WO2012093172A1 - Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors - Google Patents

Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors Download PDF

Info

Publication number
WO2012093172A1
WO2012093172A1 PCT/EP2012/050193 EP2012050193W WO2012093172A1 WO 2012093172 A1 WO2012093172 A1 WO 2012093172A1 EP 2012050193 W EP2012050193 W EP 2012050193W WO 2012093172 A1 WO2012093172 A1 WO 2012093172A1
Authority
WO
WIPO (PCT)
Prior art keywords
alphabody
ligand
cytokine
receptor
growth factor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/050193
Other languages
English (en)
French (fr)
Inventor
Ignace Lasters
Johan Desmet
Maria Henderikx
Anita WEHNERT
Geert Meersseman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Complix NV
Original Assignee
Complix NV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Complix NV filed Critical Complix NV
Priority to EP12702771.2A priority Critical patent/EP2661447B1/en
Priority to AU2012204846A priority patent/AU2012204846B2/en
Priority to JP2013547867A priority patent/JP2014504869A/ja
Priority to DK12702771.2T priority patent/DK2661447T3/en
Priority to IN1394MUN2013 priority patent/IN2013MN01394A/en
Priority to US13/994,107 priority patent/US20140057830A1/en
Priority to BR112013017367A priority patent/BR112013017367A2/pt
Priority to CN2012800046860A priority patent/CN103339148A/zh
Priority to CA2821646A priority patent/CA2821646A1/en
Publication of WO2012093172A1 publication Critical patent/WO2012093172A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics

Definitions

  • the present invention relates to the field of binding agents to cytokines and growth factors and/or to their receptorsand uses thereof for prophylactic, therapeutic or diagnostic purposes as well as in screening and detection.
  • Cytokines are considered to be a sub-class of growth factors which function as cell-signaling protein molecules. For many growth factors the characterization as 'cytokine' or 'hormone' is debated by biochemists in the art.
  • Cytokines encompass a diverse group of small proteins that mediate cell signalling and communication.
  • the major pro-inflammatory cytokines that are responsible for early responses are IL-1-alpha, IL-1-beta, IL-6, and TNF-alpha.
  • Other pro-inflammatory mediators include LIF, IFN-gamma, OSM, CNTF, TGF-beta, GM-CSF, IL-1 1 , IL-12, IL-23, IL-17, IL-18, IL-8 and a variety of chemotactic cytokines (chemokines) that chemoattract inflammatory cells.
  • cytokines either act as endogenous pyrogens (IL-1 , IL-6, TNF-alpha), upregulate the synthesis of secondary mediators and pro-inflammatory cytokines by both macrophages and mesenchymal cells (including fibroblasts, epithelial and endothelial cells), stimulate the production of acute phase proteins, or attract inflammatory cells.
  • the antiinflammatory cytokines control the proinflammatory cytokine response.
  • Major antiinflammatory cytokines include interleukin (IL)-1 receptor antagonist, IL-4, IL-6, IL-10, IL-1 1 , and IL-13.
  • Specific cytokine receptors for IL-1 , tumor necrosis factor-a, and IL-18 also function as proinflammatory cytokine inhibitors. The net effect of an inflammatory response is determined by the balance between pro-inflammatory and anti-inflammatory cytokines.
  • the traditional cytokines can be subdivided into several groups, including the immune/hematopoietins, interferons, tumor necrosis factor (TNF)-related molecules, and the chemokines. They exert their biological functions through specific receptors expressed on the surface of target cells. These receptors can be grouped into families according to both structural and amino acid sequence similarities.
  • the cytokine receptor superfamily is composed of the receptors for many growth factor families including interferon, TNF and haematopoietic growth factors. The largest subclass in this family is that of the type I cytokine receptors, a group characterized by the presence of a conserved extracellular region of approximately 200 amino acids containing two fibronectin type III folds.
  • haematopoietin receptor module This region, known as the haematopoietin receptor module, has been shown to play an essential role in receptor/ligand binding and receptor/receptor dimerization. It is characterized by four conserved cysteine residues in the first domain and a W-S-x-W-S motif in the second domain. This canonical W-S-x-W-S motif is lacking in the class II cytokine receptors.
  • cytokines A number of other growth factors are often referred to as cytokines in the art because of their functional and structural overlap with cytokines.
  • tyrosine kinase receptor ligands such as Flt3 ligand are often classified as short chain cytokines.
  • Flt3 ligand forms a dimer similar to the M-CSF and CSF dimers. It plays an important role in hematopoietic stem/progenitor cell survival and proliferation. Because it acts on a membrane-bound receptor it can be considered to be involved in cell signalling.
  • Receptor chains of the type I cytokine receptors typically form part of a multicomponent complex which includes both ligand binding and signalling subunits, of which the latter is typically a member of several receptor complexes. These characteristics account for much of the pleiotropy and redundancy amongst cytokines.
  • Cytokines or growth factors can be monomeric (e.g. G-CSF, IL-1alpha, 11-1 beta, IL-2, IL-3, IL-4, IL-6), homodimeric (e.g.lL-5, IFN-gamma, IL-10, Flt3 ligand), or heterodimeric (e.g. IL-12, IL-23).
  • cytokines A well characterized family of cytokines is the superfamily of heterodimeric cytokines including IL-12, IL-23, IL-27, CLC-sCNTFR, CLC-CLF-1 and the newly identified IL-35, all of which bind heterodimeric receptors.
  • Heterodimeric cytokines consist of two different subunits. One of these subunits comprises a four-helix bundle domain.
  • IL-23 for example, consists of the p40 subunit, which is shared with the cytokine IL-12, and the p19 or IL-23 alpha subunit which has a 4-helix bundle structure.
  • IL-17F/IL-17A is a heterodimeric cytokine (Wright et al., The Journal of Immunology, 2008, 181 : 2799-2805).
  • the receptors of heterodimeric cytokines also consist of two or more different subunits.
  • the IL-12 receptor for instance, is a heterodimer of IL-12Rbeta1 and IL-12Rbeta2 and the IL-23 receptor is a heterodimer of IL-12Rbeta1 and IL-23R.
  • IL-12Rbeta1 is used by both IL-12 and IL-23 for signalling. Targeting this receptor will lead to a blockade of both IL- 12 and IL-23 signaling.
  • IL23 activates the same signaling molecules as IL-12: JAK2, TYK2, and STAT1 , STAT3, STAT4, and STAT5.
  • STAT4 activation is substantially weaker and different DNA-binding STAT complexes form in response to IL-23 compared with IL12.
  • IL- 23R associates constitutively with JAK2 and in a ligand-dependent manner with STAT3.
  • Heterodimeric cytokines or growth factors often have subunits which are common to different cytokines (e.g. p40 is common to IL-12 and IL-23). This may limit the specificity of binding agents raised against these cytokines, especially in cases where the binding agent recognizes a subunit which is common to different cytokines. Also of particular importance is that sometimes an isolated subunit of a heterodimeric cytokine is found in body fluids. For example in the rheumatoid synovium, abundant expression of the interleukin (IL)23 p19 subunit has been observed (Brentano et al., Ann Rheum Dis 2008;68: 143-150).
  • IL interleukin
  • this binding agent recognizes such subunit only in the heterodimeric context, it may be advantageous to endow this binding agent with a binding property which ensures specificity for the heterodimeric cytokine.
  • This can be accomplished by a binding agent that recognizes simultaneously both subunits of the given heterodimeric cytokine while showing little affinity for the individual subunits.
  • the binding agent only recognizes a given subunit outside the heterodimeric context (e.g. in cases where it is desired to 'mop-up' abundantly expressed isolated cytokine subunits). This can be accomplished by e.g. a binding agent which shows affinity for the given individual subunit (e.g. IL-23(p19)) but which is sterically hindered by the other subunit (e.g. IL-23(p40)) for binding to said individual subunit in the heterodimeric context.
  • a binding agent which shows affinity for the given individual subunit (e.g. IL-23(p19)) but which is
  • IL-23 plays an important role in the inflammatory response against infection. It promotes upregulation of the matrix metalloprotease MMP9, increases angiogenesis and reduces CD8+ T-cell infiltration. Recently, IL-23 has been implicated in the development of cancerous tumors. In conjunction with IL-6 and TGF- ⁇ , IL-23 stimulates naive CD4+ T cells to differentiate into a novel subset of cells called Th17 cells, which are distinct from the classical Th1 and Th2 cells. Th17 cells produce IL-17, a proinflammatory cytokine that enhances T cell priming and stimulates the production of proinflammatory molecules such as IL-1 , IL-6, TNF-alpha, NOS-2, and chemokines resulting in inflammation.
  • proinflammatory molecules such as IL-1 , IL-6, TNF-alpha, NOS-2, and chemokines resulting in inflammation.
  • IL-23 is an important mediator of organ specific autoimmune diseases (Yen et al., 2006). Knockout mice deficient in either p40 or p19, or in either subunit of the IL-23 receptor (IL-23R and IL12R ⁇ 1) develop less severe symptoms of multiple sclerosis and inflammatory bowel disease.
  • anti-IL- 23(p19) specific antibodies can inhibit EAE, a preclinical animal model of human MS (Chen et al., 2006).
  • the secretion of IL-12 by activated dendritic cells and phagocytes leads to a Th1 response with interferon-gamma production together with an enhanced cytotoxic, antitumor and antimicrobial response. Consequently, anti-IL12 antibodies may interfere with the Th1 pathway leading to susceptibility for infection.
  • the therapeutic antibodies Ustekinumab (previously also known under the experimental name CNTO 1275 and now approved for the treatment of plaque psoriasis) and Briakinumab (in phase III clinical trial for the treatment of plaque psoriasis and in phase II trial for MS) are human monoclonal antibodies that neutralize both IL-12 as well as IL-23. There is a concern about adverse effects, more in particular the risk for infections, resulting from the IL23/IL-12 cross-reactivity. While Lima et al.
  • cytokines and their receptors constitute attractive targets for the development of pharmaceuticals for the prevention or treatment of the diseases or disorders in which they are involved. More particularly, for heterodimeric cytokines or growth factors a compound blocking specifically one subunit of the cytokine may be advantageous over a compound that does not discriminate between cytokines sharing common subunits.
  • WO2010/066740 describes Alphabody scaffolds as single-chain triple-stranded alpha-helical coiled coil scaffolds. However, it has not been disclosed how these Alphabody scaffolds can be manipulated to obtain Alphabodies specifically binding to targets with sufficient affinity in order to modulate the biological mechanisms in which these targets are involved.
  • the present inventors have found methods which allow the generation of Alphabody polypeptides which specifically bind to a target of interest. It has been found that using the Alphabody scaffold, binders can be generated which bind to a target of interest with high affinity and specificity, such that binders can be generated which overcome one or more of the disadvantages of the prior art binders. Moreover it has been found that such binders have several advantages over the traditional (immunoglobulin and non-immunoglobulin) binding agents known in the art.
  • Such advantages include, without limitation, the fact that they are compact and small in size (between 10 and 14 kDa, which is 10 times smaller than an antibody), they are extremely stable (having a melting temperature of more than 100 °C), they can be made resistant to different proteases, they are highly engineerable (in the sense that multiple substitutions will generally not obliterate their correct and stable folding), and have a structure which is based on natural motifs which have been redesigned via protein engineering techniques.
  • Alphabody polypeptides comprising an Alphabody (as defined herein, and also referred to as Alphabodies of the invention) that specifically bind to cytokines or growth factors and/or their receptors, as well as polypeptides that comprise or essentially consist of one or more such Alphabodies and to uses of such Alphabodies or polypeptides for prophylactic, therapeutic or diagnostic purposes.
  • the present invention provides Alphabody polypeptides which specifically bind to a cytokine or growth factor and/or to a cytokine or growth factor receptor.
  • the Alphabody polypeptides of the invention specifically bind to a cytokine or growth factor, and more particularly to the receptor binding site on that cytokine or growth factor.
  • the Alphabody polypeptides of the invention that bind to a cytokine or growth factor inhibit the interaction between that cytokine or growth factor and its cytokine or growth factor receptor(s).
  • the cytokine or growth factor is a heterodimeric cytokine or growth factor.
  • the cytokine or growth factor is a heterodimeric cytokine or growth factor, and the Alphabody is directed to a cytokine-specific subunit of the cytokine or a growth factor-specific subunit of the growth factor.
  • the cytokine is of the family of IL-12 cytokines. Most particularly the cytokine is IL-23.
  • the cytokine to which the Alphabody polypeptides of the present invention specifically bind is a heterodimeric cytokine, such as for example but not limited to IL-12, IL-23, IL-27 or IL-35.
  • the Alphabody polypeptides of the present invention specifically bind to IL-23, and more particularly to the p19-subunit of IL-23, to the p40 subunit of IL-23 or to both the p19 and the p40 subunit of IL-23.
  • Alphabody polypeptides of the present invention specifically bind to the p19 subunit of IL-23 and do not bind to the p40 subunit of IL-23.
  • Alphabody polypeptides of the present invention that specifically bind to a cytokine are, in particular embodiments, amino acid sequences having at least 80% sequence identity with at least one of the amino acid sequences corresponding to any one of SEQJD1 to SEQJD127 .
  • the cytokine or growth factor to which the Alphabody polypeptides of the present invention specifically bind is a class III receptor tyrosine kinase (RTK) ligand and/or its receptor, such as Flt3 ligand (Flt3L) or Flt3 receptor (Flt3R).
  • RTK receptor tyrosine kinase
  • Flt3L Flt3 ligand
  • Flt3R Flt3 receptor
  • the Alphabody polypeptides of the invention substantially interact with a single monomer of the Flt3L dimer, for example a human flt3L (hflt3L) dimer.
  • Alphabody polypeptides of the present invention that specifically bind to a cytokine or growth factor are, in particular embodiments, amino acid sequences having the specific hFlt3L-binding residues presented in Table 5 herein, and/or having at least 80% sequence identity with at least one of the amino acid sequences corresponding to SEQJD134 or SEQJD135.
  • the Alphabody polypeptides of the invention specifically bind to a cytokine or growth factor receptor, and more particularly to the cytokine or growth factor binding site on the cytokine or growth factor receptor.
  • the Alphabody polypeptides of the invention that bind to a cytokine or growth factor receptor inhibit the interaction between that cytokine or growth factor receptor and its cytokine or growth factor ligand.
  • cytokine or growth factor receptors to which the Alphabody polypeptides of the present invention may specifically bind can be chosen from the group consisting of, but are not limited to, type 1 interleukin receptor, erythropoietin receptor, GM-CSF receptor, G-CSF receptor, growth hormone receptor, prolactin receptor, oncostatin M receptor, leukemia inhibitory factor receptor, type II interleukin receptors, interferon-alpha/beta receptor, interferon-gamma receptor, interleukin-1 receptor, CSF1 , C-kit receptor, interleukin-18 receptor, CD27, CD30, CD120, CD40, lymphotoxin beta receptor, interleukin- 8 receptor, CCR1 , CXCR4, MCAF receptor, NAP-2 receptor, CC chemokine receptors, CXC chemokine receptors, CX3C chemokine receptors, XC chemokine receptor (XCR1), TGF beta receptor 1 and TGF beta receptor
  • the cytokine or growth factor receptor to which the Alphabodies of the present invention specifically bind is a receptor for a heterodimeric cytokine or growth factor, such as for example but not limited to IL-12 receptor, the IL-23 receptor, the IL-27 receptor or the IL-35 receptor.
  • a heterodimeric cytokine or growth factor such as for example but not limited to IL-12 receptor, the IL-23 receptor, the IL-27 receptor or the IL-35 receptor.
  • the Alphabody polypeptides of the invention bind both to a cytokine or growth factor and to a cytokine or growth factor receptor; the Alphabody polypeptides in such embodiments are said to be 'bispecific'.
  • the present invention provides Alphabody polypeptides that comprise only one single Alphabody or that consist of only one single Alphabody, which specifically bind to a cytokine or growth factor or to a cytokine or growth factor receptor.
  • the polypeptides of the present invention comprise more than one Alphabody which are interconnected in one polypeptide chain.
  • Alphabody polypeptides that comprise or essentially consist of one or more Alphabodies of the present invention that specifically bind to a cytokine or growth factor and/or to a cytokine or growth factor receptor (also referred to herein as polypeptides of the invention).
  • Alphabody polypeptides comprise one or more Alphabodies of the present invention and optionally one or more further groups, optionally linked via one or more linking sequences.
  • the present invention provides nucleic acid sequences encoding the Alphabody polypeptides (such as Alphabodies) or the polypeptides of the invention (also referred to herein as nucleic acid sequences of the invention).
  • the present invention provides vectors comprising one or more nucleic acid sequences of the invention.
  • the present invention provides hosts or host cells that express or are capable of expressing one or more Alphabody polypeptides of the invention.
  • the present invention provides pharmaceutical compositions comprising one or more Alphabody polypeptides and/or nucleic acid sequences according to the invention and optionally at least one pharmaceutically acceptable carrier (also referred to herein as pharmaceutical compositions of the invention).
  • the pharmaceutical compositions of the invention may further optionally comprise at least one other pharmaceutically active compound.
  • the present invention provides methods for the production of the Alphabody polypeptides or pharmaceutical compositions of the invention that specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor, the methods at least comprising the steps of:
  • the methods for the production of the Alphabody polypeptides or pharmaceutical compositions of the invention that specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor may at least comprise the steps of:
  • step b) introducing the nucleic acid or vector library into host cells and culturing the host cells in a medium under conditions suitable for the production of the single-chain Alphabody library, c) optionally isolating the single-chain Alphabody library produced in step b) from the host cells and/or from the medium,
  • step d) contacting the cytokine or growth factor, or cytokine or growth factor receptor, with the single-chain Alphabody library produced in step b or isolated in step c), and e) isolating from the single-chain Alphabody library being contacted with the cytokine or growth factor, or cytokine or growth factor receptor, of interest in step d), the one or more single-chain Alphabodies having detectable binding affinity for, or a detectable in vitro effect on the activity of, the cytokine or growth factor and/or the cytokine or growth factor receptor.
  • the Alphabody library is further enriched for single-chain
  • the method comprises the step of determining the amino acid sequence of one or more of the single-chain Alphabodies obtained in step e).
  • the method comprises the step of synthesizing one or more of the single-chain Alphabodies obtained in step e).
  • the present invention provides the use of Alphabodies or polypeptides of the invention that specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor for the preparation of a medicament for the prevention and/or treatment of at least one cytokine- or growth factor- mediated disease and/or disorder in which said cytokine or growth factor and/or said cytokine or growth factor receptor are involved.
  • the invention provides Alphabodies, polypeptides and pharmaceutical compositions specifically binding to a cytokine or growth factor and/or a cytokine or growth factor receptor for use in the prevention and/or treatment of at least one cytokine/growth factor-mediated disease and/or disorder in which said cytokine or growth factor and/or said cytokine or growth factor receptor are involved.
  • the present invention also provides methods for the prevention and/or treatment of at least one cytokine/growth factor-mediated disease and/or disorder, comprising administering to a subject in need thereof, a pharmaceutically active amount of one or more Alphabodies, polypeptides and/or pharmaceutical compositions of the invention.
  • Cytokine- or growth factor-mediated diseases and/or disorders in which a cytokine or growth factor and/or a cytokine or growth factor receptor are involved can be chosen from the group consisting of, but are not limited to inflammatory and/or autoimmune diseases and disorders.
  • the diseases and/or disorders are selected from inflammation and inflammatory disorders such as but not limited to bowel diseases (colitis, Crohn's disease, IBD), infectious diseases, psoriasis, and other autoimmune diseases (such as rheumatoid arthritis, Multiple Sclerosis, Spondylarthritis, Sarcoidosis, Lupus, Behcet's disease), transplant rejection, cystic fibrosis, asthma, chronic obstructive pulmonary disease, cancer, viral infection, common variable immunodeficiency.
  • bowel diseases colitis, Crohn's disease, IBD
  • infectious diseases such as rheumatoid arthritis, Multiple Sclerosis, Spondylarthritis, Sarcoidosis, Lupus, Behcet's disease
  • cystic fibrosis such as chronic obstructive pulmonary disease, cancer, viral infection, common variable immunodeficiency.
  • 'about' as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, is meant to encompass variations of +/-10% or less, preferably +1-5% or less, more preferably +/-1 % or less, and still more preferably +/-0.1 % or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier 'about' refers is itself also specifically, and preferably, disclosed.
  • an 'Alphabody (of the invention)' or 'Alphabodies (of the invention)' can generally be defined as self-folded, single-chain, triple-stranded, predominantly alpha- helical, coiled coil amino acid sequences, polypeptides or proteins. More particularly, Alphabodies as used in the context of the present invention can be defined as amino acid sequences, polypeptides or proteins having the general formula HRS1 -L1 -HRS2-L2-HRS3, wherein
  • each of H RS1 , HRS2 and HRS3 is independently a heptad repeat sequence (HRS) consisting of 2 to 7 consecutive heptad repeat units, at least 50% of all heptad a- and d- positions are occupied by isoleucine residues, each HRS starts and ends with an aliphatic or aromatic amino acid residue located at either a heptad a- or d-position, and HRS1 , HRS2 and HRS3 together form a triple-stranded, alpha-helical, coiled coil structure; and • each of L1 and L2 are independently a linker fragment, as further defined hereinafter, which covalently connect HRS1 to HRS2 and HRS2 to HRS3, respectively.
  • HRS heptad repeat sequence
  • a 'parallel Alphabody' shall have the meaning of an Alphabody (of the invention) wherein the alpha-helices of the triple-stranded, alpha-helical, coiled coil structure together form a parallel coiled coil structure, i.e., a coiled coil wherein all three alpha-helices are parallel.
  • an 'antiparallel Alphabody' shall have the meaning of an Alphabody (of the invention) wherein the alpha-helices of the triple-stranded, alpha-helical, coiled coil structure together form an antiparallel coiled coil structure, i.e., a coiled coil wherein two alpha-helices are parallel and the third alpha-helix is antiparallel with respect to these two helices.
  • the invention also envisages polypeptides comprising a sequence with the general formula HRS1-L1-HRS2-L2-HRS3, but which in certain particular embodiments comprise further groups, moieties and/or residues, which are covalently linked, more particularly N- and/or C-terminal covalently linked, to a basic Alphabody structure having the formula HRS1-L1-HRS2-L2-HRS3.
  • HRS1-L1-HRS2-L2-HRS3 e.g., a basic Alphabody structure having the formula HRS1-L1-HRS2-L2-HRS3.
  • the binding features described for an Alphabody herein can generally also be applied to Alphabody polypeptides comprising said Alphabody.
  • the Alphabody polypeptides of the present invention are however characterized by the presence of at least one triple-helix structure (consisting of three helixes) which as such forms a coiled coil.
  • 'heptad', 'heptad unit' or 'heptad repeat unit' are used interchangeably herein and shall herein have the meaning of a 7-residue (poly)peptide fragment that is repeated two or more times within each heptad repeat sequence of an Alphabody, polypeptide or composition of the invention and is represented as 'abcdefg' or 'defgabc', wherein the symbols 'a' to 'g' denote conventional heptad positions.
  • heptad positions are assigned to specific amino acid residues within a heptad, a heptad unit, or a heptad repeat unit, present in an Alphabody, polypeptide or composition of the invention, for example, by using specialized software such as the COILS method of Lupas et al. (Science 1991 , 252: 1 162-1 164; http://www.russell.embl-heidelberg.de/cgi-bin/coils-svr.pl).
  • heptads or heptad units as present in the Alphabodies of the invention are not strictly limited to the above-cited representations (i.e. 'abcdefg' or 'defgabc') as will become clear from the further description herein and in their broadest sense constitute a 7-residue (poly)peptide fragment per se, comprising at least assignable heptad positions a and d.
  • 'heptad a-positions', 'heptad b-positions', 'heptad c-positions', 'heptad d- positions', 'heptad e-positions', 'heptad f-positions' and 'heptad g-positions' refer respectively to the conventional 'a', 'b', 'c', 'd', 'e', 'f and 'g' amino acid positions in a heptad, heptad repeat or heptad repeat unit of an Alphabody, polypeptide or composition of the invention.
  • a 'heptad motif as used herein shall have the meaning of a 7-residue (poly)peptide pattern.
  • a 'heptad motif of the type 'abcdefg' can usually be represented as ⁇ '
  • a 'heptad motif of the type 'defgabc' can usually represented as ⁇ ', wherein the symbol ⁇ ' denotes an apolar or hydrophobic amino acid residue and the symbol 'P' denotes a polar or hydrophilic amino acid residue.
  • heptad motifs as present in the Alphabodies of the invention are not strictly limited to the above-cited representations (i.e. 'abcdefg', ⁇ ', 'defgabc' and ⁇ ') as will become clear from the further description herein.
  • a 'heptad repeat sequence' as used herein shall have the meaning of an amino acid sequence or sequence fragment consisting of n consecutive heptads, where n is a number equal to or greater than 2.
  • the terms 'linker', 'linker fragment' or 'linker sequence' are used interchangeably herein and refer to an amino acid sequence fragment that is part of the contiguous amino acid sequence of a single-chain Alphabody, and which covalently interconnect the HRS sequences of that Alphabody.
  • a 'coiled coil' or 'coiled coil structure' shall be used interchangeably herein and will be clear to the person skilled in the art based on the common general knowledge and the description and further references cited herein. Particular reference in this regard is made to review papers concerning coiled coil structures, such as for example, Cohen and Parry Proteins 1990, 7: 1-15; Kohn and Hodges Trends Biotechnol 1998, 16:379-389; Schneider et al Fold Des 1998, 3:R29-R40; Harbury et al.
  • an 'alpha-helical part of an Alphabody' shall herein have the meaning of that part of an Alphabody which has an alpha-helical secondary structure. Furthermore, any part of the full part of an Alphabody having an alpha-helical secondary structure is also considered an alpha-helical part of an Alphabody. More particularly, in the context of a binding site, where one or more amino acids located in an alpha-helical part of the Alphabody contribute to the binding site, the binding site is considered to be formed by an alpha-helical part of the Alphabody.
  • a 'solvent-oriented' or 'solvent-exposed' region of an alpha-helix of an Alphabody shall herein have the meaning of that part on an Alphabody which is directly exposed or which comes directly into contact with the solvent, environment, surroundings or milieu in which it is present. Furthermore, any part of the full part of an Alphabody which is directly exposed or which comes directly into contact with the solvent is also considered a solvent- oriented or solvent-exposed region of an Alphabody. More particularly, in the context of a binding site, where one or more amino acids located in a solvent-oriented part of the Alphabody contribute to the binding site, the binding site is considered to be formed by a solvent-oriented part of the Alphabody.
  • Alphabody which corresponds to the concave, groove-like local shape, which is formed by any pair of spatially adjacent alpha-helices within an Alphabody.
  • amino acid residues will be indicated either by their full name or according to the standard three-letter or one-letter amino acid code.
  • the term 'homology' denotes at least secondary structural similarity between two macromolecules, particularly between two polypeptides or polynucleotides, from same or different taxons, wherein said similarity is due to shared ancestry.
  • the term 'homologues' denotes so-related macromolecules having said secondary and optionally tertiary structural similarity.
  • Alphabodies and nucleic acid sequences are said to be 'exactly the same' if they have 100% sequence identity over their entire length.
  • An Alphabody of the invention is said to 'specifically bind to' a particular target when that Alphabody of the invention has affinity for, specificity for, and/or is specifically directed against that target (or against at least one part or fragment thereof).
  • the 'specificity' of an Alphabody of the invention as used herein can be determined based on affinity and/or avidity.
  • the 'affinity' of an Alphabody, polypeptide or composition of the invention is represented by the equilibrium constant for the dissociation of the Alphabody, polypeptide or composition and the target protein of interest to which it binds. The lower the KD value, the stronger the binding strength between the Alphabody, polypeptide or composition and the target protein of interest to which it binds.
  • the affinity can also be expressed in terms of the affinity constant (KA), which corresponds to 1/KD.
  • the binding affinity of an Alphabody of the invention can be determined in a manner known to the skilled person, depending on the specific target protein of interest.
  • the KD can be expressed as the ratio of the dissociation rate constant of a complex, denoted as kOff (expressed in seconds “1 or s "1 ), to the rate constant of its association, denoted kOn (expressed in molar "1 seconds “1 or M “1 s "1 ).
  • kOff the rate constant of its association
  • kOn the rate constant of its association
  • a KD value greater than about 1 millimolar is generally considered to indicate non-binding or nonspecific binding.
  • the 'avidity' of an Alphabody of the invention is the measure of the strength of binding between an Alphabody of the invention and the pertinent target protein of interest. Avidity is related to both the affinity between a binding site on the target protein of interest and a binding site on the Alphabody of the invention and the number of pertinent binding sites present on the Alphabody of the invention.
  • An Alphabody of the invention is said to be 'specific for a first target protein of interest as opposed to a second target protein of interest' when it binds to the first target protein of interest with an affinity that is at least 5 times, such as at least 10 times, such as at least 100 times, and preferably at least 1000 times higher than the affinity with which that Alphabody of the invention binds to the second target protein of interest. Accordingly, in certain embodiments, when an Alphabody is said to be 'specific for' a first target protein of interest as opposed to a second target protein of interest, it may specifically bind to (as defined herein) the first target protein of interest, but not to the second target protein of interest.
  • the 'half-life' of an Alphabody of the invention can generally be defined as the time that is needed for the in vivo serum or plasma concentration of the Alphabody to be reduced by 50%.
  • the in vivo half-life of an Alphabody of the invention can be determined in any manner known to the person skilled in the art, such as by pharmacokinetic analysis. As will be clear to the skilled person, the half-life can be expressed using parameters such as the t1/2-alpha, t1/2-beta and the area under the curve (AUC).
  • An increased half-life in vivo is generally characterized by an increase in one or more and preferably in all three of the parameters t1/2-alpha, t1/2-beta and the area under the curve (AUC).
  • the terms 'inhibiting', 'reducing' and/or 'preventing' may refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and inhibits, reduces and/or prevents the interaction between that target protein of interest, and its natural binding partner.
  • the terms 'inhibiting', 'reducing' and/or 'preventing' may also refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and inhibits, reduces and/or prevents a biological activity of that target protein of interest, as measured using a suitable in vitro, cellular or in vivo assay.
  • 'inhibiting', 'reducing' and/or 'preventing' may also refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and inhibits, reduces and/or prevents one or more biological or physiological mechanisms, effects, responses, functions pathways or activities in which the target protein of interest is involved.
  • Such an action of the Alphabody according to the invention as an antagonist may be determined in any suitable manner and/or using any suitable (in vitro and usually cellular or in vivo) assay known in the art, depending on the target protein of interest.
  • the terms 'enhancing', 'increasing' and/or 'activating' may refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and enhances, increases and/or activates the interaction between that target protein of interest, and its natural binding partner.
  • the terms 'enhancing', 'increasing' and/or 'activating' may also refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and enhances, increases and/or activates a biological activity of that target protein of interest, as measured using a suitable in vitro, cellular or in vivo assay.
  • 'enhancing', 'increasing' and/or 'activating' may also refer to (the use of) an Alphabody according to the invention that specifically binds to a target protein of interest and enhances, increases and/or activates one or more biological or physiological mechanisms, effects, responses, functions pathways or activities in which the target protein of interest is involved.
  • Such an action of the Alphabody according to the invention as an agonist may be determined in any suitable manner and/or using any suitable (in vitro and usually cellular or in vivo) assay known in the art, depending on the target protein of interest.
  • the inhibiting or antagonizing activity or the enhancing or agonizing activity of an Alphabody of the invention may be reversible or irreversible, but for pharmaceutical and pharmacological applications will typically occur reversibly.
  • An Alphabody, polypeptide, composition or nucleic acid sequence of the invention is considered to be '(in) essentially isolated (form)' as used herein corresponds to an Alphabody, when it has been extracted or purified from the host cell and/or medium in which it is produced.
  • binding region', 'binding site' or 'interaction site' present on the Alphabodies shall herein have the meaning of a particular site, part, domain or stretch of amino acid residues present on the Alphabodies that is responsible for binding to a target molecule.
  • binding region essentially consists of specific amino acid residues from the Alphabody which are in contact with the target molecule.
  • An Alphabody of the invention is said to show 'cross-reactivity' for two different target proteins of interest if it is specific for (as defined herein) both of these different target proteins of interest.
  • An Alphabody of the invention is said to be 'monovalent' if the Alphabody contains one binding site directed against or specifically binding to a site, determinant, part, domain or stretch of amino acid residues of the target of interest.
  • the Alphabody is said to be 'bivalent' (in the case of two binding sites on the Alphabody) or multivalent (in the case of more than two binding sites on the Alphabody), such as for example trivalent.
  • the term 'bispecific' when referring to an Alphabody implies that either a) two or more of the binding sites of an Alphabody are directed against or specifically bind to the same target of interest but not to the same (i.e. to a different) site, determinant, part, domain or stretch of amino acid residues of that target, the Alphabody is said to be 'bispecific' (in the case of two binding sites on the Alphabody) or multispecific (in the case of more than two binding sites on the Alphabody) or b) two or more binding sites of an Alphabody are directed against or specifically bind to different target molecules of interest.
  • the term 'multispecific' is used in the case that more than two binding sites are present on the Alphabody.
  • a 'bispecific Alphabody' or a 'multi-specific Alphabody' as used herein shall have the meaning of a single-chain Alphabody of the formula (N-)HRS1-L1-HRS2-L2- HRS3(-C) comprising respectively two or at least two binding sites, wherein these two or more binding sites have a different binding specificity.
  • an Alphabody is herein considered 'bispecific' or 'multispecific' if respectively two or more than two different binding regions exist in the same single-domain Alphabody.
  • the term 'prevention and/or treatment' comprises preventing and/or treating a certain disease and/or disorder, preventing the onset of a certain disease and/or disorder, slowing down or reversing the progress of a certain disease and/or disorder, preventing or slowing down the onset of one or more symptoms associated with a certain disease and/or disorder, reducing and/or alleviating one or more symptoms associated with a certain disease and/or disorder, reducing the severity and/or the duration of a certain disease and/or disorder, and generally any prophylactic or therapeutic effect of the Alphabodies of the invention that is beneficial to the subject or patient being treated.
  • All documents cited in the present specification are hereby incorporated by reference in their entirety. Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. By means of further guidance, term definitions are included to better appreciate the teaching of the present invention.
  • target-binding Alphabody polypeptides More particularly methods for providing cytokine- or growth factor- binding, or cytokine receptor- or growth factor receptor-binding, Alphabody polypeptides.
  • target-binding Alphabody polypeptides can bind to the target with affinities at least comparable to traditional binding agents.
  • target-binding Alphabody polypeptides maintain the advantages identified for Alphabody scaffolds. Alphabodies not only have a unique structure but also have several advantages over the traditional (immunoglobulin and non-immunoglobulin) scaffolds known in the art.
  • the present invention provides Alphabody polypeptides capable of binding to a cytokine or growth factor and/or a cytokine or growth factor receptor. Most particularly, the present invention provides Alphabody polypeptides which are capable of binding to a cytokine or growth factor and/or cytokine or growth factor receptor by a binding site which is located either primarily within the groove of an Alphabody, on the surface of an Alphabody helix, or is formed by a linker region of an Alphabody.
  • Alphabody polypeptides directed against cytokines or growth factor and/or cytokine or growth factor receptors are provided wherein the binding site of the Alphabody polypeptide is formed either:
  • binding site of the Alphabody which can be comprised in an Alphabody polypeptide is formed either:
  • growth factor is typically used in the art to refer to a naturally occurring substance capable of stimulating cellular growth, proliferation and cellular differentiation. Growth factors are important for regulating a variety of cellular processes.
  • the term 'cytokine' typically refers to a sub-class class of growth factors which function as cell- signaling protein molecules. The cytokines are sometimes classed as interleukins, lymphokines, chemokines, transforming growth factors and interferons, based on structure, function, secreting cell type or target cell, but this distinction is obsolete in view of the overlap between these classes. Similarly, for many growth factors the characterization as 'cytokine' or 'hormone' is debated by biochemists in the art.
  • the present invention relates to Alphabodies which can bind to a growth factor or growth factor receptor. More particularly the growth factor is an immunomodulatory growth factor, such as a cytokine or a growth factor involved in immunomodulation.
  • the growth factors of interest in the context of the present invention are those that enhance the cellular immune response of type I or the antibody immune response of type II.
  • the invention is particularly directed to Alphabodies against growth factors involved in immunomodulation such as the 'classical' cytokines but also including immunomodulatory growth factors such as fms-related tyrosine kinase 3 ligand, inhibins and activins.
  • the Alphabodies or Alphabody polypeptides of the present invention can bind to a cytokine or growth factor that belongs to one or more of the following classes of cytokines/growth factors: immune/hematopoietin family, IL-1 family, IL- 10 family, IL-12-family, IL-17-family, interferon family (IFNs), TNF family (TNFs), platelet- derived growth factor family (PDGFs), transforming growth factor-beta family (TGF- ⁇ ) and/or chemokine family.
  • cytokines/growth factors immune/hematopoietin family
  • IL-1 family IL-1 family
  • IL- 10 family IL-12-family
  • IL-17-family interferon family
  • IFNs interferon family
  • TNFs TNF family
  • PDGFs platelet- derived growth factor family
  • TGF- ⁇ transforming growth factor-beta family
  • the invention relates to Alphabodies directed to cytokines and to growth factors characterized by a 4-helix bundle fold and/or to their receptors.
  • growth factors such as Fms-like tyrosine kinase 3 (Flt3) are characterized by the presence of a 4 helix bundle fold which is also found in the four alpha-helix bundle family of cytokines.
  • Alphabody polypeptides of the present invention bind to a cytokine or growth factor of the immune/hematopoietin family
  • they may bind to one or more cytokines or growth factor that belongs to one or more of the following subclasses of hematopoietins: gp130 (IL6ST) shared hematopoietins, IL13RA1 shared hematopoietins, IL12RB1 shared hematopoietins, IL3RB (CSF2RB) shared hematopoietins, ILRG shared hematopoietins.
  • gp130 IL6ST
  • IL13RA1 shared hematopoietins
  • IL12RB1 shared hematopoietins
  • IL3RB CSF2RB
  • Alphabody polypeptides of the present invention bind to a cytokine or growth factor of the immune/hematopoietin family
  • they may bind to one or more cytokines chosen from the group consisting of: cardiotrophin 1 , cardiotrophin-like cytokine factor 1 , cardiotrophin-like cytokine factor 1 , ciliary neurotrophic factor, interleukin 11 , interleukin 6 (interferon, beta 2), leukemia inhibitory factor (cholinergic differentiation factor), oncostatin M, interleukin 4, isoform 1 , interleukin 13, interleukin 12A, interleukin 23, alpha subunit p19, colony stimulating factor 2, interleukin 3, interleukin 5, interleukin 2, interleukin 4 isoform 1 , interleukin 7, interleukin 9, interleukin 15, preproprotein, interleukin 21 , colony stimulating factor 3 isoform a, erythropoie
  • Alphabodies or Alphabody polypeptides of the present invention bind to a cytokine of the IL-1 family, they may bind to one or more cytokines chosen from the group consisting of: interleukin 1 alpha proprotein and interleukin 1 beta proprotein.
  • Alphabodies or Alphabody polypeptides of the present invention bind to a cytokine of the IL-10 family, they may bind to one or more cytokines chosen from the group consisting of: interleukin 10, interleukin 19 isoform 2, interleukin 20, interleukin 22, interleukin 24 isoform 1 , interleukin 28A, interleukin 28B and interleukin 29.
  • cytokines chosen from the group consisting of: interleukin 10, interleukin 19 isoform 2, interleukin 20, interleukin 22, interleukin 24 isoform 1 , interleukin 28A, interleukin 28B and interleukin 29.
  • Alphabodies of the present invention bind to a cytokine of the IL-12 family, they may bind to one or more cytokines chosen from the group consisting of: interleukin 12 and interleukin 23.
  • Alphabodies or Alphabody polypeptides of the present invention bind to a cytokine of the IL-17 family, they may bind to one or more cytokines chosen from the group consisting of: interleukin 17, interleukin 17B and interleukin 17E isoform 1.
  • the Alphabody polypeptides of the present invention bind to a cytokine of the interferon family, they may bind to one or more cytokines chosen from the group consisting of: interferon alpha 1 , interferon beta 1 , interferon kappa, interferon epsilon 1 , interferon omega 1 and interferon gamma.
  • the Alphabodies or Alphabody polypeptides of the present invention bind to a cytokine of the tumor necrosis factor (TNF) family
  • they may bind to one or more cytokines chosen from the group consisting of: tumor necrosis factor ligand superfamily member 7, tumor necrosis factor ligand superfamily member 14 isoform 1 precursor, tumor necrosis factor ligand superfamily member 13 isoform alphaproprotein, tumor necrosis factor ligand superfamily, member 1 1 isoform 1 , tumor necrosis factor alpha, tumor necrosis factor (ligand) superfamily member 9, tumor necrosis factor (ligand) superfamily member 8, tumor necrosis factor (ligand) superfamily member 4, tumor necrosis factor (ligand) superfamily member 18, tumor necrosis factor (ligand) superfamily member 13b, tumor necrosis factor (ligand) superfamily member 12 isoform 1 precursor, tumor necrosis factor (ligand) superfamily member 10, lymphotoxin-beta isoform a,
  • Alphabody polypeptides of the present invention bind to a growth factor of the platelet-derived growth factor (PDGF) family
  • they may bind to one or more growth factors chosen from the group consisting of: colony stimulating factor 1 isoform a, epidermal growth factor (beta-urogastrone), fms-related tyrosine kinase 3 ligand, hepatocyte growth factor isoform 1 preproprotein, KIT ligand isoform b, PH domain-containing protein
  • platelet-derived growth factor beta isoform 1 preproprotein platelet-derived growth factor C, vascular endothelial growth factor B, vascular endothelial growth factor C preproprotein and vascular endothelial growth factor isoform a.
  • the Alphabody polypeptides of the present invention bind to Flt3L or its receptor Flt3R.
  • 'Flt3' is known in the art as 'Fms-like tyrosine kinase 3'.
  • Other names for Flt3 in the literature are 'Flk-2' ('fetal liver kinase 2') and 'STK-1 ' ('stem cell tyrosine kinase 1 ').
  • 'Flt3R' is known in the art as 'Flt3 receptor'.
  • the murine Flt3/Flk-2 receptor was identified in the early 1990s (Matthews et al., Cell, 1991 , 65:1 143-1152; Rosnet et al., Oncogene, 1991 , 6: 1641-1650). Subsequently, using DNA probes based on the murine Flt3/Flk-2 sequence, the human Flt3 cDNA was isolated and cloned (Rosnet et al., Blood, 1993, 82:1 110-1 119; Small et al., PNAS, 1994, 91 :459-463).
  • Flt3R is a member of the tyrosine kinase III family which also includes CSF1-R (colony stimulating factor 1 receptor), c-kit and PDGF-Ro/ ⁇ (platelet-derived growth factor receptors a and ⁇ ). These receptors are bitopic type I membrane proteins which are active as a dimer. They consist of an ectodomain that is built up of 5 immunoglobulin-like subdomains, a transmembrane domain, and a cytoplasmic part that contains an ATP-binding site and a kinase domain. Dimeric ligands are needed to dimerize and activate these receptors.
  • Flt3R is involved in the proliferation, differentiation and apoptosis of haematopoietic cells. It is mainly expressed by early myeloid and lymphoid progenitor cells. 'Flt3L' is known in the art as 'Flt3 ligand'. Murine Flt3L was identified as the cognate protein ligand for the murine Flt3 receptor by its ability to bind an Flt3-Fc fusion construct (Lyman et al., Cell, 1993, 75: 1157-1167; Hannum et al., Nature, 1994, 368:643-648).
  • Flt3L is the only known ligand to Flt3R.
  • Flt3L is expressed by all cell types, except in brain tissue.
  • Flt3L can stimulate the proliferation and differentiation of certain early hematopoietic progenitor cells.
  • the Flt3 system is also an important player in the development of dendritic cells.
  • Alphabody polypeptides of the present invention bind to a growth factor of the transforming growth factor-beta family (TGF- ⁇ ), they may bind to one or more growth factors chosen from the group consisting of: transforming growth factor beta 3, transforming growth factor beta 2, transforming growth factor beta 1 , inhibin beta C chain preproprotein, inhibin beta B subunit, inhibin beta A, growth differentiation factor 5 preproprotein, bone morphogenetic protein 7, bone morphogenetic protein 2, anti-Mullerian hormone and activin beta E.
  • TGF- ⁇ transforming growth factor-beta family
  • Alphabody polypeptides of the present invention bind to a cytokine of the chemokine family, they may bind to one or more cytokines that belongs to one or more of the following subclasses of chemokines: C subfamily, CC subfamily, CXC subfamily and CX3C subfamily.
  • Alphabody polypeptides of the present invention bind to a cytokine of the chemokine family, they may bind to one or more cytokines chosen from the group consisting of: chemokine (C motif) ligand 1 , chemokine (C motif) ligand 2, chemokine (C-C motif) ligand 14 isoform 1 , chemokine (C-C motif) ligand 15, chemokine (C-C motif) ligand 20, chemokine (C-C motif) ligand 26, chemokine (C-C motif) ligand 3, chemokine (C- C motif) ligand 4, chemokine (C-C motif) ligand 7, chemokine (C-C motif) ligand 1 , chemokine (C-C motif) ligand 1 1 , chemokine (C-C motif) ligand 13, chemokine (C-C motif) ligand 16, chemokine (C-C motif) lig
  • C motif
  • the Alphabody polypeptides of the present invention can bind to one or more cytokine or growth factor receptors that belong to one or more of the following classes of cytokine or growth factor receptors: type I cytokine receptors, type II cytokine receptors, immunoglobulin superfamily, Tumor necrosis factor receptor family, chemokine receptors and TGF beta receptors.
  • Alphabody polypeptides of the present invention bind to a cytokine or growth factor receptor of the type I cytokine receptor family, they may bind to one or more of the following cytokine receptors: type 1 interleukin receptor, erythropoietin receptor, GM-CSF receptor, G-CSF receptor, growth hormone receptor, prolactin receptor, oncostatin M receptor and leukemia inhibitory factor receptor.
  • cytokine receptors type 1 interleukin receptor, erythropoietin receptor, GM-CSF receptor, G-CSF receptor, growth hormone receptor, prolactin receptor, oncostatin M receptor and leukemia inhibitory factor receptor.
  • Alphabody polypeptides of the present invention bind to a cytokine receptor of the type II cytokine receptor family, they may bind to one or more of the following cytokine receptors: type II interleukin receptors, interferon- alpha/beta receptor and interferon-gamma receptor.
  • Alphabody polypeptides of the present invention bind to a cytokine receptor of the immunoglobulin superfamily, they may bind to one or more of the following cytokine receptors: interleukin-1 receptor, CSF1 , C-kit receptor and interleukin-18 receptor.
  • cytokine receptors interleukin-1 receptor, CSF1 , C-kit receptor and interleukin-18 receptor.
  • the Alphabody polypeptides of the present invention bind to a cytokine receptor of the tumor necrosis factor receptor family, they may bind to one or more of the following cytokine receptors: CD27, CD30, CD120, CD40 and lymphotoxin beta receptor.
  • Alphabody polypeptides of the present invention bind to a cytokine receptor of the chemokine receptor family, they may bind to one or more of the following cytokine receptors: interleukin-8 receptor, CCR1 , CCR5, CXCR4, CXCR7, MCAF receptor, NAP-2 receptor, CC chemokine receptors, CXC chemokine receptors, CX3C chemokine receptors, and XC chemokine receptor (XCR1).
  • interleukin-8 receptor CCR1 , CCR5, CXCR4, CXCR7, MCAF receptor, NAP-2 receptor, CC chemokine receptors, CXC chemokine receptors, CX3C chemokine receptors, and XC chemokine receptor (XCR1).
  • Alphabody polypeptides of the present invention bind to a growth factor receptor of the TGF beta receptor family, they may bind to one or more of the following cytokine receptors: TGF beta receptor 1 and TGF beta receptor 2.
  • cytokine receptors TGF beta receptor 1 and TGF beta receptor 2.
  • the Alphabody polypeptides of the present invention specifically bind to a heterodimeric cytokine or growth factor (as defined herein), and/or to a heterodimeric cytokine or growth factor receptor.
  • the term 'heterodimeric cytokine(s) or growth factor(s)' as used herein includes any cytokine or growth factor that comprises at least two, and in particular cases only two, subunits. More particularly, the terms 'heterodimeric cytokine' or 'heterodimeric growth factor' as used herein encompasses both heterodimeric cytokines or growth factors involved in cell-mediated (THI ) immunity and heterodimeric cytokines or growth factors involved in humoral (TH2) immunity.
  • TTI cell-mediated
  • TH2 humoral
  • Alphabody polypeptides are provided against heterodimeric cytokines or growth factors whereby the Alphabody is specific for the subunit of the cytokine or growth factor which is specific for the cytokine or growth factor.
  • the subunit of interest is the subunit which is common to two or more cytokines or growth factors.
  • Alphabodies are provided which are directed against a specific subunit.
  • the Alphabody polypeptides of the invention specifically bind to a subunit selected from a p19 subunit or a p19-like subunit, such as a p19 subunit present in IL-23, a p35 subunit present in IL-12 and IL-35, or a p28 subunit present in IL-27 or a homolog thereof. More particularly, the Alphabody polypeptides are capable of binding a cytokine comprising one or more of these subunits. According to an even more particular, but non-limiting embodiment, the Alphabody polypeptides of the invention specifically bind to a p19 subunit or a p19-like subunit of a heterodimeric cytokine.
  • Alphabody polypeptides of the invention that specifically bind to a p19 or a p19-like subunit, such as to the p19 subunit of IL-23, compared to a p35 subunit and a p40 subunit, may have advantages for prophylactic, therapeutic and/or diagnostic purposes compared to the Alphabodies of the invention that specifically bind to p35(-like) subunit or p40(-like) subunit.
  • Alphabody polypeptides of the invention specifically bind to the p19 subunit of IL-23 or a homolog thereof.
  • the Alphabody polypeptides of the invention specifically bind to a heterodimeric cytokine that comprises a p40 subunit or a p40- like subunit, such as a p40 subunit present in IL-12 and IL-23 or Epstein-Barr virus (EBV)- induced molecule 3 (EBI3) present in IL-27 and IL-35.
  • a heterodimeric cytokine that comprises a p40 subunit or a p40- like subunit, such as a p40 subunit present in IL-12 and IL-23 or Epstein-Barr virus (EBV)- induced molecule 3 (EBI3) present in IL-27 and IL-35.
  • EBV Epstein-Barr virus
  • the Alphabody polypeptides of the invention specifically bind to a p19 subunit or a p19-like subunit of a heterodimeric cytokine or to a p40 subunit or a p40-like subunit of a heterodimeric cytokine or to both a p19 subunit or a p19-like subunit and a p40 subunit or a p40-like subunit of the same heterodimeric cytokine.
  • the Alphabodies of the present invention exclusively bind to a p19 subunit or a p19-like subunit of a heterodimeric cytokine and not to a p40-like subunit of a heterodimeric cytokine.
  • the Alphabody polypeptides of the invention can specifically bind to a heterodimeric cytokine that comprises at least one p19 subunit or p19-like subunit and at least one p40 subunit or p40-like subunit.
  • the Alphabody polypeptides of the present invention specifically bind to a heterodimeric cytokine (as defined herein) chosen from the group consisting of IL-12, IL-23, IL-27 and IL-35.
  • the Alphabody polypeptides of the present invention bind to IL-23.
  • the Alphabody polypeptides of the present invention specifically bind either to the p19 subunit of IL-23 or to the p40 subunit of IL-23 or to both the p40 and the p19 subunit of IL-23.
  • the Alphabody polypeptides of the present invention specifically and exclusively bind to the p19 subunit of IL-23 but not to the p40 subunit of IL-23. More particularly, the Alphabody polypeptides specifically bind IL-23. Such IL-23-specific Alphabody polypeptides are of interest for preventing and/or treating diseases and/or disorders in which IL-23 is involved.
  • Alphabody polypeptides of the present invention comprise an amino acid sequence having at least 80% sequence identity with at least one of the amino acid sequences corresponding to any one of SEQJD 1 to SEQJD127.
  • the Alphabody polypeptides of the present invention specifically bind to IL-12 or a subunit thereof. More particularly, the Alphabody polypeptides of the invention bind to the p35 subunit of IL-12. Such Alphabody polypeptides of the invention that specifically bind to IL-12 can be of interest for preventing and/or treating diseases and/or disorders in which IL-12 is involved.
  • the Alphabody polypeptides of the present invention specifically bind to IL-27, more particularly to the p28 subunit of IL-27.
  • Such Alphabody polypeptides of the invention that specifically bind to IL-27 can be used for preventing and/or treating diseases and/or disorders in which IL-27 is involved.
  • the Alphabody polypeptides of the present invention specifically bind to IL-35. In particular embodiments, they bind to the p35 subunit of IL-35. Such Alphabody polypeptides of the invention that specifically bind to IL-35 are of use for preventing and/or treating diseases and/or disorders in which IL-35 is involved.
  • the Alphabody polypeptides of the present invention bind to one or more heterodimeric cytokine receptors, such as for example but not limited to the IL-12 receptor, the IL-23 receptor, the IL-27 receptor or the IL-35 receptor.
  • heterodimeric cytokine receptors such as for example but not limited to the IL-12 receptor, the IL-23 receptor, the IL-27 receptor or the IL-35 receptor.
  • the Alphabody polypeptides of the present invention bind to the IL-23R subunit of the IL-23 receptor.
  • the Alphabody polypeptides of the present invention bind to the IL12R ⁇ 1 and/or to the IL12R- ⁇ 2 subunit of the IL-12 receptor.
  • the Alphabody polypeptides of the present invention bind to the IL-27R and/or to the gp130 subunit of the IL-27 receptor.
  • the Alphabody polypeptides of the invention bind specifically to at least two different subunits of a heterodimeric cytokine. More particularly, such an Alphabody polypeptide of the invention specifically binds to the interface of two different subunits that occur in the same heterodimeric cytokine, such as to the p19/p40 interface in IL-23 or to the p35/p40 interface in IL-12 or to the p28/EBI3 interface in IL-27, or to the the p35/EBI3 interface in IL-35.
  • Alphabody polypeptides of the invention bind specifically to at least two different subunits of a heterodimeric cytokine receptor
  • Alphabody polypeptides of the invention may specifically bind to the interface of two different subunits that occur in the same heterodimeric cytokine receptor, such as to the IL-23R/ ⁇ _12 ⁇ - ⁇ 2 interface in IL-23 receptor or to the IL12R-pi/ ⁇ _12 ⁇ - ⁇ 2 interface in IL-12 receptor or to the IL-27R/gp130 interface in IL-27 receptor.
  • Alphabody polypeptides of the present invention that bind to one or more heterodimeric cytokines and/or to one or more heterodimeric cytokine receptors can, optionally, further bind to one or more other (non-heterodimeric) cytokines and/or one or more other (non-heterodimeric) cytokine receptors.
  • cytokine- or growth factor-binding Alphabody polypeptides are provided.
  • cytokines or growth factors to which the Alphabody polypeptides can be specifically directed include cytokines or growth factor chosen from the group consisting of but not limited to cardiotrophin 1 , cardiotrophin-like cytokine factor 1 , cardiotrophin-like cytokine factor 1 , ciliary neurotrophic factor, interleukin 1 1 , interleukin 6 (interferon, beta 2), leukemia inhibitory factor (cholinergic differentiation factor), oncostatin M, interleukin 4, isoform 1 , interleukin 13, interleukin 12A, interleukin 23, alpha subunit p19, colony stimulating factor 2, interleukin 3, interleukin 5, interleukin 2, interleukin 4 isoform 1 , interleukin 7, interleukin 9, interleukin 15, pre
  • the Alphabody polypeptides of the invention will bind to a target protein of interest with a dissociation constant (KD) of less than about 1 micromolar (1 ⁇ ), and preferably less than about 1 nanomolar (1 nM) [i.e., with an association constant (KA) of about 1 ,000,000 per molar (10 6 M "1 , 1 E6 /M) or more and preferably about 1 ,000,000,000 per molar (10 9 M "1 , 1 E9 /M) or more].
  • KD dissociation constant
  • KA association constant
  • a KD value greater than about 1 millimolar is generally considered to indicate non-binding or non-specific binding.
  • the KD can also be expressed as the ratio of the dissociation rate constant of a complex, denoted as kOff (expressed in seconds “1 or s "1 ), to the rate constant of its association, denoted kOn (expressed in molar "1 seconds “1 or M “1 s "1 ).
  • kOff the rate constant of its association
  • kOn the rate constant of its association
  • an Alphabody polypeptide of the invention will bind to the target protein of interest with a kOff ranging between 0.1 and 0.0001 s "1 and/or a kOn ranging between 1 ,000 and 1 ,000,000 M “1 s "1 .
  • Binding affinities, kOff and kOn rates may be determined by means of methods known to the person skilled in the art, for example ELISA methods, isothermal titration calorimetry, surface plasmon resonance, fluorescence-activated cell sorting analysis, and the more.
  • the target-binding Alphabody polypeptides according to the present invention are amino acid sequences comprising the general formula HRS1-L1-HRS2-L2-HRS3, optionally comprising additional N- and C-terminal linked groups, residues or moieties resulting in the formula N-HRS1-L1-HRS2-L2-HRS3-C.
  • the optional N and C extensions can be, for example, a tag for detection or purification (e.g., a His-tag) or another protein or protein domain, in which case the full construct is denoted a fusion protein.
  • the 'a-positions' and 'd-positions' in each heptad unit of an Alphabody of the invention are amino acid residue positions of the coiled coil structure where the solvent-shielded (i.e., buried) core residues are located.
  • the 'e-positions' and 'g-positions' in each heptad unit of an Alphabody of the invention are amino acid residue positions of the coiled coil structure where the amino acid residues which are partially solvent-exposed are located.
  • these 'e-positions' and 'g-positions' are located in the groove formed between two spatially adjacent alpha-helices, and the corresponding amino acid residues are commonly denoted the 'groove residues'.
  • the 'b-positions', 'c-positions' and 'f-positions' in each heptad unit of an Alphabody of the invention are the most solvent-exposed positions in a coiled coil structure. It is noted that in the prior art, a heptad may be referred to as 'heptad repeat' because the 7-residue fragment is usually repeated a number of times in a true coiled coil amino acid sequence.
  • a heptad motif (as defined herein) of the type 'abcdefg' is typically represented as ⁇ '
  • a 'heptad motif of the type 'defgabc' is typically represented as ⁇ '
  • the symbol 'H' denotes an apolar or hydrophobic amino acid residue
  • the symbol 'P' denotes a polar or hydrophilic amino acid residue.
  • Typical hydrophobic residues located at a- or d-positions include aliphatic (e.g., leucine, isoleucine, valine, methionine) or aromatic (e.g., phenylalanine) amino acid residues.
  • Heptads within coiled coil sequences do not always comply with the ideal pattern of hydrophobic and polar residues, as polar residues are occasionally located at 'H' positions and hydrophobic residues at 'P' positions.
  • the patterns 'HPPHPPP' and 'HPPPHPP' are to be considered as ideal patterns or characteristic reference motifs.
  • the characteristic heptad motif is represented as 'HPPHCPC or 'HxxHCxC wherein 'H' and 'P' have the same meaning as above, 'C denotes a charged residue (lysine, arginine, glutamic acid or aspartic acid) and 'x' denotes any (unspecified) natural amino acid residue.
  • heptad repeat sequence (as defined herein) is typically represented by
  • heptad repeat sequences can be resolved based on knowledge at a higher level than the primary structure (i.e., the amino acid sequence).
  • heptad repeat sequences can be identified and delineated on the basis of secondary structural information (i.e. alpha-helicity) or on the basis of tertiary structural (i.e., protein folding) information.
  • secondary structural information i.e. alpha-helicity
  • tertiary structural i.e., protein folding
  • HRS any sequence or fragment that is known to form a regular coiled coil structure, i.e., without stutters or stammers as described in Brown et al. Proteins 1996, 26: 134-145, is herein considered a HRS. Also and more particularly, the identification of HRS fragments can be based on high-resolution 3-D structural information (X-ray or NMR structures).
  • any HRS fragment may be defined as the first (respectively last) a- or d-position at which a standard hydrophobic amino acid residue (selected from the group valine, isoleucine, leucine, methionine, phenylalanine, tyrosine or tryptophan) is located.
  • the linkers within a single-chain structure of the Alphabodies interconnect the HRS sequences, and more particularly the first to the second HRS, and the second to the third HRS in an Alphabody.
  • Each linker sequence in an Alphabody commences with the residue following the last heptad residue of the preceding HRS and ends with the residue preceding the first heptad residue of the next HRS. Connections between HRS fragments via disulfide bridges or chemical cross-linking or, in general, through any means of inter-chain linkage (as opposed to intra-chain linkage), are explicitly excluded from the definition of a linker fragment (at least, in the context of an Alphabody) because such would be in contradiction with the definition of a single-chain Alphabody.
  • a linker fragment in an Alphabody is preferably flexible in conformation to ensure relaxed (unhindered) association of the three heptad repeat sequences as an alpha-helical coiled coil structure.
  • 'LT shall denote the linker fragment one, i.e., the linker between HRS1 and HRS2, whereas 'L2' shall denote the linker fragment two, i.e., the linker between HRS2 and HRS3.
  • Suitable linkers for use in the Alphabodies of the invention will be clear to the skilled person, and may generally be any linker used in the art to link amino acid sequences, as long as the linkers are structurally flexible, in the sense that they do not affect the characteristic three dimensional coiled coil structure of the Alphabody.
  • the two linkers L1 and L2 in a particular Alphabody of the invention may be the same or may be different.
  • the linkers L1 and L2 are amino acid sequences consisting of at least 4, in particular at least 8, more particularly at least 12 amino acid residues, with a non-critical upper limit chosen for reasons of convenience being about 30 amino acid residues.
  • a non-critical upper limit chosen for reasons of convenience being about 30 amino acid residues.
  • preferably at least 50% of the amino acid residues of a linker sequence are selected from the group proline, glycine, and serine.
  • At least 60%, such as at least 70%, such as for example 80% and more particularly 90% of the amino acid residues of a linker sequence are selected from the group proline, glycine, and serine.
  • the linker sequences essentially consist of polar amino acid residues; in such particular embodiments, preferably at least 50%, such as at least 60%, such as for example 70% or 80% and more particularly 90% or up to 100% of the amino acid residues of a linker sequence are selected from the group consisting of glycine, serine, threonine, alanine, proline, histidine, asparagine, aspartic acid, glutamine, glutamic acid, lysine and arginine.
  • each of L1 and L2 are independently a linker fragment, covalently connecting HRS1 to HRS2 and HRS2 to HRS3, respectively, and consisting of at least 4 amino acid residues, preferably at least 50% of which are selected from the group proline, glycine, serine.
  • the 'coiled coil' structure of an Alphabody can be considered as being an assembly of alpha-helical heptad repeat sequences wherein the helical heptad repeat sequences are as defined supra;
  • the coiled coil structure of the Alphabodies of the present invention is not to be confused with ordinary three-helix bundles. Criteria to distinguish between a true coiled coil and non-coiled coil helical bundles are provided in Desmet et al. WO 2010/066740 A1 and Schneider et al Fold Des 1998, 3:R29-R40; such criteria essentially relate to the presence or absence of structural symmetry in the packing of core residues for coiled coils and helix bundles, respectively. Also the presence or absence of left-handed supercoiling for coiled coils and helix bundles, respectively, provides a useful criterion to distinguish between both types of folding.
  • the Alphabodies of the present invention are restricted to 3-stranded coiled coils.
  • the coiled coil region in an Alphabody can be organized with all alpha-helices in parallel orientation (corresponding to a 'parallel Alphabody' as described in EP2161278 by Applicant Complix NV) or with one of the three alpha-helices being antiparallel to the two other (corresponding to an 'antiparallel Alphabody' as described in WO 2010/066740 by Applicant Complix NV).
  • alpha-helical part of an Alphabody (as defined herein) will usually grossly coincide with the heptad repeat sequences although differences can exist near the boundaries.
  • a sequence fragment with a clear heptad motif can be non-helical due to the presence of one or more helix-distorting residues (e.g., glycine or proline).
  • part of a linker fragment can be alpha-helical despite the fact that it is located outside a heptad repeat region.
  • any part of one or more alpha-helical heptad repeat sequences is also considered an alpha-helical part of a single-chain Alphabody.
  • the solvent-oriented region of (the alpha-helices of) an Alphabody is an important Alphabody region.
  • the solvent-oriented region is largely formed by b-, c- and f-residues.
  • a subregion composed of the b-, c- and f-residues from three consecutive heptads in an Alphabody alpha-helix will also form a solvent-oriented surface region.
  • Residues implicated in the formation of (the surface of) a groove between two adjacent alpha-helices in an Alphabody are generally located at heptad e- and g-positions, but some of the more exposed b- and c-positions as well as some of the largely buried core a- and d-positions may also contribute to a groove surface; such will essentially depend on the size of the amino acid side-chains placed at these positions. If the said spatially adjacent alpha-helices run parallel, then one half of the groove is formed by b- and e-residues from a first helix and the second half by c- and g-residues of the second helix.
  • both halves of the groove are formed by b- and e-residues.
  • both halves of the groove are formed by c- and g-residues.
  • the three types of possible grooves are herein denoted by their primary groove-forming (e- and g-) residues: if the helices are parallel, then the groove is referred to as an e/g-groove; if the helices are antiparallel, then the groove is referred to as either an e/e-groove or a g/g-groove.
  • Parallel Alphabodies have three e/g-grooves, whereas antiparallel Alphabodies have one e/g-groove, one e/e-groove and one g/g-groove. Any part of an Alphabody groove is also considered a groove region.
  • the inventors have identified methods for obtaining the target-specific, and more particularly cytokine or growth factor or cytokine- or growth factor-receptor-specific Alphabodies and Alphabody polypeptides comprising such Alphabodies. These methods are based on the concept of random library screening.
  • the target-specific Alphabodies or Alphabody polypeptides according to the present invention can be obtained by methods which involve generating a random library of Alphabody polypeptides and screening this library for an Alphabody polypeptide capable of specifically binding to a target of interest, and in particular to a cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • a first step in the methods according to the invention comprises the production of a library (i.e., collection or set) of Alphabody polypeptide sequences, which differ from each other in at least one of a defined set of 5 to 20 variegated amino acid residue positions. Therefore, the sequences within a library of Alphabody polypeptides differ from each other at particular amino acid positions that are comprised in a selected or defined set. Accordingly, the term 'different-sequence' refers to the occurrence of sequence variation or sequence differences in a defined set of amino acid residue positions between two or more Alphabody polypeptides of the libraries of the invention.
  • a library or collection of Alphabody polypeptide sequences may contain any suitable number of different Alphabody (polypeptide) sequences, such as at least 2, at least 5, at least 10, at least 50, at least 100, at least 1000, at least 10,000, at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 or more different-sequence (single-chain) Alphabodies or Alphabody polypeptides.
  • a library or collection of different Alphabody (polypeptide) sequences contains at least 100 different-sequence Alphabody polypeptides, such as at least 200, at least 300, at least 400, at least 500, such as at least 1000, at least 10000, at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 or more sequences.
  • a set, collection or library (as used interchangeably herein) of Alphabody polypeptide sequences of the present invention contains at least 100 different-sequence Alphabody polypeptides.
  • the single-chain Alphabody libraries of the invention are characterized in that the different-sequence single-chain Alphabody polypeptides comprised in those libraries differ from each other in at least one of a defined set of variegated amino acid residue positions.
  • the different Alphabody sequences also referred to herein as different- sequence (single-chain) Alphabodies, comprised in the libraries of the invention only differ from each other in a defined, i.e. fixed or predetermined, set of amino acid residue positions.
  • Such a defined set of variegated amino acid residue positions consists of a number of particular amino acid residue positions, which are characterized by variety or diversity of amino acid residue types when the different-sequence (single-chain) Alphabodies within the produced library are compared to each other.
  • the notion 'variegated amino acid residue position' when referring to a library of different-sequence Alphabodies, refers to an amino acid residue position at which at least two different amino acid residue types (amino acid residues of a defined type, for example natural amino acid residue types) are located when at least two of the amino acid sequences of the different-sequence Alphabodies from the said library of Alphabodies are compared to each other (note that these positions will not differ for any two different- sequence Alphabodies of the library, but that the library comprises at least two different- sequence Alphabodies which differ in this amino acid residue position).
  • amino acid residue types amino acid residues of a defined type, for example natural amino acid residue types
  • a 'set of variegated amino acid residue positions' when referring to a library of different-sequence Alphabodies, refers to the set of amino acid residue positions at which at least two different amino acid residue types are located when at least two of the amino acid sequences of the different- sequence Alphabodies from the said library of Alphabodies are compared to each other (note that these positions will not differ for any two different-sequence Alphabodies of the library).
  • a 'defined set of variegated amino acid residue positions' when referring to a library of different-sequence Alphabodies, refers to the specific set of amino acid residue positions at which at least two different amino acid residue types are located when all amino acid sequences from the said library of different-sequence Alphabodies are simultaneously compared to each other.
  • the simultaneous comparison of all amino acid sequences from the said library of different-sequence Alphabodies, and the identification of amino acid residue positions at which at least two different amino acid residue types are located in such simultaneous comparison allows to identify the said defined set of variegated amino acid residue positions in an Alphabody library.
  • Alphabody sequences can be compared both at the level of amino acid sequences or nucleotide sequences representing (encoding) these amino acid sequences.
  • a preferred method to compare two or more different-sequence Alphabodies is based on a pair-wise or multiple sequence alignment, generated by a known computer algorithm for automated sequence alignment such as NCBI Blast.
  • two or more different-sequence Alphabodies can be compared on the basis of a pair-wise or multiple sequence alignment which is generated by a skilled user, such method of alignment also being known as manual sequence alignment.
  • Both of the techniques of automated and manual sequence alignment applied to different-sequence Alphabodies can be based on the maximization of global sequence identity or global sequence similarity (or homology or correspondence), or on the maximization of sequence identity or similarity of the core amino acid positions (i.e., the heptad a- and d- positions as defined herein) of the different- sequence Alphabodies.
  • a defined set of variegated amino acid residue positions can be deduced from an amino acid or nucleotide sequence comparison of all, or at least a representative subset of all different-sequence Alphabodies in an Alphabody library. It is also acknowledged that, upon generating an Alphabody library, so-called unintended mutations, insertions or deletions may occur. Such unintended mutations, insertions or deletions are nucleotide or amino acid mutations, insertions or deletions that occur at positions which were not intended to be variegated at the time of designing or generating the said Alphabody library.
  • unintended mutations, insertions or deletions will occur only sporadically and in a scattered fashion (i.e., at different positions) within the Alphabody library sequences.
  • such unintended mutations, insertions or deletions will occur at any given position with a frequency of less than 10%, more preferably less than 5%, more preferably less than 2%, 1 %, or even less than 1 %.
  • unintended mutations, insertions or deletions within an Alphabody library can be identified on the basis of their low frequency as compared to the variability observed at positions showing intended sequence variation.
  • a preferred method to determine a defined set of variegated amino acid residue positions within an Alphabody library of the invention is by determining the nucleotide or amino acid sequences of at least a representative subset of sequences contained within this library, followed by comparing all determined sequences in a (preferably multiple) alignment, followed by identifying the positions at which sequence variation is observed, followed by identifying the frequencies of the nucleotides or amino acid residue types observed at each variable position, followed by identifying the positions having a mutation, insertion or deletion frequency higher than a given cutoff percentage, wherein this cutoff percentage is set at 10%, 5%, 2%, 1 % or even less than 1 % such as 0.5%, 0.1 % or 0% (in which case all observed variations are included in the defined set of variegated amino acid residue positions.
  • the set of variegated amino acid residue positions in this library is preferably based on said knowledge instead of on the analysis of the library itself.
  • the number of variegated amino acid residue positions in such a defined set can range from 5 to 20 amino acid residue positions.
  • a defined set of variegated amino acid residue positions in a library of the invention may comprise 5 to 20, such as 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20, defined variegated amino acid residue positions.
  • the different-sequence Alphabody polypeptides comprised in a library of the invention can differ from each other in at least one amino acid residue position of such a defined set of 5 to 20 positions.
  • the defined set of variegated amino acid residue positions in a library comprises a set of 13 variegated amino acid residue positions
  • the different-sequence Alphabody polypeptides in the libraries of the invention can differ from each other in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or all 13 of these amino acid residue positions.
  • the different-sequence Alphabody polypeptide sequences comprised in a library of the invention can be distinguished from each other by the sequence difference(s) present in the defined set of 5 to 20 variegated amino acid residue positions, with the proviso that additional, preferably sporadic, unintended mutations, insertions or deletions may occur at positions other than those of the defined set of variegated positions.
  • the heptad repeat (HR) sequences 1 , 2 and 3 each form an alpha-helix.
  • These three helices (present in an Alphabody) that are formed respectively by the heptad repeat (HR) sequences 1 , 2 and 3 are typically referred to as helices A, B and C, respectively.
  • the heptad repeat sequences comprise at least two heptad sequences, each of which is generally represented by 'abcdefg' or 'defgabc' (as further described herein).
  • Alphabody libraries can be generated, depending on the location of the set of variegated amino acids within the Alphabody structure.
  • the location of the set of variegated amino acids determines the type and the location of the binding site that is generated on the Alphabodies within the library.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are located predominantly in the groove between two of the three helices of the Alphabody.
  • the binding site for binding to a protein is formed predominantly by amino acid residue positions located in the groove between two of the three helices of the Alphabody.
  • Residues implicated in the formation of (the surface of) a groove between two adjacent alpha-helices in an Alphabody are generally located at the heptad e- and g- positions, but some of the more exposed b- and c-positions as well as some of the largely buried core a- and d-positions may also contribute to a groove surface; such will essentially depend on the size of the amino acid side-chains placed at these positions.
  • the positions within the Alphabody sequence which need to be variegated in order to obtain a library which generates target binding Alphabodies wherein the binding site is located in the groove will vary.
  • the binding site located in the groove can be formed by at least e-residues from a first helix and g-residues from a parallel second helix.
  • the binding site may optionally further be formed by residues at b-positions in the first helix and/or residues at c-positions in the parallel second helix.
  • the variegated amino acid residue positions of the Alphabody libraries used in the generation of target-specific Alphabodies are located at heptad e-positions in a first alpha-helix of the Alphabody polypeptides and at heptad g-positions in a second alpha-helix, parallel to the first alpha- helix, and optionally also at heptad b-positions in the first alpha-helix and/or at heptad c- positions in the parallel second alpha-helix of the Alphabody.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are predominantly (i.e. for at least 70%) located at heptad e-positions in a first alpha-helix of the Alphabody polypeptides and at heptad g-positions in a second alpha-helix, parallel to the first alpha-helix, and optionally at heptad b-positions in the first alpha-helix of the Alphabody polypeptides and/or at heptad c-positions in the parallel second alpha-helix of the Alphabody polypeptides.
  • Alphabody scaffolds comprising two spatially adjacent alpha-helices that are positioned anti-parallel (if a binding site located in the groove between these helices is envisaged). This is typically the case for helices A and B or B and C in anti-parallel Alphabodies.
  • the groove between two anti-parallel helices is formed by at least e-residues from a first helix and e-residues from an anti-parallel second helix.
  • a binding site formed within the groove at least some of these amino acid residue positions are variegated.
  • such a binding site may optionally further be formed by residues at b-positions in the first helix and/or residues at b-positions in the anti-parallel second helix.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are located at heptad e-positions in a first alpha- helix of the Alphabody and at heptad e-positions in a second alpha-helix, anti-parallel to the first alpha-helix, and optionally at heptad b-positions in the first alpha-helix of the Alphabody and/or at heptad b-positions in the second alpha-helix of the Alphabody polypeptides.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are predominantly (i.e. for at least 70%) located at heptad e-positions in a first alpha-helix of the Alphabody and at heptad e-positions in a second alpha-helix, anti-parallel to the first alpha-helix, and optionally at heptad b-positions in the first alpha-helix of the Alphabody and/or at heptad b-positions in the second alpha-helix of the Alphabody.
  • another groove is formed by at least g-residues from a first helix and g-residues from an anti-parallel second helix.
  • a binding site may optionally further be formed by residues at c-positions in the first helix and/or residues at c-positions in the anti-parallel second helix.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are located at heptad g-positions in a first alpha- helix of the Alphabody and at heptad g-positions in a second alpha-helix, anti-parallel to the first alpha-helix, and optionally at heptad c-positions in the first alpha-helix of the Alphabody and/or at heptad c-positions in the second alpha-helix of the Alphabody.
  • Alphabody libraries are used wherein the variegated amino acid residue positions are predominantly (i.e. for at least 70%) located at heptad g-positions in a first alpha-helix of the Alphabody and at heptad g-positions in a second alpha-helix, anti-parallel to the first alpha-helix, and optionally at heptad c-positions in the first alpha-helix of the Alphabody and/or at heptad c-positions in the second alpha-helix of the Alphabody.
  • the three types of possible groove binding sites formed by variegated amino acid residue positions in the libraries used in the methods of the invention are herein denoted by their primary groove-forming (i.e. e- and g-) residue positions.
  • the groove is referred to as an e/g-groove; if those two helices are oriented anti-parallel with respect to each other, then the groove is referred to as either an e/e-groove or a g/g-groove.
  • Parallel Alphabodies which have three alpha-helices each oriented parallel to one another, contain three e/g-grooves.
  • Anti-parallel Alphabodies which comprise two alpha-helices that are parallel to each other and one alpha- helix that runs anti-parallel, contain one e/g-groove, one e/e-groove and one g/g-groove. Any part of an Alphabody groove is also considered a groove region.
  • 'pure' groove libraries are Alphabody libraries characterized in that the variegated amino acid residue positions in such libraries are all located at heptad e- or g- positions in a first alpha-helix of the Alphabody and at heptad e- or g-positions in a second alpha-helix, and optionally at heptad b- or c-positions in the first alpha-helix of the Alphabody and/or at heptad b- or c-positions in the second alpha-helix of the Alphabody.
  • Alphabody libraries which are characterized in that the variegated amino acid residue positions in such libraries are not exclusively but only predominantly located at heptad e- or g-positions in a first alpha-helix of the Alphabody and at heptad e- or g-positions in a second alpha-helix, and optionally at heptad b- or c-positions in the first alpha-helix of the Alphabody and/or at heptad b- or c- positions in the second alpha-helix of the Alphabody, generate more and better target- specific Alphabody polypeptides.
  • the methods of the present invention specifically envisage the use of Alphabody libraries wherein the variegated amino acid residue positions in such libraries, are predominantly (i.e. for at least 70%), but not exclusively, located at heptad e- or g-positions in a first alpha-helix of the Alphabody and at heptad e- or g-positions in a second alpha-helix, and optionally at heptad b- or c-positions in the first alpha-helix of the Alphabody and/or at heptad b- or c-positions in the second alpha- helix of the Alphabody.
  • the variegated amino acid residue positions in the Alphabody libraries used are located for at least 70% at the indicated groove-forming positions.
  • at least one of the variegated amino acid residue positions in the libraries is located outside the positions corresponding to the heptad e- or g-positions in a first alpha-helix of the Alphabody and heptad e- or g- positions in a second alpha-helix, and heptad b- or c-positions in the first alpha-helix of the Alphabody and heptad b- or c-positions in the second alpha-helix of the Alphabody.
  • helix positions it is intended to refer to the corresponding helix of the Alphabody, optionally present in an Alphabody polypeptide.
  • the methods of the present invention comprise the use of Alphabody libraries in which the binding site is formed predominantly by the surface of one of the three helices of the Alphabody. Accordingly, in these embodiments, Alphabody libraries are used in which the variegated amino acid residue positions are located predominantly on the surface of one or more of the three helices of the Alphabody. Such Alphabody libraries are referred to herein as 'surface libraries'.
  • the amino acid residue positions considered to be at the surface of the Alphabody can be located in either helix A, B or C.
  • the most protruding and thus solvent-oriented residues are located at b-, c- and f-positions in each of the alpha-helices of an Alphabody.
  • the Alphabody libraries of the invention comprise variegated amino acid residue positions that are located at heptad b-, c- and f-positions in one alpha-helix of the Alphabody.
  • 'pure' surface libraries are Alphabody libraries characterized in that the variegated amino acid residue positions in such libraries are all located at heptad b-, c- and f-positions in one alpha-helix of the Alphabody.
  • Alphabody libraries which are characterized in that the variegated amino acid residue positions are not exclusively but only predominantly located at heptad b-, c- and f-positions of an alpha-helix of the Alphabody, generate more and better target-specific Alphabodies. Accordingly, the methods of the present invention specifically envisage the use of Alphabody libraries wherein the variegated amino acid residue positions in such libraries are predominantly (i.e. for at least 70%), but not exclusively located at heptad b-, c- and f-positions of an alpha-helix of the Alphabody. In particular embodiments, the variegated amino acid residue positions in the Alphabody libraries used, are located for at least 70% at the indicated solvent-exposed positions.
  • At least one of the variegated amino acid residue positions in the libraries is located outside the positions corresponding to heptad b-, c- and f-positions of an alpha-helix of the Alphabody.
  • the methods of the present invention comprise the use of Alphabody libraries in which the binding site is formed predominantly by amino acid residue positions located in one or more of the loop or linker sequences interconnecting the alpha-helices of the Alphabody.
  • the amino acid residue positions located in a loop correspond to the amino acid positions present in one or more of the flexible linkers between the heptad repeat sequences.
  • the two loops of Alphabodies in the anti-parallel orientation i.e. loop AB and loop BC
  • loop AB and loop BC are positioned or located at opposite sides of the Alphabody coiled coil. Either of these loops can be used for introducing sequence variation at certain variegated positions.
  • libraries are used wherein all of the amino acid residue positions of a loop are variegated.
  • a selection of the residue positions located in the centre or middle of this loop are variegated.
  • alternating residue positions over the complete length of this loop sequence are variegated.
  • 'Pure' linker or loop libraries are Alphabody libraries characterized in that the variegated amino acid residue positions in such libraries are all located within a linker of the Alphabody.
  • Alphabody libraries which are characterized in that the variegated amino acid residue positions are not exclusively but only predominantly located at linker positions in the Alphabody, generate more and better target-specific Alphabodies. Accordingly, the methods of the present invention specifically envisage the use of Alphabody libraries wherein the variegated amino acid residue positions in such libraries are predominantly (i.e. for at least 70%), but not exclusively located in one of the linkers of the Alphabody.
  • the variegated amino acid residue positions in the Alphabody libraries used are located for at least 70% at the indicated linker positions.
  • at least one of the variegated amino acid residue positions in the libraries is located outside the amino acid residue positions in a linker or loop of an alpha-helix of the Alphabody.
  • Alphabody libraries are used which are characterized in that the set of variegated amino acids contains at least one, more particularly two or more amino acid residue positions which are located outside respectively, the groove, surface or loop of an Alphabody such that the binding site is predominantly but not exclusively formed respectively by that groove, surface or loop.
  • the percentage of variegated amino acid positions within the groove, surface or loop (i.e. linker) of an Alphabody having a binding site that is predominantly formed by that groove, surface or loop, respectively is less than 100%.
  • the percentage of variegated amino acid positions that is located within the groove, surface or loop (i.e. linker) is typically at least 70%.
  • the libraries used are not pure groove, surface or loop libraries. More particularly at least 70% but not all of the variegated amino acid positions, such as for example less than 95%, such as less than 90%, or less than 85% of the variegated amino acid positions are located in either a groove, surface or loop of the Alphabody.
  • Alphabody libraries are used in which for example at least 5% (i.e. at least 1 position of the 5 to 20), or particularly at least 10% (i.e. at least 1 or at least 2 positions), or particularly at least 15% (i.e. at least 1 to at least 3 positions), or particularly at least 20% (i.e. at least 1 to at least 4 positions), or particularly at least 25% (i.e. at least 1 to at least 5 positions), or particularly 30% (i.e. between 2 and 6 positions) of these 5 to 20 positions are located at positions other than:
  • the different-sequence (single-chain) Alphabodies in a library differ in a defined set of 5 to 20 amino acid residue positions, wherein, for each library at least 70% (i.e. at least 4 to at least 14 positions) of these 5 to 20 positions, such as at least 75% (i.e. at least 4 to at least 15 positions), at least 80% (i.e. at least 4 to at least 16 positions), at least 85% (i.e. at least 4 to at least 17 positions), such as at least 90% (i.e. at least 5 to at least 18 positions), for example at least 95% (i.e. at least 5 to at least 19 positions), or more, such as 100% (i.e. all 5 to 20 positions) are located
  • the remaining variegated positions that are located elsewhere than at the indicated heptad e-, g-, b- or c-positions may for example be located at heptad a-positions, at heptad d-positions, at heptad f- positions or at amino acid residue positions in the linkers or loops of the Alphabody that interconnect the alpha-helices.
  • the a-positions and d-positions (also referred to as core residues) in each heptad unit of an Alphabody of the invention are amino acid residue positions of the coiled coil structure which form essentially the solvent-shielded (i.e. buried) part of the Alphabody. It is envisaged that in most 'groove' Alphabody libraries used in the context of the present invention, all or some of these core residues are kept conserved in order to maintain the stability of the Alphabody. In these embodiments, the remaining variegated residues can be located for instance at linker residue positions or heptad f- positions.
  • the remaining variegated positions that are not located at heptad b-, c-, or f-positions may for example be located at heptad e-, g-, a- or d-positions or at amino acid residue positions in the linkers or loops of the Alphabody that interconnect the alpha-helices.
  • the remaining variegated positions may be located for instance at heptad e- or g-positions or at linker residue positions.
  • the remaining variegated positions that are not located in the linker or loop may for example be located at heptad e-, g-, f-, b-, c-, a- or d-positions or at amino acid residue positions in the other of the two linkers or loops of the Alphabody.
  • the a-positions and d-positions in each heptad unit of an Alphabody will in some embodiments not be varied to ensure stability.
  • the remainder of the variegated amino acid residue positions may be located at heptad e-, g-, f-, b-, or c-positions or at amino acid residue positions in the other of the two linkers or loops of the Alphabody.
  • variegated amino acid residue positions located in the groove formed by or between two adjacent alpha-helices of an Alphabody it is meant that these variegated amino acid residue positions are located in one and the same groove, i.e. formed by the two same adjacent alpha-helices of the Alphabodies comprised in a library.
  • variegated amino acid residue positions located in one alpha-helix of the Alphabody it is meant that these variegated amino acid residue positions are located in one and the same alpha-helix of the Alphabodies comprised in a library.
  • variegated amino acid residue positions located at positions in one or more linker or loop fragments interconnecting two consecutive alpha-helices it is meant that these variegated amino acid residue positions are located in the same one or more linker or loop fragments interconnecting the same two consecutive alpha-helices in the Alphabodies comprised in a library.
  • groove, surface or loop libraries are combined for use in the methods of the present invention. More particularly, it can be envisaged that a surface library comprising variegated amino acids primarily located on the surface of helix C is combined with a surface library comprising variegated amino acids primarily located on the surface of helix A.
  • a mixture of Alphabody libraries can be used comprising 2 to 6 different constituting libraries.
  • the libraries used in the context of the present invention contain sequence variations between Alphabody polypeptides, wherein this sequence variation exclusively resides in 5 to 20 defined amino acid residue positions, of which at least 70% of these positions are located either in a groove formed between two adjacent alpha-helices, or in one alpha-helix or at positions in a loop (fragment) or linker (fragment) connecting two consecutive alpha-helices of the Alphabody.
  • this sequence variation exclusively resides in 5 to 20 defined amino acid residue positions, of which at least 70% of these positions are located either in a groove formed between two adjacent alpha-helices, or in one alpha-helix or at positions in a loop (fragment) or linker (fragment) connecting two consecutive alpha-helices of the Alphabody.
  • two conceptually different types of randomization namely in the coiled-coil region and in the unstructured linkers between helices, can be designed.
  • the constant, non-variegated part of the single-chain Alphabodies that are present in the single-chain Alphabody libraries do not correspond to a naturally occurring protein sequence, and thus the sequence representing the non-variegated part or scaffold is of non-natural origin.
  • the constant, non-variegated part of the Alphabodies in a library of the invention is an artificial sequence.
  • Alphabody libraries comprising the variegations as described above, for use in the methods of the present invention, are typically generated by recombinant DNA techniques. More particularly, libraries of nucleic acid sequences encoding Alphabodies each differing in particular amino acid positions can be obtained by site-directed or random mutagenesis of a template sequence. As will be acknowledged by a skilled person, random amino acid residues can be introduced at specific positions in an amino acid sequence by, for example, selecting (introducing) 'NNK' or 'NNS' codons at corresponding positions in the nucleotide sequence encoding said amino acid sequence.
  • a (partially) randomized single-chain Alphabody library requires the (partial) randomization of specific positions within a template or standard or reference Alphabody scaffold sequence.
  • Such methods for producing libraries are known to the skilled person and commercial services are available for generating such libraries.
  • the nucleotide(s) determining the relevant amino acid residues in the positions of interest are mutated in different ways such as to obtain a library of sequences encoding different Alphabodies.
  • a template Alphabody scaffold sequence is the sequence of a reference Alphabody which has been selected on the basis of its (near-) optimal physico-chemical properties.
  • single-chain Alphabodies generally have a high thermal (i.e., thermodynamic) stability, a high solubility, a high resistance to variations in pH, and, importantly, a high tolerability to amino acid sequence variation.
  • the variegation envisaged in the libraries used in the methods of the invention is envisaged to encompass both naturally occurring and synthetic amino acid residues.
  • the variegated amino acid residue positions i.e. wherein the different-sequence Alphabody polypeptides comprised in the libraries of the invention differ from each other, are exclusively occupied by naturally occurring amino acid types such as glycine, alanine, proline, asparagine, aspartic acid, glutamine, glutamic acid, histidine, arginine, lysine, threonine, serine, cysteine, leucine, isoleucine, methionine, phenylalanine, tyrosine, tryptophan and valine.
  • naturally occurring amino acid types such as glycine, alanine, proline, asparagine, aspartic acid, glutamine, glutamic acid, histidine, arginine, lysine, threonine, serine, cysteine, leucine, is
  • the methods of the invention further comprise the step of selecting from the single-chain Alphabody library at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, the cytokine or growth factor and/or the cytokine or growth factor receptor of interest.
  • Screening methods for the binding of an Alphabody to a target protein are known in the art and will be detailed below. It is noted that the screening of an Alphabody library may be performed in different ways, and that the screening method will be adjusted to the form in which the Alphabody library is provided.
  • Alphabody libraries used in the methods of the present invention can be provided in different forms, and can be but are not limited to protein libraries, nucleic acid libraries, vector libraries or host cell libraries.
  • the libraries used in the context of the present invention are libraries of host cells, wherein each host cell comprises at least one member of a nucleic acid or vector library encoding a single-chain Alphabody library of the invention, or a mixture of single-chain Alphabody libraries of the invention. More particularly, the libraries are libraries of host cells wherein Alphabodies are expressed.
  • the Alphabodies of the library are displayed on the surface of a phage particle, a ribosome, a bacterium, a yeast cell, a mammalian cell or any other suitable (micro)organism, so as to facilitate screening or selection to isolate the desired Alphabody sequences having detectable binding affinity for, or detectable in vitro activity on, the protein of interest.
  • suitable methods, techniques and host organisms for displaying and selecting or screening (a set, collection or library of) variegated polypeptide sequences or nucleotide sequences encoding such variegated polypeptide sequences, and which are applicable to Alphabodies are known to the person skilled in the art.
  • the technology of phage library display, and the selection by means of a phage display technique may be chosen as a method for high-throughput identification of protein-specific binders, because it is one of the most robust and versatile selection techniques available (Scott and Smith, Science, 249:386-390, 1990; Bratkovic, Cell Mol Life Sci 67:749-767, 2010).
  • a major advantage of this technology is the coupling of genotype (i.e., the encapsulated DNA encoding the displayed protein) and phenotype (i.e., the displayed protein such as an Alphabody of the present invention) which allows affinity-based selection from large libraries with millions to trillions of polypeptide variants in a relatively simple in vitro assay.
  • the methods of the present invention may further comprise the step of isolating the single-chain Alphabody library. This can be ensured by expressing the nucleic acid or vector library under suitable conditions and isolating the produced Alphabodies from the host cells and/or from the medium.
  • the present invention provides methods for the production of at least one single-chain Alphabody polypeptide having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest, at least comprising the step of producing a single-chain Alphabody library comprising at least 100 different-sequence single-chain Alphabody polypeptides, wherein said Alphabody polypeptides differ from each other in at least one of a defined set of 5 to 20 variegated amino acid residue positions, and wherein at least 70% of said variegated amino acid residue positions are located either:
  • the production of a single-chain Alphabody library may involve the step of producing a nucleic acid or vector library of at least 100 different-sequence members, wherein each member encodes a polypeptide comprising a single-chain Alphabody and wherein the encoded different-sequence Alphabody polypeptides differ from each other in at least one of a defined set of 5 to 20 variegated amino acid residue positions.
  • at least 70% but not all of these variegated amino acid residue positions are located either:
  • an Alphabody polypeptide library is obtained.
  • the production of a random library can be achieved in different ways, as will be known by the person skilled in the art.
  • a given Alphabody library may be represented by a collection of phagemids each of which encodes for a fusion protein comprising a member of the Alphabody library fused to the minor coat protein pill.
  • These phagemids can be introduced into suitable E. coli cells (e.g. TG1) by electroporation or other means.
  • E. coli cells e.g. TG1
  • helper phage phage are produced (packaging also the phagemid genome) that display the Alphabody-fusion protein.
  • These phage can be used to select binders against a given target and the selected phage can be propagated by infecting E. coli TG1 (Stratagene),
  • the methods for the production of at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest typically comprise the step of expressing said nucleic acid or vector library under conditions suitable for the production of said single-chain Alphabody library.
  • the step of expressing the nucleic acid or vector library comprises introducing the nucleic acid or vector library into host cells such that preferably each host cell contains at most one element or molecule of said nucleic acid or vector library and culturing the host cells in a medium under conditions suitable for the production of the single-chain Alphabody library.
  • the methods of the present invention for the production of at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest at least comprise the further step of selecting from said single-chain Alphabody library at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, said cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • the selection step of the methods described herein can be performed by way of a method commonly known as a selection method or a by way of a method commonly known as a screening method. Both methods envisage the identification and subsequent isolation (i.e., the selection step) of desirable components (i.e., Alphabody library members) from an original ensemble comprising both desirable and non-desirable components (i.e., an Alphabody library).
  • desirable components i.e., Alphabody library members
  • library members will typically be isolated by a step wherein the desired property is applied to obtain the desired goal; in such case, the desired property is usually restricted to the property of a high affinity for a given cytokine or growth factor and/or cytokine or growth factor receptor of interest and the desired goal is usually restricted to the isolation of such high-affinity library members from the others.
  • affinity selection method is generally known as an affinity selection method and, in the context of the present invention, such affinity selection method will be applied to a single-chain Alphabody library for the purpose of selecting Alphabodies having a high affinity for a cytokine or growth factor and/or cytokine or growth factor receptor of interest or a subdomain or subregion thereof.
  • appropriate selection conditions e.g. short incubation times or long wash cycles, or other conditions as is known by someone skilled in the art of library selection techniques.
  • desired properties may relate to either a high affinity for a cytokine or growth factor and/or cytokine or growth factor receptor of interest or a subdomain or subregion thereof, or a functional activity such as an anti-cytokine or anti-growth factor activity, including the inhibition, reduction and/or prevention of the activity of a cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • the selection step of the methods of the invention may be accomplished by either an (affinity) selection technique or by an affinity-based or activity-based functional screening technique, both techniques resulting in the selection of one or more single-chain Alphabodies having beneficial (favorable, desirable, superior) affinity or activity properties compared to the non-selected Alphabodies of the single-chain Alphabody library of the invention.
  • the selection step comprises contacting the single-chain Alphabody library of the invention or a mixture of single-chain Alphabody libraries of the invention with a cytokine or growth factor and/or cytokine or growth factor receptor of interest and determining binding between the target molecule and an Alphabody present in the library.
  • the methods for the production of target-specific Alphabodies comprise the step of identifying from the single-chain Alphabody library or mixture of single-chain Alphabody libraries being contacted with the target molecule of interest (i.e. cytokine or growth factor and/or cytokine or growth factor receptor or fragment thereof), the one or more single-chain Alphabodies having detectable binding affinity for the cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • the target molecule of interest i.e. cytokine or growth factor and/or cytokine or growth factor receptor or fragment thereof
  • Alphabody to a target molecule or protein of interest can be determined in any suitable manner known per se, including, for example biopanning, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known in the art.
  • RIA radioimmunoassays
  • EIA enzyme immunoassays
  • Biopanning is a well known iterative selection/screening method to enrich an initial population of different molecules (such as an Alphabody library) for molecules having an affinity for the target of choice. Most often the initial population of molecules is displayed on a typical display vehicle such as bacteriophage but the technique is certainly not limited to this type of display.
  • the target is typically immobilized in the direct biopanning protocol. The immobilization of the target can be performed by many different methods known in the art. Examples of solid support are microtiter plates or tubes (e.g. Maxisorp plates, Maxisorp tubes, Nunc) or magnetic beads (Dynabeads, Invitrogen).
  • the target can either be directly coated on the plastic or the beads (surface activated Dynabeads, e.g. Dynabeads M270 Epoxy, Invitrogen) or via streptavidin when the target is biotinylated (e.g. Dynabeads MyOne Streptavidin T1 , Invitrogen).
  • tags can be used to capture the targets such as His-tags or alternatively, an antibody directed against the target can also be used to capture the target on the support.
  • These alternative tags are also compatible with the Dynabeads (Dynabeads His-tag isolation and pull down, Invitrogen) and Protein A or Protein G coupled Dynabeads (Dynabeads-Protein A/G, Invitrogen).
  • Dynabeads Dynabeads
  • Protein A or Protein G coupled Dynabeads Dynabeads-Protein A/G, Invitrogen
  • the target is captured on the solid support after incubation with the phage library.
  • this capturing can be indirect.
  • the target may be bound to e.g. a biotinylated compound that binds to a region of the target that is of no particular biological interest.
  • the capturing step may then consists of trapping this biotinylated compound to streptavidin coated magnetic beads, thereby capturing indirectly phage bound to the target.
  • the target-phage interaction is performed in solution. To be able to wash away the non- binding phage, the target needs to be immobilized on a solid support.
  • the immobilization of the target in the soluble biopanning method is identical to the immobilization possibilities in the direct biopanning protocols.
  • a classical biopanning protocol consists of 2, 3 to 5 or more screening rounds, depending on the type of target and library. Each selection round consists of typically different steps: (1) immobilization of the target of choice to a support. This step is optional, as biopanning can also be performed in a format wherein the target is not-immobilized but kept in solution (in case of soluble target) or remains anchored on a cell (in case of e.g.
  • step (4) amplification of the eluted binders from step (4) or from step (3) (in case step (4)) was omitted in consecutive screening rounds).
  • the steps 1 to 5 will be repeated two, three, four or more times to isolate from the initial library target-specific binders. After the biopanning, the target- specificity of the binders isolated from the different selection rounds is typically analyzed in ELISA assays or similar assays.
  • the most commonly used types of display libraries for selection or screening are libraries wherein the library members are displayed in a format where the displayed peptide or protein is attached, fused or anchored to a vehicle (phage, cell, RNA, etc) that contains the coding information of the displayed peptide or protein.
  • a vehicle phage, cell, RNA, etc
  • the Alphabody libraries used in the context of the invention are provided as a phage library and binding Alphabodies are identified by contacting the phage with the labeled target molecule, after which binding phages are retrieved by detection or selective collection of the labeled, bound target.
  • a biotinylated target can be used, whereby phage which generate an Alphabody binding to the target are captured with a streptavidin-coated support (e.g. magnetic beads).
  • the selection steps of the methods for producing one or more single-chain Alphabodies having detectable binding affinity (as defined herein) for a protein of interest may comprise the (further) enrichment of the Alphabody library or the mixture of Alphabody libraries for single-chain Alphabodies having detectable binding affinity for the protein of interest by iterative execution of the steps of contacting a protein of interest with a single-chain Alphabody library or with a mixture of single-chain Alphabody libraries of the invention and subsequently identifying from the single-chain Alphabody library or mixture of single-chain Alphabody libraries being contacted with the protein, the one or more single-chain Alphabodies having detectable binding affinity for the protein of interest.
  • the step of selecting a single-chain Alphabody that has detectable in vitro activity by interacting with a target protein of interest typically comprises:
  • cytokine or growth factor receptor may be a membrane anchored receptor, a soluble receptor or a molecule comprising one or more ectodomains of said cytokine or growth factor receptor.
  • the effect on the activity of a cytokine or growth factor or on the activity of a cytokine or growth factor receptor can be measured by ways known in the art. More specifically this involves determining the effect of the Alphabody on a known cytokine-mediated or growth factor-mediated effect in vitro. For instance, the effect of an Alphabody directed to a chemokine of interest can be measured in a chemotaxis assay using chemotactic cells.
  • the effect of an Alphabody directed to a cytokine or growth factor of interest may be measured by incubating said cytokine or growth factor with a given target cell which for its activity, growth or differentiation is dependent (positively or negatively) on said cytokine or growth factor and determining the target cell biological activity (metaboloic, growth, differentiation, apoptosis, or other functional property) in absence or presence of Alphabody.
  • selection methods described herein can also be performed as screening methods. Accordingly the term 'selection' as used in the present description can comprise selection, screening or any suitable combination of selection and/or screening techniques.
  • the methods of the present invention may further comprise the step of isolating from the single-chain Alphabody library at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • the methods of the present invention may further comprise the step of amplifying at least one single-chain Alphabody having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • a phage clone displaying a particular single-chain Alphabody obtained from a selection step of a method of the invention, may be amplified by reinfection of a host bacteria and incubation in a growth medium.
  • the methods of the present invention encompass determining the sequence of the Alphabody or Alphabodies capable of binding to the cytokine or growth factor and/or cytokine or growth factor receptor.
  • an Alphabody polypeptide sequence comprised in a set, collection or library of Alphabody polypeptide sequences, is displayed on a suitable cell or phage or particle, it is possible to isolate from said cell or phage or particle, the nucleotide sequence that encodes that Alphabody polypeptide sequence. In this way, the nucleotide sequence of the selected Alphabody library member(s) can be determined by a routine sequencing method.
  • the methods of the invention comprise the step of expressing said nucleotide sequence(s) in a host organism under suitable conditions, so as to obtain the actual desired Alphabody polypeptide sequence(s). This step can be performed by methods known to the person skilled in the art.
  • Alphabody sequences having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest may be synthesized as soluble protein construct, optionally after their sequence has been identified.
  • the Alphabodies obtained, obtainable or selected by the methods of the present invention can be synthesized using recombinant or chemical synthesis methods known in the art.
  • the Alphabodies obtained, obtainable or selected by the methods of the present invention can be produced by genetic engineering techniques.
  • methods for synthesizing an Alphabody obtained, obtainable or selected by the methods of the present invention may comprise transforming or infecting a host cell with a nucleic acid or a vector encoding an Alphabody sequence having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest.
  • the Alphabody sequences having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest can be made by recombinant DNA methods.
  • DNA encoding the Alphabodies can be readily synthesized using conventional procedures. Once prepared, the DNA can be introduced into expression vectors, which can then be transformed or transfected into host cells such as E. coli or any suitable expression system, in order to obtain the expression of Alphabodies in the recombinant host cells and/or in the medium in which these recombinant host cells reside.
  • Suitable host cells for the expression of the desired Alphabodies may be any eukaryotic or prokaryotic cell (e.g., bacterial cells such as E. coli, yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo.
  • host cells may be located in a transgenic animal.
  • the invention also relates to methods for the production of Alphabodies having detectable binding affinity for, or detectable in vitro activity on, a cytokine or growth factor and/or cytokine or growth factor receptor of interest comprising transforming, transfecting or infecting a host cell with nucleic acid sequences or vectors encoding such Alphabodies and expressing the Alphabodies under suitable conditions.
  • a cytokine or growth factor and/or cytokine or growth factor receptor of interest comprising transforming, transfecting or infecting a host cell with nucleic acid sequences or vectors encoding such Alphabodies and expressing the Alphabodies under suitable conditions.
  • the methods for the production of one or more target-specific Alphabodies may optionally comprise further steps or methods for improving or optimizing the binding specificity and/or efficacy of the target-specific Alphabodies obtainable by the methods of the invention.
  • the methods for the production of one or more target- binding Alphabodies may further be followed by steps or methods involving the rationalization of the obtained or produced Alphabody sequences.
  • a sequence rationalization process may include the identification or determination of particular amino acid residues, amino acid residue positions, stretches, motifs or patterns that are conserved between or among different Alphabodies against a specific target molecule of interest that have been produced using the methods of the invention. Accordingly, this rationalization process can be conducted by comparing different produced Alphabody sequences that are specific for a certain target molecule or protein of interest and identifying the sequence coherence between these sequences.
  • Such a process can be optionally supported or performed by using techniques for molecular modeling, interactive ligand docking or biostatistical data mining.
  • the particular amino acid residues, amino acid residue positions, stretches, motifs or patterns that are identified as being conserved between or among different Alphabodies against a specific target molecule of interest may be considered as contributing to the binding or activity of the target-specific Alphabodies.
  • the process of sequence rationalization as described above may further be followed by the creation of a new library of Alphabody sequences starting from the set of different Alphabody sequences that have been identified as being specific for a target molecule of interest and that have been produced using the methods of the invention.
  • the different Alphabody sequences are varied in a defined set of variegated amino acid residue positions. This defined set of variegated amino acid residue positions corresponds to those positions outside the positions where the amino acid residues, stretches, motifs or patterns are located that are conserved between or among different target-binding Alphabodies.
  • Alphabody libraries so obtained are referred to as 'dedicated libraries' of Alphabodies. These dedicated libraries are then again screened to identify the best target-binding Alphabody. Thus, in the production of such dedicated libraries of Alphabody sequences, the amino acid residues, stretches, motifs or patterns that are conserved between or among different Alphabodies are kept constant during the production process of the library. From such dedicated libraries, Alphabody sequences having an improved or optimized binding specificity for and/or in vitro activity on the target molecule of interest may be identified and optionally isolated.
  • the process of sequence rationalization as described above may further be followed by the creation of a new library of Alphabody sequences starting from the set of different Alphabody sequences that have been identified as being specific for a target molecule of interest and that have been produced using the methods of the invention.
  • a new library of Alphabody sequences starting from the set of different Alphabody sequences that have been identified as being specific for a target molecule of interest and that have been produced using the methods of the invention.
  • the different Alphabody sequences are varied by introducing at a limited number of randomly chosen positions, random amino acid substitutions.
  • error-prone PCR is a convenient method to generate 'spiked libraries', This can also be conveniently accomplished by a direct DNA synthesis method using spiked oligonucleotides as is known to someone skilled in the art of DNA synthesis.
  • the methods for the production of one or more target-binding Alphabodies may further, after the identification of two or more target-binding Alphabodies from a random library, comprise the steps of:
  • the library comprises different Alphabody sequences that are variegated at a limited number of randomly chosen positions, or, producing a dedicated library wherein the library comprises different Alphabody sequences that are variegated in a set of amino acid positions which are not the amino acid residues, amino acid residue positions, stretches, motifs or patterns that are conserved between or among the different target-binding Alphabody sequences,
  • Alphabody sequences having an improved or optimized binding specificity for and/or in vitro activity on the target molecule of interest.
  • the total number of amino acid residues in an Alphabody of the invention can be in the range of about 50 to about 210, depending mainly on the number of heptads per heptad repeat sequence and the length of the flexible linkers interconnecting the heptad repeat sequences.
  • Parts, fragments, analogs or derivatives of an Alphabody, polypeptide or composition of the invention are not particularly limited as to their length and/or size, as long as such parts, fragments, analogs or derivatives still have the biological function of an Alphabody, polypeptide or composition of the invention from which they are derived and can still be used for the envisaged (pharmacological) purposes.
  • directed evolution methods may also be employed in building Alphabody libraries starting from one or more different Alphabody sequences that have been identified as being specific for a target molecule of interest.
  • Such 'directed evolution' libraries can also be subjected to the selection and/or the identification of those Alphabody sequences having an improved or optimized binding specificity for and/or in vitro activity on the target molecule of interest.
  • the present invention provides (Alphabody) polypeptides (also referred to herein as polypeptides of the invention) that comprise or essentially consist of at least one Alphabody of the present invention that specifically binds to a cytokine or growth factor and/or a cytokine or growth factor receptor.
  • the polypeptides of the invention may comprise at least one Alphabody of the present invention and optionally one or more further groups, moieties, residues optionally linked via one or more linkers.
  • a polypeptide of the invention may optionally contain one or more further groups, moieties or residues for binding to other targets or target proteins of interest.
  • further groups, residues, moieties and/or binding sites may or may not provide further functionality to the Alphabodies of the invention (and/or to the polypeptide or composition in which it is present) and may or may not modify the properties of the Alphabody of the invention.
  • Such groups, residues, moieties or binding units may also for example be chemical groups which can be biologically and/or pharmacologically active.
  • groups, moieties or residues are, in particular embodiments, linked N- or C- terminally to the Alphabody. In particular embodiments however, one or more groups, moieties or residues are linked to the body of the Alphabody, e.g. to a free cysteine in an alpha-helix.
  • the polypeptides of the present invention comprise Alphabodies that have been chemically modified.
  • a modification may involve the introduction or linkage of one or more functional groups, residues or moieties into or onto the Alphabody of the invention.
  • These groups, residues or moieties may confer one or more desired properties or functionalities to the Alphabody of the invention. Examples of such functional groups will be clear to the skilled person.
  • the introduction or linkage of such functional groups to an Alphabody of the invention can result in an increase in the half-life, the solubility and/or the stability of the Alphabody of the invention or in a reduction of the toxicity of the Alphabody of the invention, or in the elimination or attenuation of any undesirable side effects of the Alphabody of the invention, and/or in other advantageous properties.
  • the polypeptides of the present invention comprise Alphabodies that have been chemically modified to increase the biological or plasma half-life thereof, for example, by means of PEGylation. by means of the addition of a group which binds to or which is a serum protein (such as serum albumin) or, in general, by linkage of the Alphabody to a moiety that increases the half-life of the Alphabody of the invention.
  • Alphabodies can be PEGylated at a solvent exposed cysteine using maleimide mPEG 40kD PEG (Jenkem Technology) or other PEG moieties of different molecular mass.
  • polypeptides of the present invention comprise
  • Alphabodies that have been fused to protein domains or peptides to increase the biological or plasma half-life thereof, for example, with a domain which binds to or which is a serum protein (such as serum albumin or to the Fc part of an immunoglobulin).
  • Said protein domain may be an Alphabody which binds to a serum protein.
  • polypeptides of the present invention comprise
  • Alphabodies that in addition to their target binding bind also to a serum protein (such as serum albumin or to the Fc part of an immunoglobulin) to increase the biological or plasma half-life of said Alphabodies.
  • a serum protein such as serum albumin or to the Fc part of an immunoglobulin
  • the polypeptides of the invention with increased half-life have a half-life (in human or in an animal model used for PK evaluation such as rat, dog, monkey, mouse, horse, pig, cat, etc) of more than 1 week, equally preferably more than 2 weeks as compared to the half-life of the corresponding Alphabody of the invention lacking the above described equipment for half life extension.
  • a particular modification of the Alphabodies of the invention may comprise the introduction of one or more detectable labels or other signal-generating groups or moieties, depending on the intended use of the labeled Alphabody.
  • Yet a further particular modification may involve the introduction of a chelating group, for example to chelate one or more metals or metallic cations.
  • a particular modification may comprise the introduction of a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair.
  • the Alphabodies of the invention may also be linked to a toxin or to a toxic residue or moiety.
  • the one or more groups, residues, moieties are linked to the Alphabody via one or more suitable linkers or spacers.
  • the polypeptides of the invention comprise two or more target-specific Alphabodies.
  • the two or more target-specific Alphabodies may be linked (coupled, concatenated, interconnected, fused) to each other either in a direct or in an indirect way.
  • the two or more Alphabodies are directly linked to each other, they are linked without the aid of a spacer or linker fragment or moiety.
  • the two or more Alphabodies are indirectly linked to each other, they are linked via a suitable spacer or linker fragment or linker moiety.
  • Alphabodies may be produced as single-chain fusion constructs (i.e., as single-chain protein constructs wherein two or more Alphabody sequences directly follow each other in a single, contiguous amino acid sequence).
  • direct linkage of Alphabodies may also be accomplished via cysteines forming a disulfide bridge between two Alphabodies (i.e., under suitable conditions, such as oxidizing conditions, two Alphabodies comprising each a free cysteine may react with each other to form a dimer wherein the constituting momomers are covalently linked through a disulfide bridge).
  • Alphabodies may be linked to each other via a suitable spacer or linker fragment or linker moiety.
  • they may also be produced as single-chain fusion constructs (i.e., as single-chain protein constructs wherein two or more Alphabody sequences follow each other in a single, contiguous amino acid sequence, but wherein the Alphabodies remain separated by the presence of a suitably chosen amino acid sequence fragment acting as a spacer fragment).
  • indirect linkage of Alphabodies may also be accomplished via amino acid side groups or via the Alphabody N- or C-termini.
  • two Alphabodies comprising each a free cysteine may react with a homo-bifunctional chemical compound, yielding an Alphabody dimer wherein the constituting Alphabodies are covalently cross-linked through the said homo-bifunctional compound.
  • one or more Alphabodies may be cross-linked through any combination of reactive side groups or termini and suitably chosen homo- or heterobifunctional chemical compounds for cross-linking of proteins.
  • the two or more linked Alphabodies can have the same amino acid sequence or different amino acid sequences.
  • the two or more linked Alphabodies can also have the same binding specificity or a different binding specificity.
  • the two or more linked Alphabodies can also have the same binding affinity or a different binding affinity.
  • Suitable spacers or linkers for use in the coupling of different Alphabodies of the invention will be clear to the skilled person and may generally be any linker or spacer used in the art to link peptides and/or proteins.
  • a linker or spacer is suitable for constructing proteins or polypeptides that are intended for pharmaceutical use.
  • linkers or spacers for coupling of Alphabodies in a single- chain amino acid sequence include for example, but are not limited to, polypeptide linkers such as glycine linkers, serine linkers, mixed glycine/serine linkers, glycine- and serine-rich linkers or linkers composed of largely polar polypeptide fragments.
  • linkers or spacers for coupling of Alphabodies by chemical cross-linking include for example, but are not limited to, homo-bifunctional chemical cross-linking compounds such as glutaraldehyde, imidoesters such as dimethyl adipimidate (DMA), dimethyl suberimidate (DMS) and dimethyl pimelimidate (DMP) or N-hydroxysuccinimide (NHS) esters such as dithiobis(succinimidylpropionate) (DSP) and dithiobis(sulfosuccinimidylpropionate) (DTSSP).
  • homo-bifunctional chemical cross-linking compounds such as glutaraldehyde, imidoesters such as dimethyl adipimidate (DMA), dimethyl suberimidate (DMS) and dimethyl pimelimidate (DMP) or N-hydroxysuccinimide (NHS) esters such as dithiobis(succinimidylpropionate) (DSP) and dithi
  • hetero-bifunctional reagents for cross-linking include, but are not limited to, cross-linkers with one amine-reactive end and a sulfhydryl-reactive moiety at the other end, or with a NHS ester at one end and an SH-reactive group (e.g., a maleimide or pyridyl disulfide) at the other end.
  • cross-linkers with one amine-reactive end and a sulfhydryl-reactive moiety at the other end, or with a NHS ester at one end and an SH-reactive group (e.g., a maleimide or pyridyl disulfide) at the other end.
  • a polypeptide linker or spacer for usage in single-chain concatenated Alphabody constructs may be any suitable (e.g., glycine-rich) amino acid sequence having a length between 1 and 50 amino acids, such as between 1 and 30, and in particular between 1 and 10 amino acid residues. It should be clear that the length, the degree of flexibility and/or other properties of the spacer(s) may have some influence on the properties of the final polypeptide of the invention, including but not limited to the affinity, specificity or avidity for a protein of interest, or for one or more other target proteins of interest. It should be clear that when two or more spacers are used in the polypeptides of the invention, these spacers may be the same or different. In the context and disclosure of the present invention, the person skilled in the art will be able to determine the optimal spacers for the purpose of coupling Alphabodies of the invention without any undue experimental burden.
  • the linked Alphabody polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more Alphabodies of the invention to the one or more further groups, residues, moieties and/or other Alphabodies of the invention, optionally via the one or more suitable linkers, so as to provide a polypeptide of the invention.
  • polypeptides of the present invention can be produced by methods at least comprising the steps of: (i) expressing, in a suitable host cell or expression system, the polypeptide of the invention, and (ii) isolating and/or purifying the polypeptide of the invention. Techniques for performing the above steps are known to the person skilled in the art. [PARTS/FRAGMENTS/ANALOGS/DERIVATIVES]
  • the present invention also encompasses parts, fragments, analogs, mutants, variants, and/or derivatives of the Alphabodies and polypeptides of the invention and/or polypeptides comprising or essentially consisting of one or more of such parts, fragments, analogs, mutants, variants, and/or derivatives, as long as these parts, fragments, analogs, mutants, variants, and/or derivatives are suitable for the prophylactic, therapeutic and/or diagnostic purposes envisaged herein.
  • Such parts, fragments, analogs, mutants, variants, and/or derivatives according to the invention are still capable of specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors.
  • the invention is not limited as to the origin of the Alphabodies, polypeptides or compositions of the invention (or of the nucleotide sequences of the invention used to express them). Furthermore, the present invention is also not limited as to the way that the Alphabodies, polypeptides or nucleotide sequences of the invention have been generated or obtained. Thus, the Alphabodies of the invention may be synthetic or semi-synthetic amino acid sequences, polypeptides or proteins.
  • Alphabodies, polypeptides and compositions provided by the invention can be in essentially isolated form (as defined herein), or alternatively can form part of a polypeptide or composition of the invention, which may comprise or essentially consist of at least one Alphabody of the invention and which may optionally further comprise one or more other groups, moieties or residues (all optionally linked via one or more suitable linkers).
  • the Alphabodies, polypeptides and compositions of the invention will in principle be directed against or specifically bind to human cytokines or growth factors and/or human cytokine or growth factor receptors.
  • the Alphabodies, polypeptides and compositions of the invention are intended for veterinary purposes, they will be directed against or specifically bind to cytokines or growth factors and/or cytokine or growth factor receptors from the species intended to be treated, or they will be at least cross-reactive with cytokines or growth factors and/or cytokine or growth factor receptors from the species to be treated.
  • Alphabodies, polypeptides and compositions that specifically bind to cytokines or growth factors and/or cytokine or growth factor receptors from one subject species may or may not show cross-reactivity with cytokines or growth factors and/or cytokine or growth factor receptors from one or more other subject species.
  • Alphabodies may be developed which bind to a cytokine or growth factor and/or a cytokine or growth factor receptor from another species than that which is to be treated, for use in research and laboratory testing.
  • Alphabodies and polypeptides of the invention will bind to a number of naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of cytokines or growth factors and/or cytokine or growth factor receptors. More particularly, it is expected that the Alphabodies and polypeptides of the invention will bind to at least those analogs, variants, mutants, alleles, parts and fragments of cytokines or growth factor and/or cytokine or growth factor receptors that (still) contain the binding site, part or domain of the (natural/wild-type) cytokine or growth factor and/or the cytokine or growth factor receptor to which those Alphabodies and polypeptides bind. [NUCLEIC ACID SEQUENCES]
  • the invention provides nucleic acid sequences encoding single-chain Alphabodies or Alphabody polypeptides, which are obtainable by the methods according to the invention (also referred to herein as 'nucleic acid sequences of the invention') as well as vectors and host cells comprising such nucleic acid sequences.
  • the present invention provides nucleic acid sequences encoding the Alphabodies or the polypeptides of the invention (or suitable fragments thereof). These nucleic acid sequences are also referred to herein as nucleic acid sequences of the invention and can also be in the form of a vector or a genetic construct or polynucleotide.
  • the nucleic acid sequences of the invention may be synthetic or semi-synthetic sequences, nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
  • the genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA.
  • the genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism.
  • the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon.
  • the vector may be an expression vector, i.e., a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
  • the genetic constructs of the invention may comprise a suitable leader sequence to direct the expressed Alphabody to an intended intracellular or extracellular compartment.
  • the genetic constructs of the invention may be inserted in a suitable vector at a pelB leader sequence site to direct the expressed Alphabody to the bacterial periplasmic space.
  • the vector may be equipped with a suitable promoter system to, for example, optimize the yield of the Alphabody.
  • the invention provides vectors comprising nucleic acids encoding single- chain Alphabodies, which are obtainable by the methods according to the invention.
  • the present invention provides host cells comprising nucleic acids encoding single-chain Alphabodies or Alphabody polypeptides, which are obtainable by the methods according to the invention or vectors comprising these nucleic acids.
  • a particular embodiment of the invention is a host cell transfected or transformed with a vector comprising the nucleic acid sequence encoding the Alphabodies or Alphabody polypeptides obtainable by the methods of the invention and which is capable of expressing them.
  • Suitable examples of hosts or host cells for expression of the Alphabodies or polypeptides of the invention will be clear to the skilled person and include any suitable eukaryotic or prokaryotic cell (e.g., bacterial cells such as E. coli, yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo.
  • the Alphabodies or polypeptides of the invention that specifically bind to cytokines or growth factors or a cytokine or growth factor receptor are capable of specifically inhibiting, preventing or decreasing the activity of the cytokines or growth factors or cytokine or growth factor receptor, and/or of inhibiting, preventing or decreasing the signaling and biological mechanisms and pathways in which these cytokines or growth factor and/or receptors play a role.
  • the Alphabodies, polypeptides and pharmaceutical compositions of the present invention can be used to prevent or inhibit the interaction between one or more cytokines or growth factors and their corresponding cytokine or growth factor receptors, thereby preventing, inhibiting or reducing the signalling pathways that are mediated by those cytokines or growth factors and/or their receptors and/or modulating the biological pathways and mechanisms in which those cytokines or growth factors and/or their receptors are involved.
  • Alphabodies, polypeptides and pharmaceutical compositions of the present invention can be used to affect, change or modulate the immune system and/or one or more specific immune responses in a subject in which the cytokines or growth factors and/or cytokine or growth factor receptors to which the one or more of the Alphabodies, polypeptides and compositions of the present invention bind, are involved.
  • the Alphabodies, polypeptides and compositions of the invention specifically bind to a cytokine or growth factor, and more particularly to the receptor binding site on the cytokine or growth factor.
  • 'inhibiting', 'reducing' and/or 'preventing' using an Alphabody, polypeptide or composition of the invention may mean either inhibiting, reducing and/or preventing the interaction between a target protein of interest and its natural binding partner, or, inhibiting, reducing and/or preventing the activity of a target protein of interest, or, inhibiting, reducing and/or preventing one or more biological or physiological mechanisms, effects, responses, functions pathways or activities in which the target protein of interest is involved, such as by at least 10%, but preferably at least 20%, for example by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more, as measured using a suitable in vitro, cellular or in vivo assay, compared to the activity of the target protein of interest in the same assay under the same conditions but without using the Alphabody, polypeptide or composition of the invention.
  • 'inhibiting', 'reducing' and/or 'preventing' may also mean inducing a decrease in affinity, avidity, specificity and/or selectivity of a target protein of interest for one or more of its natural binding partners and/or inducing a decrease in the sensitivity of the target protein of interest for one or more conditions in the medium or surroundings in which the target protein of interest is present (such as pH, ion strength, the presence of co-factors, etc.), compared to the same conditions but without the presence of the Alphabody, polypeptide or composition of the invention.
  • 'inhibiting', 'reducing' and/or 'preventing' may also involve allosteric inhibition, reduction and/or prevention of the activity of a target protein of interest.
  • the Alphabodies, polypeptides and compositions of the invention are directed against a cytokine or growth factor (as further described herein).
  • the result of the binding of the Alphabodies to the cytokine or growth factor can be such that, upon binding to that cytokine or growth factor, it prevents, reduces or inhibits binding of that cytokine or growth factor to its receptor or to at least one subunit thereof compared to the binding of the cytokine or growth factor to its receptor in the absence of such Alphabodies, polypeptides or pharmaceutical compositions of the invention, and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • the binding of the Alphabodies or Alphabody polypeptides to the cytokine or growth factor is such that it still allows the cytokine or growth factor to bind to its receptor, but prevents, reduces or inhibits the signalling that would be triggered by binding of the cytokine or growth factor to its receptor or at least one subunit thereof compared to the signalling upon binding of the cytokine or growth factor to its receptor in the absence of such Alphabodies, polypeptides or pharmaceutical compositions of the invention, and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • the binding of the Alphabodies or Alphabody polypeptides to the cytokine or growth factor is such that it prevents, reduces or inhibits activation and/or association of the receptor, and in particular cytokine-mediated or growth factor-mediated association of the receptor (i.e. compared to the cytokine- or growth factor-mediated association of the receptor without the presence of such Alphabodies, polypeptides and compositions of the invention), and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • the Alphabodies or polypeptides of the invention specifically bind to a cytokine or growth factor receptor, and more particularly to the cytokine or growth factor binding site on the cytokine or growth factor receptor.
  • the Alphabodies, polypeptides and compositions of the invention are directed against a cytokine or growth factor receptor or at least one subunit thereof (as further described herein) such that, upon binding to that cytokine or growth factor receptor, it prevents, reduces or inhibits binding of that cytokine or growth factor receptor to its natural cytokine or growth factor ligand compared to the binding of the cytokine or growth factor receptor to its natural cytokine or growth factor ligand in the absence of such Alphabodies, polypeptides or pharmaceutical compositions of the invention, and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • binding of the Alphabodies or Alphabody polypeptides to the cytokine or growth factor receptor or to at least one subunit thereof is such that it still allows the cytokine or growth factor receptor to bind to its natural cytokine or growth factor ligand, but prevents, reduces or inhibits the signalling that would be triggered by binding of the cytokine or growth factor receptor to its natural cytokine or growth factor ligand compared to the signalling upon binding of the cytokine or growth factor receptor to its natural cytokine or growth factor ligand in the absence of such Alphabodies, polypeptides or pharmaceutical compositions of the invention, and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • the Alphabodies, polypeptides and compositions of the invention specifically bind to a cytokine or growth factor receptor (as further described herein) such that it prevents, reduces or inhibits activation and/or association of the receptor, and in particular cytokine-mediated or growth factor-mediated association of the receptor (i.e. compared to the cytokine- or growth factor- mediated association of the receptor without the presence of such Alphabodies, polypeptides and compositions of the invention), and this by at least 20%, for example by at least 50%, as at least 70%, at least 80%, at least 90%, at least 95% or more, as determined by a suitable assay known in the art.
  • Alphabodies, polypeptides and compositions of the invention will generally act as antagonists of cytokine- or growth factor- mediated signalling , i.e. the signalling that is caused by binding of a cytokine or growth factor to its receptor, as well as the biological mechanisms and effects that are induced by such signalling.
  • an Alphabody, polypeptide or composition according to the invention may specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor thereby enhancing, increasing and/or activating the interaction between that cytokine or growth factor and/or its receptor.
  • Such an agonizing Alphabody, polypeptide or composition according to the invention may specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor thereby enhancing, increasing and/or activating the biological activity and/or one or more biological or physiological mechanisms, effects, responses, functions or pathways of that cytokine or growth factor and/or that cytokine or growth factor receptor, as measured using a suitable in vitro, cellular or in vivo assay.
  • the Alphabodies, polypeptides and compositions of the invention according to this particular embodiment will generally act as agonists of cytokine-mediated or growth factor-mediated signalling, i.e. the signalling that is caused by binding of a cytokine or growth factor to its receptor, as well as the biological mechanisms and effects that are induced by such signalling.
  • the Alphabodies, polypeptides and pharmaceutical compositions of the present invention can be used to increase one or more specific immune responses in a subject in which the cytokines or growth factors and/or cytokine or growth factor receptors to which the one or more of the Alphabodies, polypeptides and compositions of the present invention bind, are involved.
  • Agonistic Alphabodies, polypeptides or pharmaceutical compositions of the invention binding to certain cytokines or growth factors and/or cytokine or growth factor receptors can be used to stimulate or enhance one or more immune responses in a subject, for example for the prevention and/or treatment of diseases that are characterized by a weakened immune system or that may occur as a result of having a weakened immune system.
  • the present invention provides pharmaceutical compositions comprising one or more Alphabodies, polypeptides and/or nucleic acid sequences according to the invention and optionally at least one pharmaceutically acceptable carrier (also referred to herein as pharmaceutical compositions of the invention).
  • the pharmaceutical compositions of the invention may further optionally comprise at least one other pharmaceutically active compound.
  • compositions of the present invention can be used in the diagnosis, prevention and/or treatment of diseases and disorders associated with cytokines or growth factors and/or cytokine or growth factor receptors.
  • compositions comprising Alphabodies and polypeptides of the invention that are suitable for prophylactic, therapeutic and/or diagnostic use in a warm-blooded animal, and in particular in a mammal, and more in particular in a human being.
  • the present invention also provides pharmaceutical compositions comprising Alphabodies and polypeptides of the invention that can be used for veterinary purposes in the prevention and/or treatment of one or more diseases, disorders or conditions associated with and/or mediated by cytokines or growth factors and/or cytokine or growth factor receptors.
  • the polypeptides of the invention may be formulated as a pharmaceutical preparation or compositions comprising at least one Alphabody or polypeptide of the invention and at least one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and optionally one or more further pharmaceutically active polypeptides and/or compounds.
  • a pharmaceutical preparation or compositions comprising at least one Alphabody or polypeptide of the invention and at least one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and optionally one or more further pharmaceutically active polypeptides and/or compounds.
  • Such a formulation may be suitable for oral, parenteral, topical administration or for administration by inhalation.
  • the Alphabodies, or polypeptides of the invention and/or the compositions comprising the same can for example be administered orally, intraperitoneally, intravenously, subcutaneously, intramuscularly, transdermal ⁇ , topically, by means of a suppository, by inhalation, again depending on the specific pharmaceutical formulation or composition to be used.
  • the clinician will be able to select a suitable route of administration and a suitable pharmaceutical formulation or composition to be used in such administration.
  • the pharmaceutical compositions may also contain suitable binders, disintegrating agents, sweetening agents or flavoring agents. Tablets, pills, or capsules may be coated for instance with gelatin, wax or sugar and the like.
  • the Alphabodies and polypeptides of the invention may be incorporated into sustained-release preparations and devices.
  • the pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes.
  • the liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof.
  • Antibacterial and antifungal agents and the like can optionally be added.
  • Useful dosages of the Alphabodies and polypeptides of the invention can be determined by determining their in vitro activity, and/or in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the skilled person.
  • the amount of the Alphabodies and polypeptides of the invention required for use in prophylaxis and/or treatment may vary not only with the particular Alphabody or polypeptide selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician. Also the dosage of the Alphabodies and polypeptides of the invention may vary depending on the target cell, tumor, tissue, graft, or organ.
  • Alphabodies or polypeptides of the invention and/or the compositions comprising the same are administered according to a regimen of treatment that is suitable for preventing and/or treating the disease or disorder to be prevented or treated.
  • the clinician will generally be able to determine a suitable treatment regimen.
  • the treatment regimen will comprise the administration of one or more Alphabodies and/or polypeptides of the invention, or of one or more compositions comprising the same, in one or more pharmaceutically effective amounts or doses.
  • the desired dose may conveniently be presented in a single dose or as divided doses (which can again be sub-dosed) administered at appropriate intervals.
  • An administration regimen could include long-term (i.e., at least two weeks, and for example several months or years) or daily treatment.
  • the Alphabodies and polypeptides of the present invention will be administered in an amount which will be determined by the medical practitioner based inter alia on the severity of the condition and the patient to be treated.
  • an optical dosage will be determined specifying the amount to be administered per kg body weight per day, either continuously (e.g. by infusion), as a single daily dose or as multiple divided doses during the day.
  • the clinician will generally be able to determine a suitable daily dose, depending on the factors mentioned herein. It will also be clear that in specific cases, the clinician may choose to deviate from these amounts, for example on the basis of the factors cited above and his expert judgment.
  • Alphabodies and polypeptides of the invention may be used in combination with other pharmaceutically active compounds or principles that are or can be used for the prevention and/or treatment of the diseases and disorders cited herein, as a result of which a synergistic effect may or may not be obtained. Examples of such compounds and principles, as well as routes, methods and pharmaceutical formulations or compositions for administering them will be clear to the clinician.
  • the present invention provides the use of Alphabodies or polypeptides of the invention that specifically bind to a cytokine or growth factor and/or a cytokine or growth factor receptor for the preparation of a medicament for the prevention and/or treatment of at least one cytokine-mediated or growth factor-mediated disease and/or disorder in which said cytokine or growth factor and/or said cytokine or growth factor receptor are involved.
  • the invention provides Alphabodies, polypeptides and pharmaceutical compositions specifically binding to a cytokine or growth factor and/or a cytokine or growth factor receptor for use in the prevention and/or treatment of at least one cytokine-mediated or growth factor-mediated disease and/or disorder in which said cytokine or growth factor and/or said cytokine or growth factor receptor are involved.
  • the present invention also provides methods for the prevention and/or treatment of at least one cytokine- or growth factor-mediated disease and/or disorder, comprising administering to a subject in need thereof, a pharmaceutically active amount of one or more Alphabodies, polypeptides and/or pharmaceutical compositions of the invention.
  • the pharmaceutically active amount may be an amount that is sufficient (to create a level of the Alphabody or polypeptide in circulation) to inhibit, prevent or decrease (or in the case of agonistic Alphabodies and polypeptides of the invention: enhance, promote or increase) the function of cytokines or growth factors and/or their receptors or their biological or pharmacological activity and/or the biological pathways or signalling in which they are involved.
  • the subject or patient to be treated with the Alphabodies or polypeptides of the invention may be any warm-blooded animal, but is in particular a mammal, and more in particular a human suffering from, or at risk of, diseases and disorders in which the cytokines or growth factors and/or cytokine or growth factor receptors to which the Alphabodies or polypeptides of the invention specifically bind are involved.
  • cytokines or growth factors and/or cytokine or growth factor receptors' can be defined as diseases and disorders in which the activity of one or more cytokines or growth factors plays a detrimental role.
  • diseases or disorders that can be prevented and/or treated, respectively, by suitably administering to a subject in need thereof (i.e., having the disease or disorder or at least one symptom thereof and/or being at risk of attracting or developing the disease or disorder), either an Alphabody, a polypeptide or composition of the invention (and in particular, of a pharmaceutically active amount thereof).
  • diseases and disorders associated with cytokines or growth factors and/or cytokine or growth factor receptors will be clear to the skilled person, and include the following diseases and disorders: inflammation and inflammatory disorders such as bowel diseases (colitis, Crohn's disease, IBD), infectious diseases, psoriasis, and other autoimmune diseases (such as rheumatoid arthritis, Multiple Sclerosis, Spondylarthritis, Sarcoidosis, Lupus, Behcet's disease), transplant rejection, cystic fibrosis, asthma, chronic obstructive pulmonary disease, cancer, viral infection, common variable immunodeficiency.
  • bowel diseases colitis, Crohn's disease, IBD
  • infectious diseases psoriasis
  • psoriasis psoriasis
  • other autoimmune diseases such as rheumatoid arthritis, Multiple Sclerosis, Spondylarthritis, Sarcoidosis, Lupus, Behcet's disease
  • transplant rejection cystic fibrosis
  • asthma
  • the disease or disorder is an inflammatory disorder and/or an autoimmune disease.
  • the disease is selected from the group consisting of asthma, multiple sclerosis, inflammatory bowel disease, rheumatoid arthritis or psoriasis.
  • the invention provides for Alphabodies or Alphabody polypeptides against IL-23 or the IL-23 receptor for use in a method for treatment of an inflammatory and/or autoimmune disease or for use in a method of treatment of transplant rejection, cystic fibrosis, asthma, chronic obstructive pulmonary disease, cancer, viral infection, or common variable immunodeficiency.
  • the invention provides for Alphabodies or Alphabody polypeptides against Flt3L (i.e., Flt3 ligand) or against Flt3R (i.e., Flt3 receptor) for use in a method for treatment of an inflammatory and/or autoimmune disease or for use in a method of treatment of transplant rejection, cystic fibrosis, asthma, chronic obstructive pulmonary disease, cancer, viral infection, or common variable immunodeficiency.
  • Flt3L i.e., Flt3 ligand
  • Flt3R i.e., Flt3 receptor
  • the efficacy of the Alphabodies and polypeptides of the invention, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell- based assay, in vivo assay and/or animal model known per se, or any combination thereof, depending on the specific disease or disorder involved. Suitable assays and animal models will be clear to the skilled person.
  • the efficacy of an anti-IL-23 Alphabody or Alphabody polypeptide can be easily determined in an in vitro assay which measures the IL- 23-dependent production of IL-17 in mouse splenocytes.
  • splenocytes from balb/c mice are isolated, and IL-23 (mouse or human) is added together with (or without) the selected Alphabodies or Alphabody polypeptides at various concentrations.
  • IL-17A in the supernatans will then be detected via an ELISA from which the inhibitory potential of the anti-IL-23 Alphabodies can be easily determined.
  • an anti-IL-23 or anti-Flt3L Alphabody or polypeptide can be determined in a mouse psoriasis model, using for example TNO's (The Netherlands) xenografted mice model which comprises following steps as described in TNO's web publication ('Humanized_mouse_model_psoriasis-Pharma19B1.pdf located at http://www.tno.nl/downloads/): (a) Select patients and obtain Medical Ethical Committee approval, (b) Patient donate biopsies, based on informed consent, (c) Biopsies are transplanted onto immune-deficient mice, (d) Peripheral blood mononucleated cells (PBMC) are isolated from patients, (e) The autologous activated PBMC are injected into the xenograft to induce psoriasis, (f) Treatment with investigational drug and determining the inhibition of epidermal (acanthosis) by the anti-IL-23
  • the skilled person will generally be able to select a suitable in vitro assay, cellular assay or animal model to test the Alphabodies and polypeptides of the invention for binding to a cytokine or growth factor and/or a cytokine or growth factor receptor or for their capacity to affect the activity of these cytokines or growth factor and receptors, and/or the biological mechanisms in which these are involved; as well as for their therapeutic and/or prophylactic effect in respect of one or more diseases and disorders that are associate with a cytokine or growth factor and/or a cytokine or growth factor receptor.
  • FIGURES show:
  • Figure 1 Definition of the single-chain Alphabody libraries scLib_AC11 b ( Figure 1A), scLib_AC12 ( Figure 1 B) and scl_ib_B10 ( Figure 1 C). These libraries are also named by their short names, respectively AC11 b, AC12 and B10. The libraries are C-terminally connected to the N-terminus of the phage coat protein pill. The name of each library is indicated at the top row of each of the three panels ('scLib_AC1 1 b', 'scLib_AC12' and 'scl_ib_B10').
  • FIG. 1 Western blot of Alphabody libraries. Phage were run on a 12% SDS-PAGE gel and transferred on a PVDF membrane for Western blot analysis. The pill protein was visualized with an anti-pill antibody. Panel A: The first two lanes are respectively, a size ladder (ColorPlus Pre-stained protein Ladder broad range 10-230 kDa, NEB) and an empty phage. The empty phage displayed only wild type pill protein. The next three lanes are a reference Alphabody library, the scLib_AC12 and the scLib_AC11 b library, respectively.
  • a size ladder ColorPlus Pre-stained protein Ladder broad range 10-230 kDa, NEB
  • the empty phage displayed only wild type pill protein.
  • the next three lanes are a reference Alphabody library, the scLib_AC12 and the scLib_AC11 b library, respectively.
  • Panel B The first two lanes are respectively, a size ladder (ColorPlus Pre-stained protein Ladder broad range 10-230 kDA, NEB) and an empty phage.
  • the next two lanes are a reference Alphabody library and the scLib_B10 library, respectively.
  • the arrow indicates the Alphabody fusion pill protein displaying a higher molecular weight than the wild type pill protein.
  • Figure 3 Evolution of the percentage of positive clones as determined in ELISA during the selection rounds 2, 3 and 4 for the 4 biopanning campaigns with the scLib_B10, scLib_AC11 b, scLib_AC12 and mix of these libraries. The percentage of positive clones was not determined for the library scLib_B10 and the mix of libraries at round 4.
  • Figure 4 Definition of the single-chain Alphabody libraries scLib_AC11 (Figure 4A), scLib_AC7 ( Figure 4B) and scLib_C9 ( Figure 4C). These libraries are also named by their short names AC11 , AC7 and C9, respectively. Their full amino acid sequences (SEQ ID NO: 131 , 132, 133) are listed (in single-letter notation) at the bottom of each table panel, to the right of the label 'Full'. The symbol 'x' is used at positions that are randomized. 'PIN' denotes the phage pill coat protein.
  • FIG. 6 Isothermal titration calorimetry of hFlt3L (cell) with hFlt3L_cl4 (syringe). The experiment was performed three times (panels a-c). Upper panels show the raw thermograms recorded as heat output (in ⁇ 3 ⁇ / ⁇ ); each peak corresponds to one injection. Lower panels show the enthalpy changes (in kcal/mole of hFlt3L_cl4) integrated per peak.
  • Figure 7. Crystallographically determined structure of the hFlt3L_cl4m:(hFlt3L) 2 complex. The dimeric hFlt3L structure is rendered in space filling mode, with each monomer in different shades of gray.
  • the Alphabody hFlt3L_cl4m is shown as a ribbon and its N- terminal end is labeled 'N'.
  • Alphabody helices A, B and C and linker segments L1 and L2 are labeled accordingly.
  • Linker segment L2 was not well visible in the X-ray structure (in contrast to L1) and was completed by molecular modeling. All contact residues from the Alphabody (having one or more side-chain atoms within 4 A distance from hFlt3L) are represented by sticks. All such residues are located in the C-helix, although some additional contacts are observed in L1 as well.
  • 'scLib_B10' In one library (referred to as 'scLib_B10', also denoted 'B10') randomized positions were introduced in an Alphabody B-helix and in two other libraries (referred to as 'scLib_AC11 b' or 'AC1 1 b' and 'scLib_AC12' or 'AC12', respectively) residues in the A- and C-helices were randomized.
  • the AC11 b library comprised Alphabodies with 1 1 variegated residue positions within the A- and C-helices, the majority of these positions being located at heptad c- and g- positions in the A-helix and at b- and e-positions in the C-helix.
  • the randomized amino acid sequence of the AC11 b library is shown in Figure 1 A.
  • the AC12 library comprised Alphabodies with 12 variable residue positions in the groove formed by the A- and C-helices, similar to the AC11 b library, but modified with the specific aim to make the variable positions more 'patch-like'. For this purpose, two heptad f-positions in the C-helix were randomized as well.
  • the L1 and L2 linkers comprise 8- residue Gly/Ser sequences.
  • the randomized amino acid sequence of the AC12 library is shown in Figure 1 B.
  • the B10 library comprised Alphabodies with 9 variable residue positions in the B-helix located at heptad b-, c-, f- and g-positions primarily near the end of helix B.
  • Alphabody position B3g was included as a variable residue, its H-bonding partner at position C1 g was varied too;
  • Alphabody positions are herein referred to using a 3-character notation wherein the first character denotes the helix, the second character denotes the heptad number, and the third character denotes the heptad position (e.g., 'C1g' refers to C-helix, 1st heptad, g- position).
  • the three phage-displayed Alphabody libraries described in this Example were used individually to perform biopanning campaigns on IL-23. In addition, also a mixture of these libraries, referred to as 'mix', was used in a separate biopanning campaign.
  • the phage libraries displayed randomized Alphabody sequences as fusion proteins with the viral pill protein.
  • the system used for display was a phagemid system resulting in monovalent display, although other display systems can be envisaged as well.
  • the size of the Alphabody libraries corresponded to about 1 E9 (one billion) unique clones (u.c). It is important that during the rescue of the library the complexity (i.e., diversity) of the library is conserved and that all Alphabody variants are represented in the rescued phage library.
  • the inoculums (0.608 ml, 1.157 ml and 0.633 ml) of the library stock were transferred to the calculated volumes (respectively 933 ml, 1466 ml and 1266 ml) of growth medium consisting of 2xTY supplemented with 0.1 mg/ml ampicillin and 2% of glucose (2xTY-AG).
  • the baffle flask containing the growth medium should preferably not be overfilled to maintain good aeration.
  • the bacterial cultures were grown at 37°C while shaking (300 rpm) in baffle flasks to reach an OD600nm of 0.5 (mid-log phase).
  • the bacterial culture was used for superinfection with helper phage M13K07 (GE Healthcare) to produce phage particles.
  • helper phage M13K07 GE Healthcare
  • a sample of the bacterial culture was taken to determine the total number of viable cells at this stage by titration on 2xTY-AG agar plates.
  • the ratio helper phage/bacteria applied for the superinfection was 20: 1.
  • 3E8 x 0.5 x culture volume x 20 concentration of helper phage to be added to the cultures.
  • the infection culture was incubated at 37°C for 30 min without shaking to allow infection of the bacteria. After incubation, a sample of the infection culture was taken for titration on 2xTY-AG agar plates and 2xTY-AGK agar plates (K standing for kanamycin (25 microgram/ml) since helper phage are kanamycin resistant) to determine the number of viable and infected bacteria, respectively. The infection culture was then incubated for an additional 30 min, at 37°C while shaking.
  • bacterial cell pellets were obtained by centrifugation of the cultures at 4000 rpm for 10 min at room temperature. The bacterial pellets were resuspended in the same volume of pre-warmed 2xTY-AK medium as the initial startvolume. Cultures were grown overnight at 30°C while shaking (300 rmp).
  • a sample of the culture was taken for titration on 2xTY-AGK agar plates to determine viable cells.
  • the cultures were cooled for 5 min on ice and bacteria were pelleted at 7000 rpm for 20 min.
  • the supernatant was collected to precipitate phage by adding 1/5th of the volume of a solution of 20% PEG 4000 12.5 M NaCI and incubated 1 to 2 hours on ice. After incubation, phage were recovered by centrifugation at 4°C, 7000 rpm for 20 min.
  • Phage pellet was dissolved in 35 ml Phosphate Buffered Saline (PBS)/900 ml of bacterial culture and bacterial debris was removed by 10 min centrifugation at 12000 rpm. A second PEG/NaCI precipitation was performed for 1 hr followed by removal of bacterial debris. Finally, purified phage displaying the library were obtained (10ml/900 ml initial bacterial culture). 15% of glycerol was added to the phage to store at -80°C.
  • PBS Phosphate Buffered Saline
  • the titer of the phage preparation displaying to the library was determined by infecting bacteria (E. coli TG1 strain) with serial dilutions of purified phage and plating out these dilutions on 2xTY-AG agar plates. This titration allowed to determine the number of infectious phage particles (colony forming units (cfu) or transducing units (TU)).
  • E. coli TG1 strain E. coli TG1 strain
  • cfu colony forming units
  • TU transducing units
  • Alphabodies was evaluated in Western Blot analysis using an anti-pil l antibody to determine the presence of wild type pi l l protein and the Alphabody fusion pi ll protein.
  • the molecular weight of the fusion pil l protein is higher than that of the wild type pi l l protein and will thus migrate slower in the SDS-PAGE gel. When fusion protein is present, two bands should be visualized using the anti-pill antibody.
  • scLib_AC12 1.4 x 10 9 2.3 x 10 10 /ml 2 x 10 10 , 14 times library size scLib_ACllb 1.9 x 10 9 3.0 x 10 10 /ml 3.4 x 10 10 , 17 times library size scLib_B10 2.2 x 10 9 1.9 x 10 10 /ml 1.9 x 10 10 , 8 times library size
  • dot blots can be used to evaluate the presence of the fusion protein but additionally can be used to determine the display level (i.e., the average number of fusion protein per phage) in case one wants to assess this feature.
  • Two-fold dilutions of phage are typically spotted in duplicate (one for wild type pill and the other for fusion pill visualization) on nitrocellulose membranes.
  • the wild type pill and fusion pill proteins are visualized using an anti-pill antibody and an anti-His antibody, respectively.
  • Other anti-tag antibodies can be used depending on the tag displayed by the foreign insert (Myc-tag, HA tag, ... ).
  • a secondary antibody conjugated to Alkaline Phosphatase detecting both the anti- plll and anti-His tag antibody allows the colorimetric read-out. Spots of the same intensity in both the wild type pill and the fusion pill detection are determined and the ratio of the two phage concentrations of the spots displaying the same intensity in both detection systems will give the display number of the library. 3. Biopanning of Alphabody libraries against IL-23
  • This strategy was developed to drive the selections towards binders of the p19 subunit of IL-23 by (partially) blocking the p40 subunit with an antibody. This particular antibody was then also used to immobilize IL-23 on solid support for washing purposes.
  • variable concentrations of IL-23 were incubated at twice the concentration of biotinylated anti-IL-23 p40 antibody in 0.1 % BSA in PBS (phosphate buffered saline, pH 7.2) buffer for 1 hr.
  • the concentrations of IL-23 varied as a function of the selection round, in order to modulate the selection stringency so as to obtain more target-specific phage.
  • Five rounds were performed using 200, 100, 50, 25 and 12.5 nM of IL-23, respectively.
  • the concentration of input phage i.e. phage added to the target in each selection round, remained constant and corresponded to 1 E12 phage.
  • IgG- Fc binders In view of the fact that an anti-p40 antibody was used to capture IL-23
  • 20 micromolar of whole IgG was added to the IL-23/anti-p40 antibody/phage mixture.
  • the phage were incubated with the target (anti- p40+IL-23) for 1 hr at room temperature followed by capturing on 0.1 ml streptavidin-coated magnetic Dynabeads (Dynabeads M280 Streptavidin, Invitrogen) for 30 min. Prior to their use, the magnetic beads were washed as recommended by the manufacturer and blocked with 0.1 % BSA in PBS for 1 hr at room temperature on a rotating wheel.
  • Magnetic beads After capturing, the magnetic beads were then washed 10 times with 1 ml of PBS containing 0.1 % of Tween 20 to eliminate non-specific phage. Magnetic beads can be easily washed by using a magnet as known to anyone skilled in the art of biopanning.
  • Target-specific phage were eluted from the beads using 0.2 ml glycine-HCI buffer pH 2 for 5 min., followed by neutralization with 0.05 ml of Tris buffer pH 8. A supplementary fraction was recovered by adding directly mid-log bacteria to the magnetic beads.
  • Ten-fold dilutions (in the range 1 E-7 to 1 E-9) were also prepared from a small sample of the phage used as input in the selection round.
  • These titration results allow the calculation of the yield of the selection round using the formula described earlier.
  • 0.9 ml bacteria were added to the 0.1 ml phage dilutions and incubated for 30 min at 37°C.
  • 0.1 ml of the infection culture is plated on 2xTY-AG agar plates for colony counting and titer determination.
  • the eluted phage were used to infect 20 ml of mid-log phage E. coli TG1 bacteria during 30 min at 37°C. After incubation, a bacterial pellet was obtained by centrifugation at 4000 rpm for 10 min. The pellet was resuspended in 2 ml of 2xTY and plated out on two big 2xTY-AG agar plates (25x25cm).
  • the masterplate 0.020 ml of 80% glycerol was added for storage at -80°C.
  • the masterplate serves to grow individual positive clones and subsequent phage purification for further characterization of their target interaction.
  • 44 clones per selection round from the 4 biopanning campaigns were screened. No clones were screened from the first selection round since the expectations to isolate target-specific clones from this round are low.
  • the set-up of the ELISA was as follows. Neutravidin was immobilized on the plate at a concentration of 0.010 mg/ ml in PBS (0.100 ml) for 1 hour at room temperature (RT). Plates were washed 5 times with PBS containing 0.05% Tween 20 (PBST) for 5 min. Subsequently, 0.1 ml Biotinylated anti-p40 antibody (100 nM) was added to the plates in PBS containing 0.1 % BSA and incubated overnight at 4°C or at RT for 1 hour.
  • PBST room temperature
  • the bacteria plates were centrifuged at 1700 rpm for 10 min to pellet the bacteria. Plates with the immobilized IL-23 were washed 5 times with PBST and 0.050 ml of PBS with 0.2% BSA were added to the plate together with 0.050 ml of the bacterial culture supernatant containing phage. Plates were incubated for 1 to 1.5 hours at room temperature while shaking. Shaking of the plates enhanced the ELISA signals.
  • the plates were washed 5 times with PBST and incubated with an anti- Mi 3 antibody conjugated to HRP diluted 1 :5000 in 2% PBS containing 0.1 % BSA (0.1 ml /well) for 40 min at room temperature while rocking. Plates were washed 5 times and TMB (substrate of HRP) solution (0.1 ml /well) was added and plates were incubated in the dark between 5 to 30 min. The reaction was stopped by adding 0.05 ml 2N H2S04 to each well and the plates were read at 450 nm.
  • Clones were considered positive when the signal on the target was at least 3 times above background.
  • soluble Alphabodies are based on the catabolic repression of the lacZ promoter by using glucose free conditions and the isopropylthio-beta- galactosidase (IPTG) induction of transcription by inactivating the laclq repressor on the bacterial genome.
  • IPTG isopropylthio-beta- galactosidase
  • the gene coding for Alphabody is transcribed and soluble Alphabody is produced. More precisely, bacterial colonies are randomly picked from the titration plates of the selection rounds and grown in 96 well plates in 0.12 ml 2xTY-AG at 30°C, overnight while shaking (180 rpm).
  • the Alphabody sequences were determined for all positive clones binding to IL-23 from the AC12 and AC11 b biopanning campaigns (clones were picked from different biopanning rounds). These sequences were determined by the standard DNA sequencing service of the VIB Genetic Service Facility, University of Antwerp (Belgium) using Sanger sequencing and M13RS sequencing primer. Table 3 shows a multiple alignment of 77 Alphabody sequences resulting from the AC12 library against IL-23.
  • Table 4 shows a multiple alignment of 50 Alphabody sequences resulting from the AC1 1 b library against IL-23.
  • Alphabodies can also be readily made as soluble Alphabodies (i.e., outside the phage format) as described above, and can be subsequently purified by a standard Ni- NTA/SEC procedure as known to anyone skilled in the art of protein purification.
  • the Ni-NTA purification is a straightforward first purification step for the soluble Alphabodies containing a His-tag either at their C-terminal end (as is the case in the Alphabody libraries AC12 and B10) or at their N-terminus as a result of a recloning step wherein a given Alphabody gene is excised from its phage context (by standard molecular biology techniques) and inserted into a suitable expression vector such as e.g.
  • the soluble Alphabodies are subjected to a (kinetic) Biacore analysis or to Friguet (indirect ELISA) analysis (Friguet et al., 1985, J. Immunol. Methods 77:305-319) or to another appropriate method as known to anyone skilled in the art of measuring binding strengths.
  • the cross-reactivity with mouse IL-23 was studied using ELISA assays in which mouse IL- 23 was captured by a mouse anti-p40 antibody in analogy with the human IL-23 strategy.
  • the ELISA assays were performed as previously described and clones were considered positive when their signal on target was at least 2.5 times above the signal on background. It was observed that for the IL-23 positive clones resulting from the AC11 b and AC12 library respectively 34% and 26% of the analyzed clones were cross-reactive with mouse IL-23 (ratio target over background, T/B, > 2.5).
  • the domain specificity of the 127 different clones was also tested on human IL-12.
  • the ELISA was performed as described for IL-23. Human IL-12 was captured on the plate via an anti-human p40 antibody and the ELISA was performed as previously described. The ELISA results showed that 3/50, 5/76 and 0 clones from respectively the AC1 1 b, AC12 and B10 libraries were cross-reactive with human IL-12. For the AC12 library, 4 out of the 5 human IL-12-positive clones also cross-reacted with mouse IL-23.
  • SEQ_ID50 GSIEQIQKAIAKIQETIAFIQKSIYAMTGGSGGSGGGSIEQIQKQIAAIQKQIAAIQKQIYAMTGSGGGGSGGSIEQIQKQITAIAGQIYAILQQIFAMTP
  • SEQ_ID51 G+IE+I+K*IAGIQEWIAPI+KRIYAMTGGSGGSGGG+IEQIQKQIAAIQKQIAAIQK+IYAMTGSGGGGSGGSIEQI+KQISAIIDQI+AIFAQIIAMTP
  • SEQ ID52 GSIEQIQK*IAGIQEWIAPIQKRIYAMTGGSGGSGGGSIEQIQKQIAAIQKQIAAIQKQIYAMTGSGGGGSGGSIEQIQKQISAIIDQIRAIFAQIIAMTP
  • the Alphabody platform technology was used to obtain binders against the Flt3L cytokine and on a soluble form of the ectodomain of Flt3R.
  • Biopanning campaigns were conducted against both human Flt3L (hFlt3L) and soluble human Flt3R ectodomain (hFlt3Re).
  • Recombinant hFlt3L target was produced from E. coli as described in Verstraete et al., Protein J., 2009, 28:57-65.
  • Recombinant hFlt3Re target was produced in mammalian cells as described in Verstraete et al., Acta Cryst F, 201 1 , 67:325-331.
  • Example 1 Essentially the same selection and screening protocols were followed as in Example 1. However, three phage-displayed Alphabody libraries, different from the ones in Example 1 , were used.
  • the Alphabody library sequences are shown in Figure 4.
  • the second library referred to as 'scLib_AC7' or 'AC7', was based on a smaller Alphabody scaffold wherein in each alpha-helix 7 residues (one heptad) were deleted.
  • This library comprised 7 variegated residue positions located in the A- and C-helices ( Figure 4B).
  • Both of the AC1 1 and AC7 libraries are of the type 'groove library' because amino acid variegation is essentially confined to the groove formed by parallel helices A and C.
  • the third library referred to as 'scLib_C9' or 'C9' was again based on the 'long' Alphabody scaffold and comprised 9 variable residues located at solvent-oriented positions in the C-helix ( Figure 4C). In view of the variable surface region being restricted to a single helix, and the variable positions being highly solvent exposed, this library is also referred to as a 'helix surface' library.
  • Biopanning was performed against biotinylated forms of the targets hFlt3L and hFlt3Re.
  • Each of these campaigns consisted of at least 5 selection rounds.
  • 1 E12 phage were incubated for 1 hr at R.T. with 500 nM target in 0.1 % BSA in PBS, followed by capturing on streptavidin-coated magnetic Dynabeads. Capturing and elution protocols were as in Example 1. Contrary to the panning protocol of Example 1 , the target concentration was kept constant over the different rounds. Despite the constant stringency, clear enrichment of phage was seen as of round 3 (R3) for both targets.
  • Output/input phage ratio (O/l ratio) raised by a factor 90 in R3 and a factor 600 in R4 compared to R2 for hFlt3L selections.
  • Round 5 gave no further significant enrichment and this campaign was therefore stopped after R5.
  • the biopanning campaign against hFlt3Re showed slow increases in O/l ratios in consecutive rounds 3 to 5 and therefore the campaign was continued up to round 6. This last round, R6, suddenly gave a steep rise in enrichment, with an O/l ratio 20000 times higher than that of R2.
  • phage clones were randomly picked from rounds 4 and 5 of both campaigns and were further analyzed in standard phage ELISA according to the method described in Example 1.
  • Four 96-well plates were coated with biotinylated hFlt3L or hFlt3Re (two plates each), except 8 wells in each plate that were left empty for the purpose of signal over background calculations.
  • the phage clones selected from the two campaigns were tested both on a positive plate (i.e., coated with the target they were selected against) and on a negative plate (i.e., coated with the other target) for the purpose of checking target specificity.
  • Tables 5a and 5b show the amino acids at each variable position in the Alphabodies selected on hFlt3L and hFlt3Re, respectively. As there were no unintended mutations, only the variable positions are shown. For the hFlt3L and hFlt3Re selected clones, 18 and 19 sequences could be successfully determined, respectively.
  • the hFlt3Re set only comprised 2 unique sequences and was dominated by a single sequence appearing 18 times.
  • the hFlt3Re data set was too small to permit further sequence analysis, but the hFlt3L set showed clear positional preferences. Overall, a full preservation of tryptophan was observed at position 2f (i.e., 2nd heptad, f-position, in the C-helix of Alphabodies from the C9 library). In addition, position 1f showed a strong preference for either arginine or glycine, position 2b a high frequency of aromatic/aliphatic residues, and position 3c a high occurrence of acidic residues aspartic or glutamic acid. Such high degree of sequence conservation may be indicative of a common binding site on the target molecule hFlt3L.
  • the first and second half of the data set in Table 5a also differed at specific positions.
  • a strict conservation of glutamic acid at position 2c was observed in the clones numbered 6-10 and not in 1-5.
  • Clones 7-10 seemed to prefer basic residues (arginine, lysine) at position 3b.
  • Clones 1-5 had exclusively glutamine at position 3f.
  • clones 1-6 showed only non-polar residues at positions 4b and 4c, whereas the others mainly had polar residues. This situation may be indicative of a common binding region on hFlt3L albeit with different Alphabody binding modes in the complex.
  • Two his-tagged variants of the Alphabody sequence corresponding to #4 in Table 5a were recombinantly produced in E. coli. Synthetic genes for these constructs were subcloned into the pET16b vector (Novagen) in frame with the N-terminal 10-His tag between the Ndel and BamHI sites.
  • the first variant herein denoted 'hFlt3L_cl4' and further provided as SEQ ID No: 134, consisted of the native sequence as identified for phage clone #4 of Example 2, N-terminally appended with the 10-His tag sequence of the vector.
  • the second variant herein denoted 'hFlt3L_cl4m' and further provided as SEQ ID No: 135, consisted of basically the same sequence but with shortened linkers between the alpha-helices and comprising two lysine to serine mutations in both the A- and B-helices of the Alphabody.
  • the full amino acid sequences of hFlt3L_cl4 (SEQ ID No: 134) and hFlt3L_cl4m (SEQ ID No: 135) are aligned Figure 5.
  • the gene constructs were transformed into host E. coli cells (BL21 (DE3)-strain) harboring a chromosomal copy of the T7 polymerase gene under control of the lacUV5 promoter (DE3 lysogens).
  • the cells were grown in standard Luria-Bertani medium (10 I) at 37 °C, in the presence of carbenicillin (0.1 mg/ml).
  • carbenicillin 0.1 mg/ml
  • protein expression was induced by the addition of 1 mM isopropyl ⁇ -D-l-thiogalactopyranoside (IPTG).
  • IPTG isopropyl ⁇ -D-l-thiogalactopyranoside
  • the cell pellet was resuspended in 20 mM Tris, 100 mM NaCI, pH 7.5. Next, the cell suspension was subjected to sonication. The insoluble fraction was isolated by centrifugation (20000 g, 20 min, 4 °C) and washed with buffer containing 1 % Triton X-100. This wash step was repeated once. Insoluble proteins were solubilized in 50 mM NaH 2 P0 4 , 300 mM NaCI, 4 M guanidinium hydrochloride, pH 8.0 and incubated on a rotatory-shaker for 2 hours at R.T. Cells debris and other unsolubilized material was removed by centrifugation (1 h, 100000 g, 4 °C).
  • the supernatant was filtered through a 0.22 ⁇ - ⁇ and loaded onto a prepacked Ni Sepharose Fast Flow column (10 ml_) (GE Healthcare) connected to an AKTA- system and equilibrated with 50 mM NaH 2 P0 4 , 300 mM NaCI, 4 M guanidinium hydrochloride, pH 8.0. After loading the sample, the column was washed with equilibration buffer. Next, the running buffer was exchanged for 50 mM NaH 2 P0 4 , 300 mM NaCI, pH 8.0. Bound protein was eluted using a stepwise gradient with imidazole (with 500 mM as the final concentration).
  • Elution fractions corresponding to the Alphabody were pooled and desalted into trypsin digestion buffer (20 mM Tris, 50 mM Tris, pH 8.0). To remove the N-terminal His-tag, the protein solution was incubated with TPCK-trypsin immobilized on magnetic beads (Clontech) on a rotary shaker for two hours at 37 °C. Next, the magnetic beads were removed by low-speed centrifugation (500 g) and the protein solution was filtered through a 0.22 ⁇ -filter and loaded onto a prepacked Ni Sepharose Fast Flow column. Non-bound protein was collected and concentrated by ultracentrifugation using concentrators with a pore size of 5 kDa.
  • the Alphabody was injected onto a Superdex 75 column (GE Healthcare) connected to an AKTA- system and equilibrated with 20 mM Tris, 150 mM NaCI, pH 7.4. Fractions corresponding to the Alphabody were stored at -80 °C.
  • the binding of Alphabody hFlt3L_cl4 to the target hFlt3L was tested by isothermal titration calorimetry (ITC) in order to determine its dissociation constant (K D ), thermodynamic parameters ( ⁇ , AS) and binding stoichiometry.
  • ITC isothermal titration calorimetry
  • K D dissociation constant
  • ⁇ , AS thermodynamic parameters
  • binding stoichiometry Prior to the measurements, Alphabody and target samples were dialyzed against 20 mM HEPES buffer containing 150 mM NaCI, pH 7.4. The ITC measurements were performed in triplicate at a temperature of 37 °C.
  • thermograms showed a binding stoichiometry (n) of 0.88 ⁇ 0.10. This implies that, since the concentrations of hFlt3L were given for the dimeric complex (hFlt3L) 2 , only one hFlt3L_cl4 Alphabody binds to one hFlt3L dimer.
  • steps were undertaken to crystallize complexes and to determine their 3-D structure by X-ray crystallography.
  • hFlt3L_cl4m:hFlt3L complexes were formed by incubating purified recombinant hFlt3L (Verstraete et al., Protein J, 2009) with a molar excess of Alphabody.
  • the complex was separated from excess Alphabody by gel filtration using a Superdex 75 column equilibrated with 20 mM Tris, 150 mM NaCI, pH 7.4. Fractions corresponding to the complex were pooled and concentrated using a Vivaspin concentrator to a final concentration of 8 mg/ml.
  • the concentrated protein solution was aliquoted and flash frozen into liquid nitrogen and subsequently stored at -80 °C.
  • Crystallization drops were set up at both 277 K and 293 K in 96-well sitting-drop crystallization plates by mixing 100 nl of reservoir solution (45 nl) with 100 nl of protein solution at a concentration of 8 mg/ml. Crystals of the hFlt3L_cl4m:hFlt3L complex suitable for X-ray diffraction experiments appeared overnight in several conditions of the PEG ION 2 screen (Hampton Research) at 277 K.
  • Crystallization of the hFlt3L_cl4m:hFlt3L complex was confirmed by running a silver-stained SDS-PAGE gel of washed crystals. Crystals were then transferred to a drop of mother liquor (5 ⁇ ) with the use of a nylon loop (Hampton Research) mounted onto SPINE standard cryocaps (Molecular Dimensions). The concentration of cryoprotectant (PEG 400) was gradually adjusted by adding increasing amounts of mother liquor containing a higher concentration of cryoprotectant to the drop until the desired concentration of cryoprotectant (20%) was reached. A 3-minute equilibration time was allowed between subsequent additions. Subsequently, the crystals were flash-frozen into liquid nitrogen and loaded into SPINE/ESRF pucks for storage and transport.
  • the structure was solved using molecular replacement as implemented in Phaser (McCoy et al., 2007) using the high resolution structure of hFlt3L (pdb entry code 1 ETE, Savvides et al., 2000) as a search model.
  • the resulting maps showed clear 2FO-FC and positive FO-FC difference density for the hFlt3L_cl4m Alphabody.
  • Model (re)building was carried out manually in Coot (Emsley et al., Acta Cryst D, 2010). Crystallographic refinement was carried out in PHENIX (Adams et al., 2010).
  • Figure 7 shows a ribbon representation of the 3-D structure of the hFlt3L_cl4m:hFlt3L complex. It was observed that one Alphabody molecule binds to one hFlt3L dimer, in agreement with the stoichiometric data obtained previously by ITC.
  • the binding or 'interface' residues on the Alphabody defined as those amino acid residues having at least one side-chain atom within 4 A from the hFlt3L structure, included all residues located at positions that were randomized in the original Alphabody library (i.e., all x-positions shown in Figure 4C or all positions shown in Table 5a, see EXAMPLE 2).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pulmonology (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Urology & Nephrology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • AIDS & HIV (AREA)
  • Transplantation (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/EP2012/050193 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors Ceased WO2012093172A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP12702771.2A EP2661447B1 (en) 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors
AU2012204846A AU2012204846B2 (en) 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors
JP2013547867A JP2014504869A (ja) 2011-01-06 2012-01-06 サイトカインもしくは成長因子および/またはサイトカイン受容体もしくは成長因子受容体に特異的に結合するアルファボディー
DK12702771.2T DK2661447T3 (en) 2011-01-06 2012-01-06 Alphabodies that specifically bind to cytokines or growth factors and / or cytokine or growth factor receptors
IN1394MUN2013 IN2013MN01394A (https=) 2011-01-06 2012-01-06
US13/994,107 US20140057830A1 (en) 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors
BR112013017367A BR112013017367A2 (pt) 2011-01-06 2012-01-06 polipeptídeo de alfacarpo, sequência de ácido nucléico, composição farmacêutica e método para a produção de pelo menos um polipeptídeo de alfacorpo
CN2012800046860A CN103339148A (zh) 2011-01-06 2012-01-06 特异性结合细胞因子或生长因子和/或细胞因子或生长因子受体的alphabody
CA2821646A CA2821646A1 (en) 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EPPCT/EP2011/050138 2011-01-06
EP2011050138 2011-01-06

Publications (1)

Publication Number Publication Date
WO2012093172A1 true WO2012093172A1 (en) 2012-07-12

Family

ID=44242740

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/050193 Ceased WO2012093172A1 (en) 2011-01-06 2012-01-06 Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors

Country Status (9)

Country Link
US (1) US20140057830A1 (https=)
JP (1) JP2014504869A (https=)
CN (1) CN103339148A (https=)
AU (1) AU2012204846B2 (https=)
BR (1) BR112013017367A2 (https=)
CA (1) CA2821646A1 (https=)
DK (1) DK2661447T3 (https=)
IN (1) IN2013MN01394A (https=)
WO (1) WO2012093172A1 (https=)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013102659A2 (en) 2012-01-06 2013-07-11 Complix Nv Binding agents to intracellular target molecules
WO2014064080A1 (en) 2012-10-22 2014-05-01 Complix Nv Polypeptides specifically binding to il-23
US9334332B2 (en) 2012-07-25 2016-05-10 Kolltan Pharmaceuticals, Inc. Anti-kit antibodies
US9540443B2 (en) 2011-01-26 2017-01-10 Kolltan Pharmaceuticals, Inc. Anti-kit antibodies
WO2017102835A1 (en) * 2015-12-14 2017-06-22 Complix Nv Binding molecule comprising an alphabody-polypeptide and an antibody
US10023647B2 (en) 2012-10-22 2018-07-17 Complix Nv Polypeptides capable of cellular internalization
US10239943B2 (en) 2014-05-23 2019-03-26 Celldex Therapeutics, Inc. Treatment of eosinophil or mast cell related disorders
US12180290B2 (en) 2020-10-19 2024-12-31 Zoetis Services Llc Antibodies to canine and feline oncostatin M receptor beta and uses thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113315431B (zh) * 2021-04-22 2023-07-28 湖南工业大学 基于等价输入干扰系统的pmsm失磁故障控制方法、电机
CN114544812B (zh) * 2022-02-18 2023-06-30 复旦大学附属中山医院 一种代谢组合式标志物在诊断哮喘中的应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2161278A1 (en) 2008-09-08 2010-03-10 Complix N.V. Single-chain coiled coil scaffold
WO2010066740A1 (en) 2008-12-08 2010-06-17 Complix Nv Single-chain antiparallel coiled coil proteins

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101323643B (zh) * 2007-06-15 2010-12-01 烟台荣昌生物工程有限公司 优化的TACI-Fc融合蛋白
WO2012092970A1 (en) * 2011-01-06 2012-07-12 Complix Nv Alphabody libraries and methods for producing the same

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2161278A1 (en) 2008-09-08 2010-03-10 Complix N.V. Single-chain coiled coil scaffold
WO2010066740A1 (en) 2008-12-08 2010-06-17 Complix Nv Single-chain antiparallel coiled coil proteins

Non-Patent Citations (36)

* Cited by examiner, † Cited by third party
Title
BRATKOVIC, CELL MOL LIFE SCI, vol. 67, 2010, pages 749 - 767
BRENTANO ET AL., ANN RHEUM DIS, vol. 68, 2008, pages 143 - 150
BROWN ET AL., PROTEINS, vol. 26, 1996, pages 134 - 145
COHEN; PARRY, PROTEINS, vol. 7, 1990, pages 1 - 15
FRIGUET ET AL., J. IMMUNOL. METHODS, vol. 77, 1985, pages 305 - 319
GEORGIOU ET AL., NAT BIOTECHNOL, vol. 15, 1997, pages 29 - 34
HANNUM ET AL., NATURE, vol. 368, 1994, pages 643 - 648
HARBURY ET AL., SCIENCE, vol. 282, 1998, pages 1462 - 1467
KAY ET AL.: "Phage Display of Peptides and Proteins. A Laboratory Manual", 1996
KOHN; HODGES, TRENDS BIOTECHNOL, vol. 16, 1998, pages 379 - 389
LEVIN; WEISS, MOL BIOSYST, vol. 2, 2006, pages 49 - 57
LIPOVSEK; PLUCKTHUN, J IMMUNOL METHODS, vol. 290, 2004, pages 51 - 67
LUPAS ET AL., SCIENCE, vol. 252, 1991, pages 1162 - 1164
LUPAS ET AL., SCIENCE, vol. 252, 1991, pages 1162 - 1164, Retrieved from the Internet <URL:http://www.russell.embl-heidelberg.de/cgi-bin/coils-svr.pl>
LUPAS; GRUBER, ADV PROTEIN CHEM, vol. 70, 2005, pages 37 - 78
LYMAN ET AL., BLOOD, vol. 83, 1994, pages 2795 - 2801
LYMAN ET AL., CELL, vol. 75, 1993, pages 1157 - 1167
MASON; ARNDT, CHEMBIOCHEM, vol. 5, 2004, pages 170 - 176
MATTHEWS ET AL., CELL, vol. 65, 1991, pages 1143 - 1152
MCFARLANE ET AL., EUR J PHARMACOL, vol. 625, 2009, pages 101 - 107
O. PILOTO ET AL.: "IMC-EB10, an anti-FLT3 monoclonal antibody, prolongs survival and reduces nonobese diabetic/severe combined immunodeficient engraftment of some acute lymphoblastic leukemia cell lines and primary leukemic samples.", CANCER RESEARCH, vol. 66, no. 9, 1 May 2006 (2006-05-01), U.S.A., pages 4843 - 4851, XP002548251 *
PARRY ET AL., J STRUCT BIOL, vol. 163, 2008, pages 258 - 269
REIERSEN ET AL., NUCL ACIDS RES, vol. 33, 2005, pages E10
ROSNET ET AL., BLOOD, vol. 82, 1993, pages 1110 - 1119
ROSNET ET AL., ONCOGENE, vol. 6, 1991, pages 1641 - 1650
SCHNEIDER ET AL., FOLD DES, vol. 3, 1998, pages R29 - R40
SCOTT; SMITH, SCIENCE, vol. 249, 1990, pages 386 - 390
SMALL ET AL., PNAS, vol. 91, 1994, pages 459 - 463
VERSTRAETE ET AL., ACTA CRYST F, vol. 67, 2011, pages 325 - 331
VERSTRAETE ET AL., PROTEIN J, 2009
VERSTRAETE ET AL., PROTEIN J., vol. 28, 2009, pages 57 - 65
WALSHAW; WOOLFSON, J MOL BIOI, vol. 307, 2001, pages 1427 - 1450
WITTRUP, CURR OPIN BIOTECHNOL, vol. 12, 2001, pages 395 - 399
WOOLFSON, ADV PROTEIN CHEM, vol. 70, 2005, pages 79 - 112
WRIGHT ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 181, 2008, pages 2799 - 2805
Y. CHEN ET AL.: "Anti-IL-23 therapy inhibits multiple inflammatory pathways and ameliorates autoimmune encephalomyelitis.", THE JOURNAL OF CLINICAL INVESTIGATION, vol. 116, no. 5, May 2006 (2006-05-01), U.S.A., pages 1317 - 1326, XP002583205 *

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10793639B2 (en) 2011-01-26 2020-10-06 Celldex Therapeutics, Inc. Methods of treating by administering anti-kit antibodies
US10189907B2 (en) 2011-01-26 2019-01-29 Celldex Therapeutics, Inc. Polynucleotides encoding anti-KIT antibodies
US9540443B2 (en) 2011-01-26 2017-01-10 Kolltan Pharmaceuticals, Inc. Anti-kit antibodies
US11884699B2 (en) 2011-01-26 2024-01-30 Celldex Therapeutics, Inc. Anti-KIT antibodies and uses thereof
US20140363434A1 (en) * 2012-01-06 2014-12-11 Complix Nv Binding agents to intracellular target molecules
WO2013102659A2 (en) 2012-01-06 2013-07-11 Complix Nv Binding agents to intracellular target molecules
US11891452B2 (en) 2012-07-25 2024-02-06 Celldex Therapeutics, Inc. Anti-kit antibodies and uses thereof
US9334332B2 (en) 2012-07-25 2016-05-10 Kolltan Pharmaceuticals, Inc. Anti-kit antibodies
US9605081B2 (en) 2012-07-25 2017-03-28 Celldex Therapeutics, Inc. Polynucleotides encoding anti-kit antibodies
US10781267B2 (en) 2012-07-25 2020-09-22 Celldex Therapeutics, Inc. Methods of treating by administering anti-kit antibodies
US10184007B2 (en) 2012-07-25 2019-01-22 Celldex Therapeutics, Inc. Methods of treating a kit-associated cancer by administering anti-kit antibodies
WO2014064080A1 (en) 2012-10-22 2014-05-01 Complix Nv Polypeptides specifically binding to il-23
US9701717B2 (en) 2012-10-22 2017-07-11 Complix Nv Polypeptides specifically binding to IL-23
US10023647B2 (en) 2012-10-22 2018-07-17 Complix Nv Polypeptides capable of cellular internalization
JP2016506361A (ja) * 2012-10-22 2016-03-03 コンプリクス エン ヴェー Il−23に特異的に結合するポリペプチド
US10239943B2 (en) 2014-05-23 2019-03-26 Celldex Therapeutics, Inc. Treatment of eosinophil or mast cell related disorders
US10774146B2 (en) 2014-05-23 2020-09-15 Celldex Therapeutics, Inc. Treatment of eosinophil or mast cell related disorders
US11987626B2 (en) 2014-05-23 2024-05-21 Celldex Therapeutics, Inc. Treatment of eosinophil or mast cell related disorders
WO2017102835A1 (en) * 2015-12-14 2017-06-22 Complix Nv Binding molecule comprising an alphabody-polypeptide and an antibody
US12180290B2 (en) 2020-10-19 2024-12-31 Zoetis Services Llc Antibodies to canine and feline oncostatin M receptor beta and uses thereof

Also Published As

Publication number Publication date
CA2821646A1 (en) 2012-07-12
IN2013MN01394A (https=) 2015-06-12
DK2661447T3 (en) 2015-11-02
AU2012204846A1 (en) 2013-07-04
CN103339148A (zh) 2013-10-02
US20140057830A1 (en) 2014-02-27
BR112013017367A2 (pt) 2016-11-22
JP2014504869A (ja) 2014-02-27
AU2012204846B2 (en) 2016-09-08

Similar Documents

Publication Publication Date Title
AU2012204846B2 (en) Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors
US10087249B2 (en) Alphabody libraries and methods for producing the same
US9605027B2 (en) Polypeptides that bound to IL-23 receptor and inhibit binding of IL-23 and cell signaling thereof
RU2723034C2 (ru) Новые полипептиды со специфическим связыванием и пути их применения
JP2019501885A (ja) 多特異性抗体
JP2019501887A (ja) 多特異性抗体
KR20160015220A (ko) 특이적 결합 분자의 합성 라이브러리
WO2008124858A2 (en) Targeted receptor
JP2019507104A (ja) 二重特異性抗体を用いる方法
TW200902064A (en) Methods and compositions for modulating IL-17F/IL-17A biological activity
Finch et al. Whole-molecule antibody engineering: generation of a high-affinity anti-IL-6 antibody with extended pharmacokinetics
AU2006268111A1 (en) Il-6 binding proteins
US11248036B2 (en) Mutant tumor necrosis factor receptor superfamily (TNFsfR) ligands and methods of making and using same
EP2661447B1 (en) Alphabodies specifically binding to cytokines or growth factors and/or cytokine or growth factor receptors
CN102660551B (zh) 来源于抗CypA骆驼科动物的重链VHH抗体基因、编码多肽及其应用
KR101510831B1 (ko) 항 il-6r 및 tnfr2을 포함하는 이중특이적 단백질을 발현하는 미니서클 벡터를 포함하는 줄기세포 치료제
USRE49026E1 (en) Polypeptides that bound to IL-23 receptor and inhibit binding of IL-23 and cell signaling thereof
Warren Single-chain RANKL Provides Insights into RANK Receptor Oligomerization and a Novel Approach to Osteoclast Inhibition

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12702771

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2821646

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 13994107

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2012204846

Country of ref document: AU

Date of ref document: 20120106

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013547867

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2012702771

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013017367

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013017367

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130705