the bispecific binding molecule of the invention comprises a moiety which binds to an antigen found in blood, such as serum albumin, serum immunoglobulins, thyroxine-binding protein, fibrinogen or transferrin, thereby conferring an increased half-life in vivo to the resulting polypeptide of the invention.
- an antigen found in blood such as serum albumin, serum immunoglobulins, thyroxine-binding protein, fibrinogen or transferrin
- such moiety is an albumin-binding immunoglobulin and, especially preferred, an albumin-binding immunoglobulin single variable domain such as an albumin-binding VHH domain.
- albumin-binding immunoglobulin single variable domain preferably binds to human serum albumin and preferably is a humanized albumin-binding VHH domain.
- Immunoglobulin single variable domains binding to human serum albumin are known in the art and are described in further detail in e.g. WO 2006/122786.
- useful albumin binding VHHs are ALB 1 and its humanized counterpart, ALB 8 (WO 2009/095489).
- Other albumin binding VHH domains mentioned in the above patent publication may, however, be used as well.
- a specifically useful albumin binding VHH domain is ALB8 which consists of or contains the amino acid sequence shown in SEQ ID NO: 98 or 519.
- the two immunoglobulin single variable domains may be fused to a serum albumin molecule, such as described e.g. in WO01/79271 and WO03/59934.
- the fusion protein may be obtained by conventional recombinant technology: a DNA molecule coding for serum albumin, or a fragment thereof, is joined to the DNA coding for the bispecific binding molecule, the obtained construct is inserted into a plasmid suitable for expression in the selected host cell, e.g. a yeast cell like Pichia pastoris or a bacterial cell, and the host cell is then transfected with the fused nucleotide sequence and grown under suitable conditions.
- the sequence of a useful HSA is shown in SEQ ID NO: 99.
- a half-life extending modification of a polypeptide of the invention comprises attachment of a suitable pharmacologically acceptable polymer, such as straight or branched chain poly(ethylene glycol) (PEG) or derivatives thereof (such as methoxypoly(ethylene glycol) or mPEG).
- PEG poly(ethylene glycol)
- derivatives thereof such as methoxypoly(ethylene glycol) or mPEG.
- any suitable form of PEGylation can be used, such as the PEGylation used in the art for antibodies and antibody fragments (including but not limited to domain antibodies and scFv's); reference is made, for example, to: Chapman, Nat. Biotechnol., 54, 531 -545 (2002); Veronese and Harris, Adv. Drug Deliv. Rev. 54, 453-456 (2003); Harris and Chess, Nat. Rev. Drug. Discov. 2 (2003); and WO 2004/060965.
- reagents for PEGylation of polypeptides are also commercially available, for example from Nektar Therapeutics, USA, or NOF Corporation, Japan, such as the Sunbright® EA Series, SH Series, MA Series, CA Series, and ME Series, such as Sunbright® ME-100MA, Sunbright® ME-200MA, and Sunbright® ME-400MA.
- site-directed PEGylation is used, in particular via a cysteine-residue (see for example Yang et al., Protein Engineering 16, 761 -770 (2003)).
- PEG may be attached to a cysteine residue that naturally occurs in a polypeptide of the invention
- a polypeptide of the invention may be modified so as to suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the N- and/or C-terminus of a polypeptide of the invention, all using techniques of protein engineering known per se to the skilled person.
- a PEG is used with a molecular weight of more than 5 kDa, such as more than 10 kDa and less than 200 kDa, such as less than 100 kDa; for example in the range of 20 kDa to 80 kDa.
- the invention also encompasses any bispecific binding molecule that has been PEGylated at one or more amino acid positions, preferably in such a way that said PEGylation either (1 ) increases the half-life in vivo; (2) reduces immunogenicity; (3) provides one or more further beneficial properties known per se for PEGylation; (4) does not essentially affect the affinity of the polypeptide for its target (e.g. does not reduce said affinity by more than 50 %, and more preferably not by more than 10%, as determined by a suitable assay described in the art); and/or (4) does not affect any of the other desired properties of the bispecific binding molecules of the invention.
- Suitable PEG- groups and methods for attaching them, either specifically or non-specifically, will be clear to the skilled person.
- Various reagents for PEGylation of polypeptides are also commercially available, for example from Nektar Therapeutics, USA, or NOF
- Sunbright® EA Series such as the Sunbright® EA Series, SH Series, MA Series, CA Series, and ME Series, such as Sunbright® ME-100MA, Sunbright® ME-200MA, and Sunbright® ME-400MA.
- a PEGylated polypeptide of the invention includes one PEG moiety of linear PEG having a molecular weight of 40 kDa or 60 kDa, wherein the PEG moiety is attached to the polypeptide in a linker region and, specifially, at a Cys residue at position 5 of a GS9- linker peptide as shown in SEQ ID NO:93, at position 14 of a GS27-linker peptide as shown in SEQ ID NO:95, or at position 15 of a GS35-linker peptide as shown in SEQ ID NO:96, or at position 5 of a 35GS-linker peptide as shown in SEQ ID NO:97.
- a bispecific binding molecule of the invention may be PEGylated with one of the PEG reagents as mentioned above, such as "Sunbright® ME-400MA", as shown in the following chemical formula:
- Bispecific binding molecules that contain linkers and/or half-life extending functional groups are shown in SEQ ID NO: 81 and in Figure 48.
- the immunoglobulin single variable domains are domain antibodies, as defined herein.
- Immunoglobulin single variable domains present in the bispecific binding molecules of the invention may also have sequences that correspond to the amino acid sequence of a naturally occurring VH domain that has been "camelized", i.e. by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring variable heavy chain from a conventional 4-chain antibody by one or more amino acid residues that occur at the corresponding position(s) in a VHH domain of a heavy chain antibody. This can be performed in a manner known per se, which will be clear to the skilled person, and reference is additionally be made to WO 94/04678.
- Such camelization may preferentially occur at amino acid positions which are present at the VH-VL interface and at the so-called Camelidae Hallmark residues (see for example also WO 94/04678).
- a detained description of such "humanization” and “camelization” techniques and preferred framework region sequences consistent therewith can additionally be taken from e.g. pp. 46 and pp. 98 of WO 2006/040153 and pp. 107 of WO 2006/122786.
- the binding components have specificity for Ang2 or DII4, respectively, in that they comprise in a preferred embodiment one or more immunoglobulin single variable domains specifically binding to one or more epitopes within the Ang2 molecule or within the DII4 molecule, respectively.
- RIA radioimmunoassays
- EIA enzyme immunoassays
- ELISA sandwich competition assays
- an immunoglobulin single variable domain is not limited with regard to the species.
- the immunoglobulin single variable domains preferably bind to human Ang2 or to human DII4,
- immunoglobulin single variable domains that bind to Ang2 or DII4, respectively, from another mammalian species, or polypeptides containing them, are also within the scope of the invention.
- An immunoglobulin single variable domain binding to one species form of Ang2 or DII4 may cross-react with the respective antigen from one or more other species.
- immunoglobulin single variable domains binding to the human antigen may exhibit cross reactivity with the respective antigen from one or more other species of primates and/or with the antigen from one or more species of animals that are used in animal models for diseases, for example monkey (in particular Cynomolgus or Rhesus), mouse, rat, rabbit, pig, dog or) and in particular in animal models for diseases and disorders that can be modulated by inhibition of Ang2 (such as the species and animal models mentioned herein).
- Immunoglobulin single variable domains of the invention that show such cross-reactivity are advantageous in a research and/or drug development, since it allows the
- the binding components are not limited to or defined by a specific domain or an antigenic determinant of the antigen against which they are directed.
- a binding component recognizes an epitope in a region of the the respective antigen that has a high degree of identity with the human antigen.
- an anti-Ang2 in view of using a mouse model, an anti-Ang2
- the bispecific binding molecule of the invention comprises a DII4-binding molecule which is an immunoglobulin single variable domain that is selected from the group that binds to an epitope that is totally or partially contained within the EGF-2 domain that corresponds to amino acid residues 252-282 of SEQ ID NO: 101 .
- nucleic acid molecules that encode bispecific binding molecules of the invention.
- nucleic acid molecules will also be referred to herein as "nucleic acids of the invention” and may also be in the form of a genetic construct, as defined herein.
- a nucleic acid of the invention may be genomic DNA, cDNA or synthetic DNA (such as DNA with a codon usage that has been specifically adapted for expression in the intended host cell or host organism).
- the nucleic acid of the invention is in essentially isolated form, as defined hereabove.
- the nucleic acid of the invention may also be in the form of, may be present in and/or may be part of a vector, such as for example a plasmid, cosmid or YAC.
- the vector may especially be an expression vector, i.e. a vector that can provide for expression of the bispecific binding molecule in vitro and/or in vivo (i.e. in a suitable host cell, host organism and/or expression system).
- Such expression vector generally comprises at least one nucleic acid of the invention that is operably linked to one or more suitable regulatory elements, such as promoter(s), enhancer(s), terminator(s), and the like. Such elements and their selection in view of expression of a specific sequence in a specific host are common knowledge of the skilled person.
- regulatory elements and other elements useful or necessary for expressing bispecific binding molecules of the invention such as promoters, enhancers, terminators, integration factors, selection markers, leader sequences, reporter genes, and the like, are disclosed e.g. on pp. 131 to 133 of
- the nucleic acids of the invention may be prepared or obtained in a manner known per se (e.g. by automated DNA synthesis and/or recombinant DNA technology), based on the information on the amino acid sequences for the polypeptides of the invention given herein, and/or can be isolated from a suitable natural source.
- the invention relates to host cells that express or that are capable of expressing one or more bispecific binding molecules of the invention; and/or that contain a nucleic acid of the invention.
- said host cells are bacterial cells; other useful cells are yeast cells, fungal cells or mammalian cells.
- Suitable bacterial cells include cells from gram-negative bacterial strains such as strains of Escherichia coli, Proteus, and Pseudomonas, and gram-positive bacterial strains such as strains of Bacillus, Streptomyces, Staphylococcus, and Lactococcus.
- Suitable fungal cell include cells from species of Trichoderma, Neurospora, and Aspergillus.
- Suitable yeast cells include cells from species of Saccharomyces (Tor example Saccharomyces cerevisiae), Schizosaccharomyces (for example
- Pichia for example Pichia pastoris and Pichia methanolica
- Hansenula Hansenula
- Suitable mammalian cells include for example CHO cells, BHK cells, HeLa cells, COS cells, and the like. However, amphibian cells, insect cells, plant cells, and any other cells used in the art for the expression of heterologous proteins can be used as well.
- the invention further provides methods of manufacturing a bispecific binding molecule of the invention, such methods generally comprising the steps of: - culturing host cells comprising a nucleic acid capable of encoding a bispecific binding molecule under conditions that allow expression of the bispecific binding molecule of the invention; and
- preferred host organisms include strains of E. coli, Pichia pastoris, and S. cerevisiae that are suitable for large scale expression, production and fermentation, and in particular for large scale pharmaceutical expression, production and fermentation.
- the choice of the specific expression system depends in part on the requirement for certain post-translational modifications, more specifically glycosylation.
- the production of a bispecific binding molecule of the invention for which glycosylation is desired or required would necessitate the use of mammalian expression hosts that have the ability to glycosylate the expressed protein.
- the glycosylation pattern obtained i.e. the kind, number and position of residues attached
- Bispecific binding molecules of the invention may be produced either in a cell as set out above intracellullarly (e.g. in the cytosol, in the periplasma or in inclusion bodies) and then isolated from the host cells and optionally further purified; or they can be produced extracellularly (e.g. in the medium in which the host cells are cultured) and then isolated from the culture medium and optionally further purified.
- the invention relates to a peptide having an amino acid sequence of a CDR3 contained in an anti-DII4-VHH having an amino acid sequence selected from sequences shown in SEQ ID NOs: 1 to 166 and 458, SEQ ID NOs: 333 to 353, or SEQ ID NOs: 375 to 395, respectively, and a nucleic acid molecule encoding same.
- These peptides correspond to CDR3s derived from the VHHs of the invention. They, in particular the nucleic acid molecules encoding them, are useful for CDR grafting in order to replace a CDR3 in an immunoglobulin chain, or for insertion into a non- immunoglobulin scaffold, e.g.
- CDR- grafting is well known in the art and has been widely used, e.g. for humanizing antibodies (which usually comprises grafting the CDRs from a rodent antibody onto the Fv frameworks of a human antibody).
- the DNA encoding such molecule may be obtained according to standard methods of molecular biology, e.g. by gene synthesis, by oligonucleotide annealing or by means of overlapping PCR fragments, as e.g. described by
- the invention further relates to a product or composition containing or comprising at least one bispecific binding molecule of the invention and optionally one or more further components of such compositions known per se, i.e. depending on the intended use of the composition.
- a bispecific binding molecule of the invention for pharmaceutical use, a bispecific binding molecule of the invention or a
- polypeptide containing same may be formulated as a pharmaceutical preparation or composition comprising at least one bispecific binding molecule of the invention and at least one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and optionally one or more further pharmaceutically active polypeptides and/or compounds.
- a formulation may be in a form suitable for oral administration, for parenteral administration (such as by intravenous, intramuscular or subcutaneous injection or intravenous infusion), for topical administration, for administration by inhalation, by a skin patch, by an implant, by a suppository, etc.
- suitable administration forms - which may be solid, semi-solid or liquid, depending on the manner of administration - as well as methods and carriers for use in the preparation thereof, will be clear to the skilled person, and are further described herein.
- the invention relates to a pharmaceutical composition that contains at least one bispecific binding molecule, in particular one immunoglobulin single variable domain of the invention or a polypeptide containing same and at least one suitable carrier, diluent or excipient (i.e. suitable for pharmaceutical use), and optionally one or more further active substances.
- the bispecific binding molecules of the invention may be formulated and administered in any suitable manner known per se: Reference, in particular for the immunoglobulin single variable domains, is for example made to WO 2004/041862, WO 2004/041863, WO 2004/041865, WO 2004/041867 and WO 2008/020079, as well as to the standard handbooks, such as Remington's Pharmaceutical Sciences, 18 th Ed., Mack Publishing Company, USA (1990), Remington, the Science and Practice of Pharmacy, 21 th Edition, Lippincott Williams and Wilkins (2005); or the Handbook of Therapeutic Antibodies (S. Dubel, Ed.), Wiley, Weinheim, 2007 (see for example pages 252-255).
- an immunoglobulin single variable domain of the invention may be formulated and administered in any manner known per se for conventional antibodies and antibody fragments (including ScFv's and diabodies) and other pharmaceutically active proteins.
- Such formulations and methods for preparing the same will be clear to the skilled person, and for example include preparations suitable for parenteral administration (for example intravenous, intraperitoneal, subcutaneous,
- intramuscular, intraluminal, intra-arterial or intrathecal administration or for topical (i.e. transdermal or intradermal) administration.
- Preparations for parenteral administration may for example be sterile solutions, suspensions, dispersions or emulsions that are suitable for infusion or injection.
- Suitable carriers or diluents for such preparations for example include, without limitation, sterile water and pharmaceutically acceptable aqueous buffers and solutions such as physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution; water oils; glycerol; ethanol; glycols such as propylene glycol or as well as mineral oils, animal oils and vegetable oils, for example peanut oil, soybean oil, as well as suitable mixtures thereof.
- aqueous solutions or suspensions will be preferred.
- bispecific binding molecule of the invention may be systemically
- the bispecific binding molecule of the invention may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier.
- the bispecific binding molecule of the invention may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- compositions and preparations should contain at least 0.1 % of the DII4-binding molecule of the invention. Their percentage in the compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% of the weight of a given unit dosage form. The amount of the bispecific binding molecule of the invention in such therapeutically useful compositions is such that an effective dosage level will be obtained.
- the tablets, pills, capsules, and the like may also contain binders, excipients, disintegrating agents, lubricants and sweetening or flavouring agents, for example those mentioned on pages 143-144 of WO 08/020079.
- the unit dosage form When the unit dosage form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol.
- a liquid carrier such as a vegetable oil or a polyethylene glycol.
- Various other materials may be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like.
- a syrup or elixir may contain the bispecific binding molecules of the invention, sucrose or fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor.
- any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed.
- the bispecific binding molecules of the invention may be incorporated into sustained- release preparations and devices.
- Preparations and formulations for oral administration may also be provided with an enteric coating that will allow the constructs of the invention to resist the gastric environment and pass into the intestines. More generally, preparations and
- formulations for oral administration may be suitably formulated for delivery into any desired part of the gastrointestinal tract.
- suitable suppositories may be used for delivery into the gastrointestinal tract.
- the bispecific binding molecules of the invention may also be administered.
- the bispecific binding molecules of the invention For topical administration of the bispecific binding molecules of the invention, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatologically acceptable carrier, which may be a solid or a liquid, as further described on page 145 of WO 2008/020079.
- a dermatologically acceptable carrier which may be a solid or a liquid, as further described on page 145 of WO 2008/020079.
- the concentration of the bispecific binding molecules of the invention in a liquid composition, such as a lotion will be from about 0.1 -25 wt-%, preferably from about 0.5-10 wt-%.
- the concentration in a semi-solid or solid composition such as a gel or a powder will be about 0.1 -5 wt-%, preferably about 0.5-2.5 wt-%.
- the amount of the bispecific binding molecules of the invention required for use in treatment will vary not only with the particular bispecific binding molecule selected, but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician.
- the dosage of the bispecific binding molecules of the invention varies depending on the target cell, tumor, tissue, graft, or organ.
- the desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub- doses per day.
- the sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations; such as multiple inhalations from an insufflator or by application of a plurality of drops into the eye.
- An administration regimen may include long-term, daily treatment.
- long-term is meant at least two weeks and preferably, several weeks, months, or years of duration. Necessary modifications in this dosage range may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. See Remington's Pharmaceutical Sciences (Martin, E.W., ed. 4), Mack Publishing Co., Easton, PA. The dosage can also be adjusted by the individual physician in the event of any complication.
- the invention relates to the use of bispecific binding molecules of the invention, e.g. immunoglobulin single variable domains or polypeptides containing them, for therapeutic purposes, such as
- a pharmaceutically active amount of at least one bispecific binding molecule of the invention e.g. an immunoglobulin single variable domain, or a pharmaceutical composition containing same;
- said disorder disorder, disease or condition is a cancer or cancerous disease, as defined herein.
- the disease is an eye disease associated with associated with DII4-mediated and/or Ang2-mediated effects on angiogenesis or which can be treated or alleviated by modulating the Notch signaling pathway and/or the Tie2 signalling pathway with a bispecific binding molecule.
- a bispecific binding molecule of the invention may be used on its own or in combination with one or more additional therapeutic agents, in particular selected from chemotherapeutic agents like DNA damaging agents or therapeutically active compounds that inhibit angiogenesis, signal transduction pathways or mitotic checkpoints in cancer cells.
- the additional therapeutic agent may be administered simultaneously with, optionally as a component of the same pharmaceutical preparation, or before or after administration of the bispecific binding molecule.
- the additional therapeutic agent may be, without limitation, one or more inhibitors selected from the group of inhibitors of EGFR, VEGFR, HER2- neu, Her3, AuroraA, AuroraB, PLK and PI3 kinase, FGFR, PDGFR, Raf, Ras, KSP, PDK1 , PTK2, IGF-R or IR.
- additional therapeutic agents are inhibitors of CDK, Akt, src/bcr abl, cKit, cMet/HGF, c-Myc, Flt3, HSP90, hedgehog antagonists, inhibitors of
- JAK/STAT Mek, mTor, NFkappaB, the proteasome, Rho, an inhibitor of wnt signaling or an inhibitor of the ubiquitination pathway or another inhibitor of the Notch signaling pathway.
- Aurora inhibitors are, without limitation, PHA-739358, AZD-1 152, AT 9283, CYC-1 16, R-763, VX-680, VX-667, MLN-8045, PF-3814735.
- An example for a PLK inhibitor is GSK-461364.
- raf inhibitors are BAY-73-4506 (also a VEGFR inhibitor), PLX 4032, RAF-265 (also in addition a VEGFR inhibitor), sorafenib (also in addition a VEGFR inhibitor), and XL 281 .
- KSP inhibitors examples include ispinesib, ARRY-520, AZD-4877, CK-1 122697, GSK 246053A, GSK-923295, MK-0731 , and SB-743921 .
- Examples for a src and/or bcr-abl inhibitors are dasatinib, AZD-0530, bosutinib,
- XL 228 also an IGF-1 R inhibitor
- nilotinib also a PDGFR and cKit inhibitor
- An example for a PDK1 inhibitor is BX-517.
- An example for a Rho inhibitor is BA-210.
- PI3 kinase inhibitors examples include PX-866, BEZ-235 (also an mTor inhibitor), XL 418 (also an Akt inhibitor), XL-147, and XL 765 (also an mTor inhibitor).
- inhibitors of cMet or HGF are XL-184 (also an inhibitor of VEGFR, cKit, Flt3), PF-2341066, MK-2461 , XL-880 (also an inhibitor of VEGFR), MGCD-265 (also an inhibitor of VEGFR, Ron, Tie2), SU-1 1274, PHA-665752, AMG-102, and AV-299.
- c-Myc inhibitor is CX-3543.
- Flt3 inhibitors are AC-220 (also an inhibitor of cKit and PDGFR), KW 2449, lestaurtinib (also an inhibitor of VEGFR, PDGFR, PKC), TG-101348 (also an inhibitor of JAK2), XL-999 (also an inhibitor of cKit, FGFR, PDGFR and VEGFR), sunitinib (also an inhibitor of PDGFR, VEGFR and cKit), and tandutinib (also an inhibitor of PDGFR, and cKit).
- AC-220 also an inhibitor of cKit and PDGFR
- lestaurtinib also an inhibitor of VEGFR, PDGFR, PKC
- TG-101348 also an inhibitor of JAK2
- XL-999 also an inhibitor of cKit, FGFR, PDGFR and VEGFR
- sunitinib also an inhibitor of PDGFR, VEGFR and cKit
- HSP90 inhibitors examples include tanespimycin, alvespimycin, IPI-504 and
- JAK/STAT inhibitors are CYT-997 (also interacting with tubulin), TG 101348 (also an inhibitor of Flt3), and XL-019.
- Mek inhibitors are ARRY-142886, PD-325901 , AZD-8330, and XL 518.
- mTor inhibitors examples include temsirolimus, AP-23573 (which also acts as a VEGF inhibitor), everolimus (a VEGF inhibitor in addition).
- AP-23573 also acts as a VEGF inhibitor
- everolimus a VEGF inhibitor in addition
- XL-765 also a PI3 kinase inhibitor
- BEZ-235 also a PI3 kinase inhibitor
- Akt inhibitors are perifosine, GSK-690693, RX-0201 , and triciribine.
- Examples for cKit inhibitors are AB-1010, OSI-930 (also acts as a VEGFR inhibitor), AC-220 (also an inhibitor of Flt3 and PDGFR), tandutinib (also an inhibitor of Flt3 and PDGFR), axitinib (also an inhibitor of VEGFR and PDGFR), XL-999 (also an inhibitor of Flt3, PDGFR, VEGFR, FGFR), sunitinib (also an inhibitor of Flt3, PDGFR,
- VEGFR VEGFR
- XL-820 also acts as a VEGFR- and PDGFR inhibitor
- imatinib also a bcr-abl inhibitor
- nilotinib also an inhibitor of bcr-abl and PDGFR.
- hedgehog antagonists are IPI-609 and CUR-61414.
- CDK inhibitors are seliciclib, AT-7519, P-276, ZK-CDK (also inhibiting VEGFR2 and PDGFR), PD-332991 , R-547, SNS-032, PHA-690509, and AG 024322.
- proteasome inhibitors examples include bortezomib, carfilzomib, and NPI-0052 (also an inhibitor of NFkappaB).
- An example for an NFkappaB pathway inhibitor is NPI-0052.
- An example for an ubiquitination pathway inhibitor is HBX-41 108.
- the additional therapeutic agent is an anti-angiogenic agent.
- anti-angiogenic agents are inhibitors of the FGFR, PDGFR and VEGFR or the respective ligands (e.g VEGF inhibitors like pegaptanib or the anti-VEGF antibody bevacizumab), and thalidomides, such agents being selected from, without limitation, bevacizumab, motesanib, CDP-791 , SU-14813, telatinib, KRN-951 , ZK-CDK (also an inhibitor of CDK), ABT-869, BMS-690514, RAF-265, IMC-KDR, IMC-18F1 , IMiDs (immunomodulatory drugs), thalidomide derivative CC-4047, lenalidomide, ENMD 0995, IMC-D1 1 , Ki 23057, brivanib, cediranib, XL-999 (also an inhibitor of cKit and Flt3), 1 B3, CP 868596, IMC 3G3, R-1530 (also an inhibitor
- the additional therapeutic agent may also be selected from EGFR inhibitors, it may be a small molecule EGFR inhibitor or an anti-EGFR antibody.
- anti- EGFR antibodies without limitation, are cetuximab, panitumumab, matuzumab; an example for a small molecule EGFR inhibitor is gefitinib.
- Another example for an EGFR modulator is the EGF fusion toxin.
- EGFR and Her2 inhibitors useful for combination with the bispecific binding molecule of the invention are lapatinib, gefitinib, erlotinib, cetuximab, trastuzumab, nimotuzumab, zalutumumab, vandetanib (also an inhibitor of VEGFR), pertuzumab, XL-647, HKI-272, BMS-599626 ARRY-334543, AV 412, mAB-806, BMS-690514, JNJ-26483327, AEE-788 (also an inhibitor of VEGFR), ARRY-333786, IMC-1 1 F8, Zemab.
- tositumumab and ibritumomab tiuxetan two radiolabeled anti-CD20 antibodies
- alemtuzumab an anti-CD52 antibody
- denosumab an osteoclast differentiation factor ligand inhibitor
- galiximab a CD80 antagonist
- hormones e.g. tamoxifen, toremifene, raloxifene, fulvestrant, mege
- LHRH agonists and antagonists e.g. goserelin acetate, leuprolide, abarelix, cetrorelix, deslorelin, histrelin, triptorelin
- antimetabolites e.g. antifolates like methotrexate, pemetrexed, pyrimidine analogues like 5 fluorouracil, capecitabine, decitabine, nelarabine, and gemcitabine, purine and adenosine analogues such as mercaptopurine thioguanine, cladribine and pentostatin, cytarabine, fludarabine
- antitumor antibiotics e.g.
- anthracyclines like doxorubicin, daunorubicin, epirubicin and idarubicin, mitomycin-C, bleomycin dactinomycin, plicamycin, mitoxantrone, pixantrone, streptozocin); platinum derivatives (e.g. cisplatin, oxaliplatin, carboplatin, lobaplatin, satraplatin); alkylating agents (e.g.
- vinca alkaloids like vinblastine, vindesine, vinorelbine, vinflunine and vincristine
- taxanes like paditaxel, docetaxel and their formulations, larotaxel; simotaxel, and epothilones like ixabepilone, patupilone, ZK-EPO); topoisomerase inhibitors (e.g.
- epipodophyllotoxins like etoposide and etopophos, teniposide, amsacrine, topotecan, irinotecan) and miscellaneous chemotherapeutics such as amifostine, anagrelide, interferone alpha, procarbazine, mitotane, and porfimer, bexarotene, celecoxib.
- bispecific binding molecules of the present invention are VEGF antagonists, like bevacizumab (Avastin ® ), Vargatef ® , Sorafenib and Sunitinib.
- VEGF antagonists like bevacizumab (Avastin ® ), Vargatef ® , Sorafenib and Sunitinib.
- the efficacy of bispecific binding molecules of the invention or polypeptides containing them, and of compositions comprising the same can be tested using any suitable in vitro assay, cell- based assay, in vivo assay and/or animal model known per se, or any combination thereof, depending on the specific disease or disorder of interest. Suitable assays and animal models will be clear to the skilled person, and for example include the assays described herein and used in the Examples below, e.g. a proliferation assay.
- DII4-binding components of the invention have properties that are superior to those of DII4-binding molecules of the prior art, as can e.g. be taken from the ELISA data of Figure 10, showing that affinity-matured VHHs block hDLL4/hNotch1 -Fc interaction in a complete manner, as well as the IC50 (nM) values for affinity matured VHHs in hDLL4/hNotch1 -Fc competition ELISA; and the affinity K D (nM) of purified affinity matured VHHs on recombinant human DLL4 and mouse DLL4.
- DII4-binding components of the invention are promising candidates to have therapeutic efficacy in diseases and disorders associated with DII4-mediated effects on angiogenesis, such as cancer.
- a method of diagnosing a disease by a) contacting a sample with a DII4-and/or Ang2 binding component of the invention as defined above, and b) detecting binding of said DII4-and/or Ang2-binding component to said sample, and c) comparing the binding detected in step (b) with a standard, wherein a difference in binding relative to said sample is diagnostic of a disease or disorder associated with
- a bispecific binding component of the invention may be further modified, such as by introduction of a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair.
- a functional group may be used to link the bispecific binding molecule of the invention to another protein, polypeptide or chemical compound that is bound to the other half of the binding pair, i.e. through formation of the binding pair.
- a bispecific binding molecule of the invention may be conjugated to biotin, and linked to another protein, polypeptide, compound or carrier conjugated to avidin or streptavidin.
- such a conjugated bispecific binding molecule of the invention may be used as a reporter, for example in a diagnostic system where a detectable signal- producing agent is conjugated to avidin or streptavidin.
- Figure 1 Amino acid sequence alignment of human, rhesus and cynomolgus
- FIG. 3 Purified VHHs blocking hDLL4/hNotch1 -Fc interaction (ELISA).
- FIG. 4 Purified VHHs blocking hDLL4/hNotch1 -Fc interaction (AlphaScreen).
- FIG. 5 Purified VHHs blocking CHO-hDLL4/hNotch1 -Fc and
- FIG. 6 Purified VHHs blocking DLL4 mediated Notchl cleavage (reporter).
- Figure 8 Binding of purified VHHs to recombinant human DLL1 and human
- FIG. 9 Binding of purified VHHs to human/mouse/cynomolgus DLL4 (FACS).
- Figure 10 Affinity matured VHHs blocking hDLL4/hNotch1 -Fc interaction (ELISA).
- FIG. 11 Purified affinity matured VHHs blocking CHO-hDLL4/hNotch1 -Fc and
- FIG. 12 Binding of purified VHHs to human/mouse DLL4 (ELISA).
- Figure 13 Binding of purified affinity matured VHHs to recombinant human DLL1 and human Jagged-1 (ELISA).
- FIG. 14 Binding of purified VHHs to human/mouse/cynomolgus DLL4 (FACS).
- Figure 16 Description cycle 1 DLL4xAng2 VHHs
- Figure 17 Purified cycle 1 DLL4xAng2 VHHs blocking hDLL4-hNotch1 interaction (ELISA)
- Figure 18 Purified cycle 1 DLL4xAng2 VHHs blocking CHO-hDLL4/Notch1 (44-1 ) and CHO-mDLL4/Notch1 (44-2) interaction (FMAT)
- FIG. 19 Purified cycle 1 DLL4xAng2 VHHs binding to human, mouse and
- Figure 20 Purified cycle 1 DLL4xAng2 VHHs binding to human, mouse and rat
- FIG. 21 Purified cycle 1 DLL4xAng2 VHHs binding to human DLL1 and Jagged-1
- Figure 22 Purified cycle 1 DLL4xAng2 VHHs blocking hAng2-hTie2 (48-1 ), mAng2- mTie2 (48-2) and cAng2/cTie2 (48-3) interaction (ELISA)
- Figure 25 Purified cycle 2 DLL4xAng2 VHHs blocking CHO-hDLL4/Notch1 (51 -1 ) and CHO-mDLL4/Notch1 (51 -2) interaction (FMAT)
- Figure 26 Purified cycle 2 DLL4xAng2 VHHs blocking hDLL4 mediated Notchl activation (reporter gene assay)
- FIG. 27 Purified cycle 2 DLL4xAng2 VHHs binding to human, mouse and
- Figure 28 Purified cycle 2 DLL4xAng2 VHHs binding to human, mouse and rat
- FIG. 29 Purified cycle 2 DLL4xAng2 VHHs binding to human DLL1 and Jagged-1
- Figure 30 Purified cycle 2 DLL4xAng2 VHHs blocking hAng2-hTie2 (56-1 ), mAng2- mTie2 (56-2) and cAng2/cTie2 (56-3) interaction (ELISA)
- Figure 31 Purified cycle 2 DLL4xAng2 VHHs blocking hAng1 -hTie2 interaction (ELISA)
- Figure 32 Purified cycle 2 DLL4xAng2 VHHs blocking hAng2 mediated HUVEC survival.
- the cDNAs encoding human (SEQ ID NO: 417; NM_019074.2) and mouse DII4 (NM_019454.3) are amplified from a Human Adult Normal Tissue Heart cDNA library (BioChain, Hayward, CA, USA) and a Mouse Heart Tissue cDNA library (isolated from C57/BI6 strain), respectively, using oligonucleotides designed in the 5' and 3' UTR of the corresponding sequence (see Table 1 ; SEQ ID NO:421 to 426).
- Amplicons are cloned into the mammalian expression vector pCDNA3.1 (+)-neo (Invitrogen, Carlsbad, CA, USA).
- Table 1 Oligonucleotide sequences used for amplification of DLL4 gene full length orthologues.
- Cynomolgus DII4 cDNA is amplified from a Cynomolgus Normal Tissue Heart cDNA library (BioChain, Hayward, CA, USA), using primers designed on the 5' and 3' UTR of the DII4 encoding sequence of the closely related species rhesus (Macaca mulatta DII4, SEQ ID NO:418; XM_001099250.1 ) (see Table 1 ).
- the final amplicon is cloned in the mammalian expression vector pCDNA3.1 (+)-neo (Invitrogen, Carlsbad, CA, USA).
- the amino acid sequence of cynomolgus DII4 was shown to be 100% identical to rhesus, and 99% identical to human (see Figure 1 ; differences from the human sequence are indicated as bold-underlined).
- DII4 mAb The published variable heavy and light chain sequences of DII4 mAb are cloned into a MgG2aK framework, transiently expressed in HEK293 cells and purified from supernatants using protein A chromatography. Purified DII4 mAb shows binding to human DII4 and mouse DII4 in ELISA and FACS (using CHO-mDII4 and CHO-hDII4 cells), sub-nanomolar affinities to both growth factor orthologues in Biacore.
- the corresponding DII4 Fab fragment is constructed via gene assembly based on back-translation and codon optimization for expression in E. coli using Leto's Gene Optimization software (www.entechelon.com). Oligonucleotide primers for the assembly of the variable light chain (V L ), variable heavy chain (V H ), constant light chain (CL) and constant domain 1 of the heavy chain (Cm) are designed and an assembly PCR is performed.
- V L variable light chain
- V H variable heavy chain
- CL constant light chain
- Cm constant domain 1 of the heavy chain
- _ and V H +Cm are cloned into a pUC1 19-derived vector, which contains the LacZ promotor, a resistance gene for kanamycin, a multiple cloning site and a hybrid glll-pelB leader sequence, using the restriction sites Sfil and Ascl and the restriction sites Kpnl and Notl, respectively.
- the expression vector encodes a C-terminal HA and His6-tag.
- the Fab fragment is expressed in E. coli as His6- tagged protein and subsequently purified from the culture medium by immobilized metal affinity chromatography (IMAC) and size exclusion chromatography (SEC).
- IMAC immobilized metal affinity chromatography
- SEC size exclusion chromatography
- the mammalian expression vector pSecTag2/Hygro (Invitrogen, Carlsbad, CA, USA) comprising a CMV promotor upstream of polynucleotides encoding a nested series of deletion fragments of the DII4 ECD fused to a polyHis- tag are generated using standard recombinant DNA technology (see Figure 2; amino acid domain boundaries in superscript).). These recombinant proteins are expressed in transiently transfected HEK293 cells using the Freestyle 293 Expression System (Invitrogen, Carlsbad, CA, USA) from which conditioned medium is collected and purified via IMAC.
- DII4 reporter assay plasmids A reporter assay is developed based on the ⁇ -secretase mediated cleavage of
- Gal4/VP16 coding sequences are inserted into the NICD-coding sequence.
- the potent hybrid transcriptional activator GAL4-VP16 which consists of a DNA binding fragment of yeast GAL4 fused to a Herpes simplex viral transcriptional activator domain VP16, is inserted carboxy-terminal to the transmembrane domain of Notchl . Cleavage of this construct by ⁇ -secretase results in the release of the
- Gal4/VP16 NICD fusion protein which will translocate to the nucleus where it will bind to and transcriptionally activate a co-transfected luciferase reporter plasmid, containing a strong GAL4-UAS promoter sequence (Struhl, G. and Adachi, A., Cell, vol. 93, 649-660, 1998).
- the human Notchl -Gal4/VP 16 expression cassette is cloned in pcDNA3.1 (+)-neo (Invitrogen, Carlsbad, CA, USA).
- pGL4.31 [Luc2P/Gal4UAS/Hygro] vector (Promega, Madison, Wl, USA) is used as luciferase reporter plasmid.
- 4 llamas (designated No. 208, 209, 230, 231 ) are immunized with 6 intramuscular injections (100 or 50 g/dose at weekly intervals) of recombinant human DII4 (R&D Systems, Minneapolis, MN, US).
- the DII4 antigen is formulated in Stimune (Cedi Diagnostics BV, Lelystad, The Netherlands).
- Three additional llamas are immunized according to standard protocols with 4 subcutaneous injections of alternating human DII4 and mouse DII4 overexpressing CHO cells which are established as described above.
- Adjuvant (Difco, Detroit, Ml, USA).
- immunoglobulins are detected using a horseradish peroxidase (HRP)-conjugated goat anti-llama immunoglobulin (Bethyl Laboratories Inc., Montgomery, TX, USA) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3', 5, 5'- tetramentylbenzidine) (Pierce, Rockford, IL, USA), showing that a significant antibody-dependend immune response against DII4 is induced.
- HRP horseradish peroxidase
- the antibody response is mounted both by conventional and heavy-chain only antibody expressing B-cell repertoires since specifically bound immunoglobulins can be detected with antibodies specifically recognizing the conventional llama lgG1 antibodies or the heavy chain only llama lgG2 or lgG3 antibodies (Table 2-A).
- an antibody response is mounted by conventional and heavy chain only antibody expressing B-cells specifically against mouse DII4.
- serum titers of cell immunized animals are confirmed by FACS analysis on human and mouse DII4 overexpressing HEK293 cells (Table 2-B).
- Table 2 Antibody mediated specific serum response against DLL4.
- PBMCs peripheral blood mononuclear cells
- a library is constructed by pooling the total RNA isolated from all collected immune tissues of that animal.
- the PCR- amplified VHH repertoire is cloned via specific restriction sites into a vector designed to facilitate phage display of the VHH library.
- the vector is derived from pUC1 19 and contains the LacZ promoter, a M13 phage gill protein coding sequence, a resistance gene for ampicillin or carbenicillin, a multiple cloning site and a hybrid glll-pelB leader sequence (pAX050).
- the vector encodes a C-terminal c-myc tag and a His6 tag. Phage are prepared according to standard protocols and stored after filter sterilization at 4°C for further use.
- VHH repertoires obtained from all llamas and cloned as phage library are used in different selection strategies, applying a multiplicity of selection conditions.
- Variables include i) the DII4 protein format (C-terminally His-tagged recombinantly expressed extracellular domain of human DII4 (Met1 -Pro524) and mouse DII4 (Met1 -Pro525) (R&D Systems, Minneapolis, MN, USA), or full length human DII4 and mouse DII4 present on DII4-overexpressing CHO or HEK293 cells, ii) the antigen presentation method (plates directly coated with DII4 or Neutravidin plates coated with DII4 via a biotin-tag; solution phase: incubation in solution followed by capturing on Neutravidin- coated plates), iii) the antigen concentration and iv) different elution methods (nonspecific via trypsin or specfic via cognate receptor Notch1/Fc chimera or anti-DII4 IgG
- DII4 antigen preparations for solid and solution phase selection formats are presented as described above at multiple
- Periplasmic extracts are screened in a human DII4/human Notchl AlphaScreen assay to assess the blocking capacity of the expressed VHHs.
- Human DII4 is biotinylated using biotin (Sigma, St Louis, MO, USA) and biotinamidohexanoic acid 3-sulfo-N-hydroxysuccinimide ester sodium salt (Sigma, St Louis, MO, USA).
- Notchl /Fc chimera (R&D Systems, Minneapolis, MN, USA) is captured using an anti- Fc VHH which is coupled to acceptor beads according to the manufacturer's instructions (Perkin Elmer, Waltham, MA, US).
- dilution series of the periplasmic extracts are pre-incubated with biotinylated human DII4.
- the acceptor beads and the streptavidin donor beads are added and further incubated for 1 hour at room temperature.
- Fluorescence is measured by reading plates on the Envision Multilabel Plate reader (Perkin Elmer, Waltham, MA, USA) using an excitation wavelength of 680 nm and an emission wavelength of 520 nm. Decrease in fluorescence signal indicates that the binding of biotinylated human DII4 to the human Notchl /Fc receptor is blocked by the VHH expressed in the periplasmic extract.
- CHO-hDII4 and CHO-mDII4 cells are used in a human Notchl /Fc FMAT (Fluorometric Microvolume Assay Technology) competition assay.
- Recombinant human Notchl /Fc chimera R&D Systems, Minneapolis, MN, USA
- Alexa-647 Invitrogen, Carlsbad, CA, USA
- 5 ⁇ periplasmic material is added to 100 pM or 175 pM labeled human Notch1/Fc together with 7,500 CHO-hDII4 or CHO-mDII4 overexpressing cells, respectively, and readout is performed after 2 hours of incubation.
- Table 3 Selection parameters used for the identification of DLL4 specific VHH B-cell lineages.
- RIM biot- (RIM) rhDLL4 (0.01
- RIM biot- (RIM) rhDLL4
- RIM biot- (RIM) rhDLL4
- RIM biot- (RIM) rhDLL4
- Inhibitory anti-DII4 VHHs selected from the screening described in Example 4 are further purified and characterized. Selected VHHs are expressed in E. coli TG1 as c-myc, His6-tagged proteins. Expression is induced by addition of 1 mM IPTG and allowed to continue for 4 hours at 37 ° C. After spinning the cell cultures,
- periplasm ic extracts are prepared by freeze-thawing the pellets. These extracts are used as starting material and VHHs are purified via IMAC and size exclusion chromatography (SEC) resulting in 95% purity as assessed via SDS-PAGE.
- SEC size exclusion chromatography
- the blocking capacity of the VHHs is evaluated in a human DII4 - human
- Notch1/Fc blocking ELISA 1 pg/mL of human Notch1/Fc chimera (R&D Systems, Minneapolis, MN, USA) is coated in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). A fixed concentration of 15 nM biotinylated human DII4 is preincubated with a dilution series of the VHH for 1 hour, after which the mixture is incubated on the coated Notchl receptor for an additional hour. Residual binding of biotinylated human DII4 is detected using horseradish peroxidase (HRP) conjugated extravidin (Sigma, St. Louis, MO, USA) ( Figure 3).
- HRP horseradish peroxidase
- Human DII4 is biotinylated as described above.
- the IC50 values for VHHs blocking the human DII4 - human Notchl /Fc interaction are depicted in Table 6.
- Table 6 IC 50 (nM) values for VHHs in hDLL4/hNotch1 -Fc competition ELISA
- the blocking capacity of the VHHs is evaluated in a human and mouse DII4 - human Notch1/Fc competitive FMAT assay ( Figure 5) as outlined in Example 4.
- the IC50 values for VHHs blocking the interaction of human Notch1/Fc to human or mouse DII4 expressed on CHO cells are depicted in Table 8.
- a reporter assay is set up which is based on the ⁇ -secretase mediated cleavage of Notchl and release of the intracellular domain of Notchl (NICD) upon stimulation with DII4.
- the Notchl - GAL4/VP16 construct is cotransfected with the pGL4.31 [Luc2P/Gal4UAS/Hygro] reporter plasmid in HEK cells resulting in a transient expression of the fusion protein. These transiently transfected cells are stimulated for 24 hours by co- culture with a HEK293-hDII4 stable cell line. Forty-eight hours post-transfection, the readout is performed.
- the VHHs are preincubated with the HEK293-hDII4 cells 1 hour before the start of the co-culture and are included during the co-culture
- Table 10-A represents the sequential injection/regeneration path of analysed VHHs and controls.
- VHHs DLLBII56A09 (SEQ ID NO: 300), DLLBII96C03 (SEQ ID NO: 326), DLLBII101 G08 (SEQ ID NO: 197) and DLLBII1 15A05 (SEQ ID NO: 224) are shown not to additionally bind to human DII4 captured by DII4 Fab.
- Injection of DII4 Fab also failed to additionally bind human DII4 indicating that all epitopes are saturated. Therefore, it can be concluded that these VHHs recognize an epitope overlapping with DII4 Fab for binding human DII4.
- Table 10-A Epitope binning of anti-DLL4 VHHs - simultaneous binding with DLL4 Fab
- VHHs DLLBII101 G08 (SEQ ID NO: 197) and DLLBII1 15A5 (SEQ ID NO: 224) are coated on a CM4 Sensorchip and 200 nM of each deletion mutant is injected across the chip. Binding is qualitatively assessed. No binding of DLLBII56A09 (SEQ ID NO: 300), DLLBII101 G08 (SEQ ID NO: 197) and DLLBII1 15A05 (SEQ ID NO: 224) is observed to human and mouse DII4 mutants hDII4.1 and mDII4.8, respectively, lacking EGF-like 2 domain (Table 10-B).
- Table 10-B Epitope mapping of anti-DLL4 VHHs - binding to DLL4 deletion mutants
- Recombinant human DII4 is immobilized onto a CM5 chip via amine coupling using EDC and NHS) or biotinylated human DII4 is captured on a SA chip (streptavidin surface).
- Purified VHHs or Fab fragment are injected for 2 minutes at different concentrations (between 10 and 300 nM) and allowed to dissociate for 20 min at a flow rate of 45 ⁇ /min. Between sample injections, the surfaces are regenerated with 10 mM glycine pH1.5 and 100 mM HCI.
- HBS-N Hepes buffer pH7.4 is used as running buffer. If possible, data are evaluated by fitting a 1 : 1 interaction model (Langmuir binding) onto the binding curves.
- the affinity constant K D is calculated from resulting association and dissociation rate constants (k a ) and (k d ).
- the affinities of the anti-DII4 VHHs are depicted in Table 1 1.
- Table 11 Affinity K D (nM) of purified VHHs for recombinant human DLL4
- VHHs are applied as dilution series and binding is detected using a mouse anti-myc (Roche) and an anti-mouse-AP conjugate (Sigma, St Louis, MO, USA) ( Figure 7). As reference, binding to human DII4 is measured. EC50 values are summarized in Table 12. Table 12: EC50 (nM) values for VHHs in a recombinant human DLL4 and mouse DLL4 binding ELISA
- a FACS binding experiment is performed. Cynomolgus DII4 expressing HEK293 cells (transient or stable transfection) are used for a titration binding experiment of the VHHs. After a 30 minutes incubation on ice, all samples are washed and detection is performed by applying anti-c-myc ⁇ Alexa647 (Santa Cruz Biotechnology, Santa Cruz, CA, USA). Human and mouse DII4 overexpressing HEK293 cells are taken as reference. The mean MCF value is determined on the FACS Array and used for calculation of the EC50 value (see Figure 9).
- VHHs in blocking DII4- mediated HUVEC proliferation
- the potency of the selected VHHs is evaluated in a proliferation assay, as described by Ridgway et al., Nature. 2006 Dec 21 ;444(7122): 1083-7), in modified form.
- 96-well tissue culture plates are coated with purified DII4-His (RnD Systems; C-terminal His-tagged human DII4, amino acid 27-524, 0.75ml/well, 10 ng/ml) in coating buffer (PBS, 0.1 % BSA).
- Wells are washed in PBS before 4000 HUVE cells/well are seeded in quadruplicate.
- Cell proliferation is measured by [ 3 H]-Thymidine incorporation on day 4.
- VHHs DLLBII101 G08 and DLLBII1 15A05 are subjected to two cycles of affinity maturation.
- a first cycle amino acid substitutions are introduced randomly in both framework (FW) and complementary determining regions (CDR) using the error- prone PCR method.
- Mutagenesis is performed in a two-round PCR-based approach (Genemorph II Random Mutagenesis kit obtained from Stratagene, La Jolla, CA, USA) using 1 ng of the DLLBII101 G08 or DLLBII1 15A05 cDNA template, followed by a second error-prone PCR using 0.1 ng of product of round 1.
- PCR products are inserted via unique restriction sites into a vector designed to facilitate phage display of the VHH library.
- Consecutive rounds of in-solution selections are performed using decreasing concentrations of biotinylated recombinant human DLL4 (biot-rhDLL4) and trypsin elutions.
- Affinity- driven selections in a third round using cold rhDLL4 (at least 100x excess over biot-rhDLL4) are also performed.
- No selections on murine DLL4 are included as (conservation of) cross-reactivity is assessed at the screening level.
- Individual mutants are produced as recombinant protein using an expression vector derived from pUC1 19, which contains the LacZ promoter, a resistance gene for ampicillin, a multiple cloning site and an ompA leader sequence (pAX50).
- coli TG1 cells are transformed with the expression vector library and plated on agar plates (LB + Amp + 2% glucose). Single colonies are picked from the agar plates and grown in 1 ml_ 96-deep-well plates. VHH expression is induced by adding IPTG (1 mM). Periplasmic extracts (in a volume of ⁇ 80 uL) are prepared according to standard methods and screened for binding to recombinant human and mouse DII4 in a ProteOn (BioRad, Hercules, CA, USA) off-rate assay.
- a GLC ProteOn Sensor chip is coated with recombinant human DII4 on the "Ngand channels" L2 and L4 (with L1/L3 as reference channel), while "Ngand channels” L3 and L6 is coated with mouse DII4.
- Periplasmic extract of affinity matured clones is diluted 1/10 and injected across the "analyte channels" A1 -A6.
- An average off-rate is calculated of the wild type clones present in the plate and served as a reference to calculate off-rate improvements.
- the full length DLLBII101 G8 or DLLBII1 15A05 cDNA is synthesized by overlap PCR using oligonucleotides degenerated (NNS) at the randomisation positions and a rescue PCR is performed.
- NPS oligonucleotides degenerated
- a list of the primers used for generating the combinatorial library can be found in Table 14 and SEQ ID NOs: 427 to 457.
- the randomised VHH genes are inserted into a phage display vector (pAX50) using specific restriction sites as described above (Example 2). Preparation of periplasmic extracts of individual VHH clones is performed as described before.
- Table 14 Oligonucleotides affinity maturation libraries
- DLLBII101 G08 variants and DLLBII1 15A05 variants are cloned into expression vector pAXI OO in frame with a C-terminal c-myc tag and a (His)6 tag. Off-rates on recombinant mouse DII4 are also improved.
- VHHs are produced in E. coli as His6-tagged proteins and purified by IMAC and SEC. Sequences are represented in Tables 16-A (LLBII101 G08) and 16-B (DLLBII1 15A05), respectively.
- VHHs DLLBII101 G08 and DLLBII1 15A05 are expressed and purified as described above (Example 6).
- VHHs are characterized in the rhDLL.1/ rhJAGI binding ELISA and hDII4/ mDII4/ cynoDII4 FACS (Example 5.8; Table 20;
- Table 18 IC50 values (nM) of purified affinity matured VHHs blocking the interaction of human Notch1/Fc to human or mouse DLL4 expressed on CHO cells (FMAT)
- Table 20 EC 5 o (nM) values of affinity matured VHHs for binding on CHO-hDLL4, CHO-mDLL4 and CHO-cDLL4 (FACS)
- the anti-DLL4 VHH DLLBII00018 (US 201 1/0172398 A1 ) and the cycle 1 sequence optimized anti-Ang2 VHHs 00042 (SEQ ID NO: 482), 00045 (SEQ ID NO: 484) and 00050 (SEQ ID NO:483) are used as building blocks to generate bispecific VHHs DLLANGBII00001 -00016.
- a genetic fusion to a serum albumin binding VHH is used as half-life extension methodology. Building blocks are linked via a 9 Gly-Ser flexible linker.
- VHHs are produced and purified as described in Example 5.
- An overview of the format and sequence of all bispecific VHHs is depicted in Figure 16 and Table 22-A (linker sequences underlined), SEQ ID Nos 460-475. Expression levels are indicated in Table 22-B.
- DLLANGBII00002 DVQLVESGGGLVQPGGSLRLSCAASGFTFDDYALGWFRQAPGKEREGVSCIRCSDGSTYYADSVKGR
- DLLANGBII00005 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMAWYRQAPGKEREYVAAIRWSGGTAYYADSVKGR
- DLLANGBII00006 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMAWYRQAPGKEREYVAAIRWSGGTAYYADSVKGR
- DLLANGBII00011 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMAWYRQAPGKEREYVAAIRWSGGTAYYADSVKGR
- DLLANGBII00015 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYAMAWYRQAPGKEREYVAAIRWSGGTAYYADSVKGR
- Table 23 IC50 values (nM) and % inhibition in hDLL4/hNotch1 competition ELISA and CHO-hDLL4 and CHO-mDLL4 competition FMAT.
- a FACS binding experiment is performed. Briefly, CHO cells overexpressing mouse and cynomolgus DLL4 are used for a titration binding
- Table 24 EC50 values of bispecific VHHs binding to human, mouse and cyno DLL4 overexpressed on CHO cells (FACS)
- a binding ELISA is performed.
- recombinant mouse DLL4 (R&D Systems, Minneapolis, Ml, USA) and rat DLL4 is coated overnight at 4 ° C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a 1 % casein solution.
- VHHs are applied as dilution series and binding is detected biotinylated anti-VHH 1 A4 followed by extravidin-HRP.
- 1A4 is an anti-VHH VHH (generetad in-house by Ablynx NV).
- EC50 values are summarized in Table 25 and Figure 20.
- Table 25 EC50 values of bispecific VHHs binding to human, mouse and rat DLL4 (ELISA)
- Absence of binding to the homologous human ligands DLL1 and Jagged-1 is assessed via a solid phase binding assay (ELISA).
- ELISA solid phase binding assay
- 1 pg/mL of recombinant human DLL1 (Alexis, San Diego, CA, USA) or recombinant human Jagged-1 (Alexis, San Diego, CA, USA) is coated overnight at 4 ° C i n a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a 1 % casein solution.
- VHHs are applied as dilution series and binding is detected biotinylated anti-VHH 1 A4 followed by extravidin-HRP. All bispecific VHH are considered as being non-cross reactive to these homologous ligands. Results are shown in Figure 21 .
- Affinities of certain DLL4-Ang2 bispecific VHHs for human serum albumin have been determined (see Example 5) and are shown in Table 27.
- the affinity constant K D is calculated from resulting association and dissociation rate constants k a and k d .
- the anti-DLL4 VHH DLLBII00018 (US 201 1/0172398 A1 ) and the final sequence optimized anti-Ang2 VHHs 00921 (SEQ ID NO: 485), 00938 (SEQ ID NO:486) and 00956 (SEQ ID NO:488) are used as building blocks to generate bispecific VHHs DLLANGBII00017-00019.
- a genetic fusion to a serum albumin binding VHH is used as half-life extension methodology. Building blocks are linked via a 9 Gly-Ser flexible linker.
- An overview of the format and sequence of all bispecific VHHs is depicted in Figure 23 and Table 28 (linker sequences underlined), SEQ ID Nos 476-478.
- the ELISA competition assay is performed with a fixed concentration of 8 nM biotinylated hDLL4.
- the ELISA competition assay, the FMAT competition assays and the reporter gene assay are also performed after preincubation of the VHH with 12.5 ⁇ , 25 ⁇ and 162 ⁇ human serum albumin, respectively.
- a summary of IC50 values and % inhibition is shown in Table 29.
- Table 29 IC 5 o values (nM) and % inhibition in hDLL4/hNotch1 competition ELISA, CHO-hDLL4 and CHO-mDLL4 competition FMAT and hDLL4 mediated Notchi activation (reporter gene) assay
- Binding to human DLL4, mouse DLL4 and rat DLL4 is assessed in Biacore. Briefly, kinetic analysis of the bispecific VHHs is performed by SPR on a Biacore T100 instrument. Recombinant human DLL4 (R&D Systems, Minneapolis, Ml, USA) and mouse DLL4 (R&D Systems, Minneapolis, Ml, USA) are immobilized on a CM5 chip via amine coupling. VHHs are injected over these surfaces at different concentrations between 2.5 and 1 ,800 nM. Samples are injected for 2 min and allowed to dissociate for 20 m in at a flow rate of 45 ⁇ /m in.
- a FACS binding experiment is performed. Briefly, CHO cells overexpressing mouse and cynomolgus DLL4 are used for a titration binding experiment of the VHHs. After a 30 min incubation on ice, all samples are washed and a 2-step detection using biotinylated anti-VHH 1A4 followed by PE labeled streptavidin is performed. CHO cells overexpressing human DLL4 are taken as reference. The mean MCF value is determined using a FACS Array and used for calculation of the EC50 value (Table 31 ; Figure 27). Table 31 : EC50 values of bispecific VHHs binding to human, mouse and cyno DLL4 overexpressed on CHO cells (FACS)
- a binding ELISA is performed.
- recombinant mouse DLL4 (R&D Systems, Minneapolis, Ml, USA) and rat DLL4 is coated overnight at 4 ° C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a 1 % casein solution.
- VHHs are applied as dilution series and binding is detected biotinylated anti-VHH 1 A4 followed by extravidin-HRP.
- EC50 values are summarized in Table 32 and Figure 28.
- Table 32 EC50 values of bispecific VHHs binding to human, mouse and rat DLL4 (ELISA)
- Absence of binding to the homologous human ligands DLL1 and Jagged-1 is assessed via a solid phase binding assay (ELISA).
- ELISA solid phase binding assay
- 1 pg/mL of recombinant human DLL1 (Alexis, San Diego, CA, USA) or recombinant human Jagged-1 (Alexis, San Diego, CA, USA) is coated overnight at 4 ° C i n a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a 1 % casein solution.
- VHHs are applied as dilution series and binding is detected biotinylated anti-VHH 1 A4 followed by extravidin-HRP. All bispecific VHH are considered as being non-cross reactive to these homologous ligands. Results are shown in Figure 29.
- Table 33 IC50 values (pM) and % inhibition in human, mouse and cyno Ang2/Tie2 competition ELISA, hAngl competition
- Affinities of DLLANGBII00017-18-19 for human, mouse and cyno serum albumin have been determined (Example 5) and are shown in Table 35.
- the affinity constant K D is calculated from resulting association and dissociation rate constants k a and k d .
- Table 35 Binding kinetics of purified VHHs for recombinant human, mouse and cyno serum albumin
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Ophthalmology & Optometry (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AP2013007086A AP2013007086A0 (en) | 2011-04-01 | 2012-03-30 | Bispecific binding molecules binding to DII4 and Ang2 |
| BR112013025294A BR112013025294A2 (pt) | 2011-04-01 | 2012-03-30 | moléculas de ligação biespecífica ligando a dll4 e ang2 |
| MX2013011032A MX337115B (es) | 2011-04-01 | 2012-03-30 | Moleculas de union biespecificas que se unen a dll4 y ang2. |
| KR1020137028119A KR20140016345A (ko) | 2011-04-01 | 2012-03-30 | Dll4와 Ang2에 결합하는 이중특이성 결합분자 |
| AU2012234218A AU2012234218A1 (en) | 2011-04-01 | 2012-03-30 | Bispecific binding molecules binding to Dll4 and Ang2 |
| NZ614243A NZ614243B2 (en) | 2011-04-01 | 2012-03-30 | BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 |
| CA2827809A CA2827809A1 (en) | 2011-04-01 | 2012-03-30 | Bispecific binding molecules binding to dll4 and ang2 |
| EA201301109A EA201301109A1 (ru) | 2011-04-01 | 2012-03-30 | БИСПЕЦИФИЧЕСКИЕ СВЯЗЫВАЮЩИЕ МОЛЕКУЛЫ, СВЯЗЫВАЮЩИЕСЯ С Dll4 И Ang2 |
| JP2014501664A JP2014511682A (ja) | 2011-04-01 | 2012-03-30 | Dll4及びAng2と結合する二重特異性結合分子 |
| EP12711200.1A EP2694545B1 (en) | 2011-04-01 | 2012-03-30 | Bispecific binding molecules binding to dll4 and ang2 |
| SG2013070792A SG193557A1 (en) | 2011-04-01 | 2012-03-30 | BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 |
| CN201280026737.XA CN103596977B (zh) | 2011-04-01 | 2012-03-30 | 结合D114和Ang2的双特异性结合分子 |
| TNP2013000389A TN2013000389A1 (en) | 2011-04-01 | 2013-09-26 | BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 |
| MA36275A MA35233B1 (fr) | 2011-04-01 | 2013-09-27 | Molecules de liaison bispecifiques se liant à dii4 et ang2 |
| PH12013502031A PH12013502031A1 (en) | 2011-04-01 | 2013-09-30 | BISPECIFIC BINDING MOLECULES BINDING TO D114 AND Ang2 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11160920.2 | 2011-04-01 | ||
| EP11160920 | 2011-04-01 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012131076A1 true WO2012131076A1 (en) | 2012-10-04 |
Family
ID=44314095
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/055897 Ceased WO2012131076A1 (en) | 2011-04-01 | 2012-03-30 | BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 |
Country Status (23)
| Country | Link |
|---|---|
| US (1) | US20130078247A1 (https=) |
| EP (1) | EP2694545B1 (https=) |
| JP (1) | JP2014511682A (https=) |
| KR (1) | KR20140016345A (https=) |
| CN (2) | CN106046167A (https=) |
| AP (1) | AP2013007086A0 (https=) |
| AR (1) | AR085919A1 (https=) |
| AU (1) | AU2012234218A1 (https=) |
| BR (1) | BR112013025294A2 (https=) |
| CA (1) | CA2827809A1 (https=) |
| CL (1) | CL2013002622A1 (https=) |
| CO (1) | CO6801638A2 (https=) |
| EA (1) | EA201301109A1 (https=) |
| EC (1) | ECSP13012996A (https=) |
| MA (1) | MA35233B1 (https=) |
| MX (1) | MX337115B (https=) |
| PE (1) | PE20141157A1 (https=) |
| PH (1) | PH12013502031A1 (https=) |
| SG (1) | SG193557A1 (https=) |
| TN (1) | TN2013000389A1 (https=) |
| TW (2) | TWI535735B (https=) |
| UY (1) | UY33997A (https=) |
| WO (1) | WO2012131076A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014049099A1 (en) * | 2012-09-28 | 2014-04-03 | Boehringer Ingelheim International Gmbh | Pharmaceutical combinations comprising dual angiopoietin-2 / dll4 binders and anti-vegf-r agents |
| WO2014049100A1 (en) * | 2012-09-28 | 2014-04-03 | Boehringer Ingelheim International Gmbh | Pharmaceutical combinations comprising dual angiopoietin-2 / dll4 binders and anti-vegf agents |
| AU2013241769B2 (en) * | 2012-03-30 | 2017-05-11 | Boehringer Ingelheim International Gmbh | Ang2-binding molecules |
| CN116444675A (zh) * | 2023-05-11 | 2023-07-18 | 亲和(武汉)生命科技有限责任公司 | 一种Pfu DNA聚合酶纳米抗体及其制备方法和应用 |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9527925B2 (en) | 2011-04-01 | 2016-12-27 | Boehringer Ingelheim International Gmbh | Bispecific binding molecules binding to VEGF and ANG2 |
| ES2913205T3 (es) | 2014-05-13 | 2022-06-01 | Bioatla Inc | Proteínas biológicas activas condicionalmente |
| CN107540747B (zh) * | 2017-08-09 | 2020-01-24 | 苏州大学附属儿童医院 | 抗人dll4单克隆抗体6f12 |
| CN110950967B (zh) * | 2019-12-13 | 2022-05-13 | 山东民康生物科技有限公司 | 抗人血清白蛋白纳米抗体与il-2融合蛋白及制备方法 |
| CA3231417A1 (en) * | 2021-09-10 | 2023-03-16 | Jian Shi | Anti-ang2 antibody, preparation method therefor, and application thereof |
| WO2025111816A1 (en) * | 2023-11-28 | 2025-06-05 | Eluminex Biosciences Limited | Multispecific fusion proteins targeting angiogenic, inflammatory, and/or fibrotic factors |
Citations (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1996034103A1 (en) | 1995-04-25 | 1996-10-31 | Vrije Universiteit Brussel | Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes |
| WO1998049185A1 (en) | 1997-04-28 | 1998-11-05 | Fmc Corporation | Lepidopteran gaba-gated chloride channels |
| WO2001079271A1 (en) | 2000-04-12 | 2001-10-25 | Principia Pharmaceutical Corporation | Albumin fusion proteins |
| WO2002056910A1 (en) | 2001-01-17 | 2002-07-25 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| WO2003059934A2 (en) | 2001-12-21 | 2003-07-24 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2004041865A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Stabilized single domain antibodies |
| WO2004041867A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders |
| WO2004060965A2 (en) | 2002-12-31 | 2004-07-22 | Nektar Therapeutics Al, Corporation | Hydrolytically stable maleimide-terminated polymers |
| WO2004081026A2 (en) | 2003-06-30 | 2004-09-23 | Domantis Limited | Polypeptides |
| WO2005044858A1 (en) | 2003-11-07 | 2005-05-19 | Ablynx N.V. | Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor |
| WO2006004678A2 (en) | 2004-06-29 | 2006-01-12 | Bookham Technology Plc | Worm type gear mover assembly |
| WO2006040153A2 (en) | 2004-10-13 | 2006-04-20 | Ablynx N.V. | Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease |
| WO2006122786A2 (en) | 2005-05-18 | 2006-11-23 | Ablynx Nv | Improved nanobodies™ against tumor necrosis factor-alpha |
| WO2007070671A2 (en) | 2005-12-16 | 2007-06-21 | Regeneron Pharmaceuticals, Inc. | Therapeutic methods for inhibiting tumor growth with dll4 antagonists |
| WO2007143689A2 (en) * | 2006-06-06 | 2007-12-13 | Genentech, Inc. | Compositions and methods for modulating vascular development |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| WO2008076379A2 (en) | 2006-12-14 | 2008-06-26 | Regeneron Pharmaceuticals, Inc. | Human antibodies to human delta like ligand 4 |
| WO2009095489A2 (en) | 2008-02-01 | 2009-08-06 | Ablynx N.V. | Improved amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of diseases and disorders associated with il-6-mediated signalling |
| WO2009109635A2 (en) | 2008-03-05 | 2009-09-11 | Ablynx Nv | Novel antigen binding dimer-complexes, methods of making and uses thereof |
| WO2010032060A1 (en) * | 2008-09-19 | 2010-03-25 | Medimmune Llc | Antibodies directed to dll4 and uses thereof |
| WO2010040508A1 (en) * | 2008-10-08 | 2010-04-15 | F. Hoffmann-La Roche Ag | Bispecific anti-vegf/anti-ang-2 antibodies |
| WO2011014469A1 (en) * | 2009-07-29 | 2011-02-03 | Regeneron Pharmaceuticals, Inc. | High affinity human antibodies to human angiopoietin-2 |
| WO2011039368A2 (en) * | 2009-10-02 | 2011-04-07 | Boehringer Ingelheim International Gmbh | Dll4-binding molecules |
| US20110172398A1 (en) | 2009-10-02 | 2011-07-14 | Boehringer Ingelheim International Gmbh | Bispecific binding molecules for anti-angiogenesis therapy |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ572177A (en) * | 2006-06-06 | 2012-02-24 | Genentech Inc | Anti-dll4 antibodies and methods using same |
| UA94464C2 (ru) * | 2006-06-06 | 2011-05-10 | Дженентек, Инк. | Выделенное антитело к dll4 и его применение |
| AU2007293614A1 (en) * | 2006-09-08 | 2008-03-13 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
| ES2593484T3 (es) * | 2007-03-29 | 2016-12-09 | Genmab A/S | Anticuerpos biespecíficos y métodos de producción de los mismos |
| US20100260668A1 (en) * | 2008-04-29 | 2010-10-14 | Abbott Laboratories | Dual Variable Domain Immunoglobulins and Uses Thereof |
| AR080794A1 (es) * | 2010-03-26 | 2012-05-09 | Hoffmann La Roche | Anticuerpos bivalentes biespecificos anti- vegf/ anti-ang-2 |
-
2012
- 2012-03-29 US US13/433,354 patent/US20130078247A1/en not_active Abandoned
- 2012-03-30 BR BR112013025294A patent/BR112013025294A2/pt not_active IP Right Cessation
- 2012-03-30 EP EP12711200.1A patent/EP2694545B1/en not_active Not-in-force
- 2012-03-30 SG SG2013070792A patent/SG193557A1/en unknown
- 2012-03-30 AU AU2012234218A patent/AU2012234218A1/en not_active Abandoned
- 2012-03-30 TW TW101111544A patent/TWI535735B/zh not_active IP Right Cessation
- 2012-03-30 AP AP2013007086A patent/AP2013007086A0/xx unknown
- 2012-03-30 CA CA2827809A patent/CA2827809A1/en not_active Abandoned
- 2012-03-30 WO PCT/EP2012/055897 patent/WO2012131076A1/en not_active Ceased
- 2012-03-30 PE PE2013002157A patent/PE20141157A1/es not_active Application Discontinuation
- 2012-03-30 TW TW101111526A patent/TWI551612B/zh active
- 2012-03-30 EA EA201301109A patent/EA201301109A1/ru unknown
- 2012-03-30 CN CN201610374703.XA patent/CN106046167A/zh active Pending
- 2012-03-30 CN CN201280026737.XA patent/CN103596977B/zh not_active Expired - Fee Related
- 2012-03-30 MX MX2013011032A patent/MX337115B/es active IP Right Grant
- 2012-03-30 UY UY0001033997A patent/UY33997A/es unknown
- 2012-03-30 AR ARP120101129A patent/AR085919A1/es unknown
- 2012-03-30 JP JP2014501664A patent/JP2014511682A/ja not_active Ceased
- 2012-03-30 KR KR1020137028119A patent/KR20140016345A/ko not_active Withdrawn
-
2013
- 2013-09-12 CL CL2013002622A patent/CL2013002622A1/es unknown
- 2013-09-26 TN TNP2013000389A patent/TN2013000389A1/fr unknown
- 2013-09-27 CO CO13230710A patent/CO6801638A2/es unknown
- 2013-09-27 MA MA36275A patent/MA35233B1/fr unknown
- 2013-09-30 PH PH12013502031A patent/PH12013502031A1/en unknown
- 2013-10-25 EC ECSP13012996 patent/ECSP13012996A/es unknown
Patent Citations (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1996034103A1 (en) | 1995-04-25 | 1996-10-31 | Vrije Universiteit Brussel | Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes |
| WO1998049185A1 (en) | 1997-04-28 | 1998-11-05 | Fmc Corporation | Lepidopteran gaba-gated chloride channels |
| WO2001079271A1 (en) | 2000-04-12 | 2001-10-25 | Principia Pharmaceutical Corporation | Albumin fusion proteins |
| WO2002056910A1 (en) | 2001-01-17 | 2002-07-25 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| WO2003059934A2 (en) | 2001-12-21 | 2003-07-24 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2004041865A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Stabilized single domain antibodies |
| WO2004041863A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Single domain antibodies directed against interferon- gamma and uses therefor |
| WO2004041867A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders |
| WO2004041862A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
| WO2004060965A2 (en) | 2002-12-31 | 2004-07-22 | Nektar Therapeutics Al, Corporation | Hydrolytically stable maleimide-terminated polymers |
| WO2004081026A2 (en) | 2003-06-30 | 2004-09-23 | Domantis Limited | Polypeptides |
| WO2005044858A1 (en) | 2003-11-07 | 2005-05-19 | Ablynx N.V. | Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor |
| WO2006004678A2 (en) | 2004-06-29 | 2006-01-12 | Bookham Technology Plc | Worm type gear mover assembly |
| WO2006040153A2 (en) | 2004-10-13 | 2006-04-20 | Ablynx N.V. | Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease |
| WO2006122786A2 (en) | 2005-05-18 | 2006-11-23 | Ablynx Nv | Improved nanobodies™ against tumor necrosis factor-alpha |
| WO2007070671A2 (en) | 2005-12-16 | 2007-06-21 | Regeneron Pharmaceuticals, Inc. | Therapeutic methods for inhibiting tumor growth with dll4 antagonists |
| WO2007143689A2 (en) * | 2006-06-06 | 2007-12-13 | Genentech, Inc. | Compositions and methods for modulating vascular development |
| US20080014196A1 (en) | 2006-06-06 | 2008-01-17 | Genentech, Inc. | Compositions and methods for modulating vascular development |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| WO2008076379A2 (en) | 2006-12-14 | 2008-06-26 | Regeneron Pharmaceuticals, Inc. | Human antibodies to human delta like ligand 4 |
| WO2009095489A2 (en) | 2008-02-01 | 2009-08-06 | Ablynx N.V. | Improved amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of diseases and disorders associated with il-6-mediated signalling |
| WO2009109635A2 (en) | 2008-03-05 | 2009-09-11 | Ablynx Nv | Novel antigen binding dimer-complexes, methods of making and uses thereof |
| WO2010032060A1 (en) * | 2008-09-19 | 2010-03-25 | Medimmune Llc | Antibodies directed to dll4 and uses thereof |
| WO2010040508A1 (en) * | 2008-10-08 | 2010-04-15 | F. Hoffmann-La Roche Ag | Bispecific anti-vegf/anti-ang-2 antibodies |
| WO2011014469A1 (en) * | 2009-07-29 | 2011-02-03 | Regeneron Pharmaceuticals, Inc. | High affinity human antibodies to human angiopoietin-2 |
| WO2011039368A2 (en) * | 2009-10-02 | 2011-04-07 | Boehringer Ingelheim International Gmbh | Dll4-binding molecules |
| US20110172398A1 (en) | 2009-10-02 | 2011-07-14 | Boehringer Ingelheim International Gmbh | Bispecific binding molecules for anti-angiogenesis therapy |
Non-Patent Citations (47)
| Title |
|---|
| "Handbook of Therapeutic Antibodies", 2007, WILEY |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
| "Remington's Pharmaceutical Sciences", MACK PUBLISHING CO. |
| AUGUSTIN ET AL., NAT REV MOL CELL BIOL., vol. 10, no. 3, March 2009 (2009-03-01), pages 165 - 77 |
| BARBAS ET AL., PROC. NAT. ACAD. SCI, USA, vol. 91, 1994, pages 3809 - 3813 |
| CHAPMAN, NAT. BIOTECHNOL., vol. 54, 2002, pages 531 - 545 |
| DAUGHERTY ET AL., NUCLEIC ACIDS RESEARCH, vol. 19, no. 9, 1991, pages 2471 - 2476 |
| FALC6N ET AL., AM J PATHOL., vol. 175, no. 5, November 2009 (2009-11-01), pages 2159 - 70 |
| FERRARA ET AL., NAT REV DRUG DISCOV., vol. 3, no. 5, May 2004 (2004-05-01), pages 391 - 400 |
| FOLKMAN ET AL., NATURE, 1989, pages 339 - 58 |
| GOEDE ET AL., BR J CANCER., vol. 103, no. 9, 26 October 2010 (2010-10-26), pages 1407 - 14 |
| HAMERS-CASTERMAN C; ATARHOUCH T; MUYLDERMANS S; ROBINSON G; HAMERS C; SONGA EB; BENDAHMAN N; HAMERS R.: "Naturally occurring antibodies devoid of light chains", NATURE, vol. 363, 1993, pages 446 - 448, XP002535892, DOI: doi:10.1038/363446a0 |
| HARRIS; CHESS, NAT. REV. DRUG. DISCOV., vol. 2, 2003 |
| HAWKINS ET AL., J. MOL. BIOL., vol. 226, no. 3, 1992, pages 889 896 |
| HELFRICH ET AL., CLIN CANCER RES., vol. 15, no. 4, 15 February 2009 (2009-02-15), pages 1384 - 92 |
| HOEY, CELL STEM CELL, vol. 5, no. 2, 7 August 2009 (2009-08-07), pages 168 - 77 |
| HOLT, L.J. ET AL.: "Domain antibodies: proteins for therapy", TRENDS IN BIOTECHNOLOGY, vol. 21, no. 11, 2003, pages 484 - 490, XP004467495, DOI: doi:10.1016/j.tibtech.2003.08.007 |
| J. ZHANG ET AL: "Angiopoietin-1/Tie2 Signal Augments Basal Notch Signal Controlling Vascular Quiescence by Inducing Delta-Like 4 Expression through AKT-mediated Activation of -Catenin", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 286, no. 10, 11 March 2011 (2011-03-11), pages 8055 - 8066, XP055004080, ISSN: 0021-9258, DOI: 10.1074/jbc.M110.192641 * |
| JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9 |
| KABAT ET AL.: "Sequence of proteins of immunological interest", NIH |
| KS JOHNSON; RE HAWKINS: "Affinity maturation of antibodies using phage display", 1996, OXFORD UNIVERSITY PRESS |
| LEWIN: "Genes IV", 1990, OXFORD UNIVERSITY PRESS |
| MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| NICAISE ET AL., PROTEIN SCIENCE, vol. 13, 2004, pages 1882 - 1891 |
| NOGUERA-TROISE ET AL., NATURE, vol. 444, no. 7122, 21 December 2006 (2006-12-21) |
| NOGUERA-TROISE ET AL., NATURE, vol. 444, no. 7122, 21 December 2006 (2006-12-21), pages 1032 - 7 |
| NOGUERA-TROISE, NATURE, vol. 444, no. 7122, 21 December 2006 (2006-12-21) |
| PARK ET AL., CHEST., vol. 132, no. 1, pages 200 - 6 |
| REMINGTON: "Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS AND WILKINS |
| RIDGWAY ET AL., NATURE, vol. 444, no. 7122, 21 December 2006 (2006-12-21), pages 1083 - 7 |
| RIDGWAY, NATURE, vol. 444, no. 7122, 21 December 2006 (2006-12-21), pages 1083 - 7 |
| RIECHMANN; MUYLDERMANS, J. IMMUNOL. METHODS, vol. 231, 1999, pages 25 - 38 |
| ROITT ET AL.: "Immunology", 1989, GOWER MEDICAL PUBLISHING |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCEHNET ET AL., BLOOD, vol. 109, no. 11, 1 June 2007 (2007-06-01), pages 4753 - 60 |
| SHARMA ET AL., CELL CYCLE, vol. 6, no. 8, 2007, pages 927 - 30 |
| SHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SHIH ET AL., CANCER RES., vol. 67, no. 5, 1 March 2007 (2007-03-01), pages 1879 - 82 |
| SHUTTER ET AL., GENES DEVELOP., vol. 14, 2000, pages 1313 - 1318 |
| STRUHL, G.; ADACHI, A., CELL, vol. 93, 1998, pages 649 - 660 |
| STRUHL; ADACHI, CELL., vol. 93, no. 4, 15 May 1998 (1998-05-15), pages 649 - 60 |
| THURSTON ET AL., NAT REV CANCER., vol. 7, no. 5, May 2007 (2007-05-01), pages 327 - 31 |
| VERONESE; HARRIS, ADV. DRUG DELIV. REV., vol. 54, 2003, pages 453 - 456 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WARD, E.S. ET AL.: "Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli", NATURE, vol. 341, 1989, pages 544 - 546 |
| YANG ET AL., PROTEIN ENGINEERING, vol. 16, 2003, pages 761 - 770 |
| YELTON ET AL., IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2013241769B2 (en) * | 2012-03-30 | 2017-05-11 | Boehringer Ingelheim International Gmbh | Ang2-binding molecules |
| WO2014049099A1 (en) * | 2012-09-28 | 2014-04-03 | Boehringer Ingelheim International Gmbh | Pharmaceutical combinations comprising dual angiopoietin-2 / dll4 binders and anti-vegf-r agents |
| WO2014049100A1 (en) * | 2012-09-28 | 2014-04-03 | Boehringer Ingelheim International Gmbh | Pharmaceutical combinations comprising dual angiopoietin-2 / dll4 binders and anti-vegf agents |
| CN116444675A (zh) * | 2023-05-11 | 2023-07-18 | 亲和(武汉)生命科技有限责任公司 | 一种Pfu DNA聚合酶纳米抗体及其制备方法和应用 |
| CN116444675B (zh) * | 2023-05-11 | 2023-12-22 | 亲和(武汉)生命科技有限责任公司 | 一种Pfu DNA聚合酶纳米抗体及其制备方法和应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20140016345A (ko) | 2014-02-07 |
| MX2013011032A (es) | 2013-12-06 |
| TW201302789A (zh) | 2013-01-16 |
| MX337115B (es) | 2016-02-12 |
| EP2694545A1 (en) | 2014-02-12 |
| CA2827809A1 (en) | 2012-10-04 |
| CN103596977B (zh) | 2016-07-06 |
| AU2012234218A1 (en) | 2013-09-05 |
| BR112013025294A2 (pt) | 2017-06-13 |
| AR085919A1 (es) | 2013-11-06 |
| NZ614243A (en) | 2015-04-24 |
| JP2014511682A (ja) | 2014-05-19 |
| CN103596977A (zh) | 2014-02-19 |
| MA35233B1 (fr) | 2014-07-03 |
| UY33997A (es) | 2012-09-28 |
| CN106046167A (zh) | 2016-10-26 |
| SG193557A1 (en) | 2013-11-29 |
| TWI535735B (zh) | 2016-06-01 |
| TW201302797A (zh) | 2013-01-16 |
| CO6801638A2 (es) | 2013-11-29 |
| TN2013000389A1 (en) | 2015-01-20 |
| TWI551612B (zh) | 2016-10-01 |
| ECSP13012996A (es) | 2013-12-31 |
| AP2013007086A0 (en) | 2013-08-31 |
| PH12013502031A1 (en) | 2013-12-16 |
| CL2013002622A1 (es) | 2014-02-14 |
| US20130078247A1 (en) | 2013-03-28 |
| PE20141157A1 (es) | 2014-09-24 |
| EA201301109A1 (ru) | 2014-08-29 |
| EP2694545B1 (en) | 2016-08-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11161916B2 (en) | Bispecific binding molecules binding to VEGF and Ang2 | |
| CA2808696C (en) | Vegf-binding molecules | |
| US20110195494A1 (en) | Dll4-binging molecules | |
| CA2865464C (en) | Ang2-binding molecules | |
| US20140120095A1 (en) | Bispecific binding molecules for anti-angiogenesis therapy | |
| EP2694545B1 (en) | Bispecific binding molecules binding to dll4 and ang2 | |
| OA16772A (en) | Bispecific binding molecules binding to DII4 and Ang2. | |
| NZ614243B2 (en) | BISPECIFIC BINDING MOLECULES BINDING TO Dll4 AND Ang2 | |
| HK1171031A (en) | Dll4-binding molecules | |
| HK1190735A (en) | Bispecific binding molecules binding to d114 and ang2 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12711200 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2827809 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2012234218 Country of ref document: AU Date of ref document: 20120330 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013002622 Country of ref document: CL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/011032 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13230710 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2014501664 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 002157-2013 Country of ref document: PE |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1301005628 Country of ref document: TH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2013000641 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20137028119 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201312687 Country of ref document: UA |
|
| REEP | Request for entry into the european phase |
Ref document number: 2012711200 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012711200 Country of ref document: EP Ref document number: 201301109 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 13277 Country of ref document: GE Kind code of ref document: P |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013025294 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013025294 Country of ref document: BR Kind code of ref document: A2 Effective date: 20130930 |