WO2012045776A1 - Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations - Google Patents

Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations Download PDF

Info

Publication number
WO2012045776A1
WO2012045776A1 PCT/EP2011/067390 EP2011067390W WO2012045776A1 WO 2012045776 A1 WO2012045776 A1 WO 2012045776A1 EP 2011067390 W EP2011067390 W EP 2011067390W WO 2012045776 A1 WO2012045776 A1 WO 2012045776A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
identity
seq
polynucleotide
amino acid
Prior art date
Application number
PCT/EP2011/067390
Other languages
English (en)
Inventor
Frédéric Ducancel
Didier Boquet
Jean-Yves Couraud
Anne Wijkhuisen
Bertrand Allard
Original Assignee
Commissariat A L'energie Atomique Et Aux Energies Alternatives
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Commissariat A L'energie Atomique Et Aux Energies Alternatives filed Critical Commissariat A L'energie Atomique Et Aux Energies Alternatives
Publication of WO2012045776A1 publication Critical patent/WO2012045776A1/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2869—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/12—Drugs for disorders of the urinary system of the kidneys
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053—Skin, nerves, brain
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention belongs to the technical field of antibodies, their therapeutic and diagnostic use as well as their use as a research tool.
  • the present invention provides an antibody, advantageously monoclonal, specific for the native and functional conformation of endothelin receptor subtype B and in particular human endothelin receptors, said antibody being capable of blocking the pharmacological properties of such receptors.
  • the present invention also relates to the use of this antibody for therapeutic and diagnostic purposes as well as for research purposes.
  • the endothelin receptors (designated ET1, ET2 and ET3 in humans) belong to the family of receptors with 7 transmembrane domains also called GPCRs for "G-protein Coupled Receptors". Endothelin receptors have two main subtypes in humans: subtype A (ETA-R) and subtype B (ETB-R).
  • ETA-R subtype A
  • ETB-R subtype B
  • the endothelin axis and its receptors is involved in several pathophysiological functions and dysfunctions. As non-limiting examples, mention may be made of arterial hypertension, atherosclerosis, coronary heart disease, renal dysfunction, cerebrovascular diseases, Crohn's disease, pulmonary fibrosis, asthma, etc. (See R. Shah's review, 2007, “Endothelins in Health and Disease", Eur J. Int.Med., vol 18, pages 272-282).
  • endothelin receptors have also been shown to be associated with the development of many cancers, promoting the proliferation, survival and dissemination of cancer cells as well as angiogenesis (Bagnato & Rosano, 2008, "The endothelin axis in cancer J. of Biochem. & Cell Biology, Vol 40, pp. 1443-1451). Concerning the endothelin receptor subtype B, the endothelin receptor exhibits a modification of its level of expression, particularly in melanoma, colon cancer, Kaposi's sarcoma, glioblastoma (brain tumors), and in cases of bladder cancer.
  • endothelin receptor subtype B is involved in the lack of recognition of certain cancer cells, especially ovarian cancer cells by the immune system, by inducing a strong reduction in infiltration.
  • lymphocyte Bactanovich et al., 2008, "Endothelin B receptor mediates the endothelial barrier to T cell homing to tumors and immune disables therapy ", Nature Medicine, vol. 14, pp. 28-36).
  • Isolation of anti-endothelin receptor monoclonal antibodies for use in receptor characterization discloses the binding properties of 4 monoclonal antibodies (A2, G9, E7 and G10) to solubilized endothelin receptor complexes present on the membrane surface. lungs of rats.
  • the G9 and G10 antibodies are immunoglobulins of type G and isotype 2a (IgG2a), whereas antibodies A2 and E7 are IgG1 immunoglobulins. If these four antibodies are specific for endothelin-solubilized receptors, the article by Kondoh et al. provides no information as to the specificity of these antibodies (ETA-R and / or ETB-R), as to the recognition of receptors of human origin, or as to any possible antagonistic property.
  • Patent Application JP 2008280266 in the name of Seikisui Chemical Co Ltd and published November 20, 2008 relates to a monoclonal antibody called ha21. It is a mouse immunoglobulin of IgG2a / kappa isotype, which is exclusively specific for the human endothelin receptor subtype A, and which does not recognize murine or rat receptors.
  • the inventors have therefore set themselves the goal of obtaining antibodies capable of specifically recognizing the subtype B of the endothelin receptor, having effective antagonist properties rendering them useful both in the therapeutic and diagnostic fields.
  • the present invention makes it possible to solve the technical problems as previously defined and to achieve the goal that the inventors have set themselves.
  • This strategy consists, first of all, of carrying out several gene immunizations by injection into the tibial muscle of plasmid DNA mice containing the DNA encoding ETB-R. These injections are systematically followed by in vivo electroporation. After 3 gene immunizations, a first boost of immunization by injection of higher eukaryotic cells, overexpressing ETB-R in its functional form was performed.
  • ETB-R expressed on the surface of the cells used for immunization boosting was verified by various endothelin-1 binding experiments labeled radioactive or fluorescently.
  • This strategy coupled with a procedure for screening hybridomas with ELISA-cell followed by flow cytometry, favors the production of specific monoclonal antibodies of ETB-R in its native conformation.
  • This approach also has the advantage of not needing the extracted and purified interest receptor, which is still a difficult challenge today.
  • Rendomab-B1 a monoclonal antibody antagonist of the pharmacological properties of the endothelin receptor subtype B and in particular of the human subtype B, hereinafter referred to as Rendomab-B1.
  • Rendomab-B1 a monoclonal antibody antagonist of the pharmacological properties of the endothelin receptor subtype B and in particular of the human subtype B, hereinafter referred to as Rendomab-B1.
  • the antibody which is the subject of the present invention is a 10-fold antagonist. more effective (see paragraph III below).
  • the interest is also related to the fact that the antibody according to the present invention is capable, via its Fc domain, of recruiting different cellular effectors such as NK lymphocytes (for "Natural” Killers "), and thus to induce lysis of targeted cells (ADCC), or molecular as the complement.
  • NK lymphocytes for "Natural” Killers "
  • ADCC targeted cells
  • the labeling of the antibody with a radionuclide such as yttrium-90 is also conceivable, as well as its use in imaging in a smaller recombinant form such as a fragment as defined below.
  • the present invention relates to an endothelin receptor subtype B antagonist antibody, a fragment or derivative thereof. this.
  • antibody and “immunoglobulin” are equivalent and may be used interchangeably in the present invention.
  • An antibody is a glycoprotein comprising at least two heavy chains (H) and at least two light chains (L) interconnected by one or more disulfide bridges.
  • Each heavy chain comprises a variable region (or domain) (VH) and a constant region comprising 3 domains, usually designated CH1, CH2 and CH3.
  • Each light chain comprises a variable region (or domain) (VL) and a constant region comprising a single domain, usually designated CL.
  • the variable regions of the heavy and light chains involved in antigen recognition can be further subdivided into 3 hypervariable regions, also called complementarity determining regions (CDRs), framed by 4 more conserved regions, also called framework regions (FR).
  • CDRs complementarity determining regions
  • each heavy chain (or light chain) variable region is, from the N-terminus to the C-terminus, as follows: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the definition of the CDRs and FRs which has been used is that of the IMGT (the international ImMunoGeneTics database http: // imgt.cines.en: 8104). The calculations of the percentages of identity of the CDR sequences mentioned and claimed hereafter are therefore to be taken into account on the basis of this annotation.
  • antibody includes, in the context of the present invention, not only complete antibody molecules but also fragments and derivatives thereof.
  • antibody fragment is meant, in the context of the present invention, both a monovalent fragment that has a single antigen-binding site and a divalent fragment that has two antigen-combining sites. .
  • a fragment according to the invention has at least one antigen binding site.
  • These fragments include Fab, F (ab ') 2 f Fv, and other fragments which retain the antigen binding site (scFv and diabody).
  • An Fab fragment is a monovalent fragment consisting of the entire light chain and a portion of the heavy chain (Fd) comprising the VH and CH1 domains as previously defined.
  • An F (ab ') 2 fragment is a divalent fragment corresponding to the association of two Fab fragments connected by the disulfide bridges present at the level of the hinge region of immunoglobulins ("Hinge") located between the constant domains CH1 and CH2.
  • a Fv fragment is a monovalent fragment consisting only of the variable regions VL and VH of the light and heavy chains of an antibody.
  • An scFv fragment is a monovalent polypeptide fragment, obtained only by genetic engineering, corresponding to the variable domains linked by a peptide bond.
  • a diabody is a recombinant and divalent antibody molecule consisting of two scFv molecules upside down because of a peptide link that is too short to allow the formation of scFv.
  • the fragments according to the invention also cover the fragments as mentioned above, the half-life of which has been increased by chemical modification, in particular by incorporation into a liposome or by the introduction of a poly (alkylene) glycol such as a polyethylene.
  • a poly (alkylene) glycol such as a polyethylene.
  • glycol (PEG) this technique being called “PEGylation” and giving fragments such as Fab-PEG, F (ab ') 2 -PEG or Fv-PEG.
  • antibody derivative is meant, in the context of the present invention, genetically engineered antibody fragments such as single chain Fv (scFv) molecules and antibodies. single domain (dAb).
  • scFv single chain Fv
  • dAb single domain
  • the term also includes antibody-like molecules that can be produced using phage display techniques or other random selection techniques for molecules that bind to receptor subtype B. endothelins or specific regions of this subtype.
  • the "antibody fragments” and “antibody derivatives” cover all the molecules that contain a structure, advantageously peptide, which is part of the recognition site (that is to say the part of the antibody which binds to or combines with the epitope or antigen) of an antibody according to the present invention.
  • the fragments and antibody derivatives according to the present invention show an antagonistic activity towards the endothelin receptor subtype B.
  • an antibody antagonist of the pharmacological properties of the subtype B endothelin receptors More particularly, such an antibody is capable of decreasing, inhibiting or blocking one or more biological activity (s) of ETB-R.
  • An antibody, fragment or derivative thereof, antagonist can act:
  • ETB - R down - regulation
  • ETB - R internalization of ETB - R
  • down - regulation internalization which results in a sharp decrease, or even a disappearance of ETB - R of the surface of the targeted cells, such an effect, causing the arrest effects induced by endothelin binding to ETB-R, including the effects responsible for the proliferation of cancer cells.
  • the antibodies according to the present invention cover antibodies which bind to ETB-R, which directly or indirectly interfere with the formation of the ETB-R / endothelin complex such as ET1, ET2 or ET3.
  • the antibody can reduce, inhibit or block, include proliferation, survival and / or dissemination of cells including cancer; the release of nitric oxide (NO); Angiogenesis; release of prostacyclin, VEGF (vascular endothelial growth factor) or MMP (metalloproteinases); prevention of apoptosis; vasodilatation and / or vasoconstriction.
  • the antibody of the present invention is also likely to raise, at least partially, the lack of lymphocyte infiltration by the immune system at the level of the cancer cells.
  • the present invention relates to an endothelin receptor subtype B antagonist antibody having at least one heavy chain variable region comprising a CDR3 (hereinafter referred to as CDR3 H ) having at least 80% identity with the amino acid sequence. following: ARNYDGYFDFW (SEQ ID NO: 2).
  • amino acid sequences are given in accordance with the international 1-letter code.
  • the antibody according to the present invention has at least one heavy chain variable region including CDR1 (hereinafter designated CDR1 H), CDR2 (hereinafter CDR2 H) and CDR3 have at least 80% identity with the following amino acid sequences:
  • IWTGGDT (SEQ ID NO: 6);
  • the CDR1 of the heavy chain variable region of the antibody according to the invention has at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following amino acid sequence: GFSLTTYA (SEQ ID NO: 4).
  • CDR2 of the heavy chain variable region of the antibody according to the invention has at least 80% identity and may have at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following amino acid sequence: IWTGGDT (SEQ ID NO: 6).
  • CDR3 of the heavy chain variable region of the antibody according to the invention has at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following amino acid sequence: RNAYDGYFDFW (SEQ ID NO: 2).
  • the antibody according to the invention has at least one heavy chain variable region comprising a CDR1 (CDR1 H ), a CDR2 (CDR2 H ) and a CDR3 (CDR3 H ) respectively presenting the following amino acid sequences:
  • IWTGGDT (SEQ ID NO: 6);
  • the antibody according to the invention comprises a heavy chain variable region whose amino acid sequence exhibiting at least 80% identity with the following sequence: ## EQU1 ##
  • the antibody according to the invention comprises a heavy chain variable region whose amino acid sequence has at least 80% identity and can have at least 85% identity, at least 90% identity, at least 50% identity. minus 95% identity and / or at least 98% identity with the amino acid sequence SEQ ID NO: 8.
  • the antibody according to the invention comprises a heavy chain variable region whose amino acid sequence corresponds to the amino acid sequence SEQ ID NO: 8.
  • the antibody according to the present invention has at least one light chain variable region whose CDR1 (hereinafter designated CDR1 L ) has at least 80% identity with the sequence as follows: QNLLYSGNQKTY (SEQ ID NO: 10).
  • the antibody according to the present invention has at least one light chain variable region including CDR1 (hereinafter designated CDR1 L ), CDR2 (hereinafter designated CDR2 L ) and CDR3 (hereinafter designated CDR3 L). ) respectively have at least 80% identity with the following amino acid sequences:
  • CDR2 of the light chain variable region of the antibody according to the invention has at least 80% identity and can have at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following amino acid sequence: WAS (SEQ ID NO: 12).
  • CDR3 L has at least 80% identity and can have at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following amino acid sequence: QQYFIYPRT (SEQ ID NO: 14).
  • the antibody according to the invention has at least one light chain variable region of which CDR1 (CDR1 L ), CDR2 (CDR2 L ) and CDR3 (CDR3 L ) respectively have the following amino acid sequences:
  • the antibody according to the invention comprises a variable light chain region whose amino acid sequence has at least 80% identity with the following amino acid sequence:
  • the antibody according to the invention comprises a light chain variable region whose amino acid sequence has at least 80% identity and can have at least 85% identity, at least 90% identity, at least 50% identity. minus 95% identity and / or at least 98% identity with the amino acid sequence SEQ ID NO: 16.
  • the antibody according to the invention comprises a light chain variable region whose amino acid sequence corresponds to the amino acid sequence SEQ ID NO: 16.
  • the antibody according to the invention has a light chain variable region and a heavy chain variable region as previously defined.
  • the antibody according to the invention has at least one heavy chain variable region comprising a CDR 3 H , a CDR 2 H and a CDR 1 H as defined above and at least one light chain variable region comprising a CDR 1 L , a CDR 2 L and a CDR3 L as previously defined.
  • the light chain of the antibody according to the invention is typically a kappa light chain.
  • the heavy chain of the antibody according to the invention is especially a gamma heavy chain 2b
  • the antibody according to the present invention is a type G immunoglobulin.
  • the antibody according to the present invention is an immunoglobulin of IgG2b / kappa type.
  • the antibody according to the invention has:
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined and at least one light chain variable region comprising a CDR1 L as defined above; at least one heavy chain variable region comprising a CDR 3 H and a CDR 1 H as previously defined and at least one light chain variable region comprising a CDR 2 L as defined above;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR2 L as defined above;
  • At least one heavy chain variable region comprising a CDR 3 H , a CDR 2 H and a CDR 1 H as previously defined and at least one light chain variable region comprising a CDR 1 L as defined above;
  • At least one heavy chain variable region comprising a CDR 3 H , a CDR 2 H and a CDR 1 H as previously defined and at least one light chain variable region comprising a CDR 2 L as defined above;
  • At least one heavy chain variable region comprising a CDR3 H , a CDR2 H and a CDR1 H as defined above and at least one light chain variable region comprising a CDR1 L and a CDR2 L as previously defined; at least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR3 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined and at least one light chain variable region comprising a CDR3 L as defined above;
  • At least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR3 L and a CDR1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined and at least one light chain variable region comprising a CDR3 L and a CDR1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR3 L as defined above;
  • At least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR3 L and a CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as defined above and at least one variable chain region light comprising CDR3 L and CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H , a CDR1 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR3 L as defined above;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR3 L and a CDR1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR 3 H , a CDR 1 H and a CDR 2 H as defined above and at least one light chain variable region comprising a CDR 3 L and a CDR 1 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined and at least one light chain variable region comprising a CDR3 L and a CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H as defined above and at least one light chain variable region comprising a CDR3 L and a CDR1 L and a CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR1 H as previously defined and at least one variable chain region light comprising CDR3 L and CDR1 L and CDR2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR 3 H , a CDR 2 H and a CDR 1 H as defined above and at least one light chain variable region comprising a CDR 3 L and a CDR 2 L as previously defined;
  • At least one heavy chain variable region comprising a CDR3 H and a CDR2 H as previously defined and at least one light chain variable region comprising a CDR3 L and a CDR1 L and a CDR2 L as previously defined.
  • the endothelin receptor subtype B antagonist antibody which is the subject of the present invention selectively binds to three extracellular segments of ETB-R, which segments respectively consist of amino acid residues. at 71, amino acid residues 80 to 94 and amino acid residues 244 to 272 of human endothelin receptor subtype B (SEQ ID NO: 17).
  • sequences of human subtype B endothelin receptors selectively recognized by the antibody object of the present invention are:
  • IMTPPTKTLWPKGSNASLARSLAPAEV corresponding to amino acid residues 45 to 71 of the amino acid sequence of endothelin receptor subtype B (SEQ ID NO: 17);
  • SPPRTISPPPCQGPI corresponding to amino acid residues 80 to 94 of the amino acid sequence endothelin receptor subtype B (SEQ ID NO: 17);
  • TMDYKGSYLRICLLHPVQKTAFMQFYKTA corresponding to amino acid residues 244 to 272 of the amino acid sequence of endothelin receptor subtype B (SEQ ID NO: 17).
  • an antibody which selectively binds at least one specified domain or region of ETB-R, in particular human ETB-R, is meant, in the context of the present invention, an antibody which binds the domain (s) specific with greater affinity than any other region of ETB-R.
  • the antibody binds the specified domain (s) of ETB-R with an affinity of at least 2, or at least 5, or at least 10, or at least 50 times greater than that which it is present for any other region of ETB-R.
  • This binding can be determined by methods well known in the art such as flow cytometry, radioimmunoassay (RIA), confocal microscopy, enzymo-immunoassay labeling (EIA) by direct or indirect revelation of the antibody to test (ELISA).
  • methods well known in the art such as flow cytometry, radioimmunoassay (RIA), confocal microscopy, enzymo-immunoassay labeling (EIA) by direct or indirect revelation of the antibody to test (ELISA).
  • the antibody which is the subject of the present invention may be obtained from an animal immunized against endothelin receptor subtype B or against a fragment of this receptor comprising the epitope (s) recognized by the antibody according to the present invention.
  • the immunized animal may be any animal usually used for the production of antibodies such as a mouse, a rat, a rabbit, a goat, a dog, a horse or a camelid such as camel or llama.
  • the antibody thus obtained may be purified on an affinity column on which the endothelin receptor subtype B or one of the sequences recognized specifically by the antibody according to the invention has been immobilized beforehand. This purification may also involve affinity chromatography on protein A.
  • the antibody may be a polyspecific or monospecific polyclonal antibody, or a monoclonal antibody.
  • the antibody of the present invention is monoclonal.
  • a “monoclonal antibody” refers, by definition in immunology, to an antibody obtained from a substantially homogeneous antibody population i.e. a population of identical antibodies, a relatively small amount of which may possibly have a mutation.
  • a monoclonal antibody is obtained from the proliferation of a single cell clone such as a hybridoma.
  • the antibody according to the present invention is the murine monoclonal antibody obtained from the hybridoma deposited at the CNCM on September 30, 2010 under the number CNCM 1-4370.
  • the present invention also relates to such a hybridoma.
  • the antibody according to the present invention may be a chimeric antibody ie an antibody which contains variable regions or hypervariable regions of heavy and light chain (s) derived from an antibody of a species given in combination with heavy and light chain constant regions derived from an antibody of another species heterologous to the previous one.
  • a first variant of the present invention corresponds to a chimericized antibody and in particular a chimeric monoclonal antibody, that is to say an antibody whose variable domains derived from the murine antibody previously described are associated with constant domains of human origin. . It should be recalled that several therapeutic antibodies used in humans are chimerised antibodies.
  • a second particularly advantageous variant may be a humanized antibody and in particular a humanized monoclonal antibody. Indeed, it is preferable to use a humanized antibody, if the latter is to be administered repeatedly to a human subject.
  • a humanized monoclonal antibody In the case of a humanized monoclonal antibody according to the present invention, the latter may be prepared by insertion of the CDRs of a murine antibody and in particular of the murine antibody derived from the hybridoma deposited on September 30, 2010 at the CNCM under the number CNCM 1-4370 within a human antibody, regardless of its isotype (IgG, IgA, IgM).
  • Antibodies Humanized can be made using the techniques and approaches described in the article by Verhoeyen et al., 1988, entitled “Reshaping human antibodies: Grafting antilyssozyme activity", in Science, vol. 239, pages 1534-1536 and in US Patent 4, 816, 567 in the name of Genentech and published March 28, 1989.
  • the antibodies may also be human antibodies in the sense that they have the amino acid sequence of human anti-ETB-R antibodies via methods of preparation known in the art that do not require vaccination of humans.
  • such antibodies can be obtained by gene immunization / transgenic mouse cell immunoassociations that are available and which in essence contain human immunoglobulin genes (see Vaughan et al., 1998, entitled Human antibodies by design "in Nature Biotechnol, vol 16, pages 535-539).
  • such antibodies can be obtained by cloning cDNAs encoding human B cells against ETB-R.
  • the present invention also relates to an isolated polynucleotide chosen from the following polynucleotides:
  • a polynucleotide of at least 18 nucleotides capable of hybridizing under conditions of high stringency to polynucleotides as defined in (i) and (ii).
  • polynucleotide in the context of the present invention a nucleic acid, a nucleic sequence, a nucleic acid sequence, an oligonucleotide, a polynucleotide sequence, a nucleotide sequence, a single-stranded DNA, a double DNA -branch or RNA.
  • a polynucleotide according to the present invention may comprise natural nucleotides and unnatural nucleotides.
  • the polynucleotide according to the invention does not correspond to a nucleotide sequence in its natural state i.e. in its natural chromosomal environment. On the contrary, the polynucleotide according to the invention has been isolated and optionally purified, and its environment has consequently been modified.
  • the polynucleotide according to the invention can also be obtained by genetic recombination or by chemical synthesis.
  • the conditions of high stringency correspond to temperature and ionic strength conditions which make it possible to maintain hybridization between two complementary nucleotide sequences.
  • Those skilled in the art will be able to determine the most stringent conditions of high stringency, particularly as a function of the size of the nucleotide sequences, and this, referring to the teaching of Sambrook et al. (Molecular cloning, 1989, Noland C. Ed., NY: Cold Spring Harbor Laboratory Press).
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity. % identity with the following nucleotide sequence:
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, and / or at least 98% identity with the sequence complementary to the following nucleotide sequence:
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with respectively the following nucleotide sequences:
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences corresponding respectively to the nucleotide sequences SEQ ID NO: 3, SEQ ID NO: 5 and SEQ ID NO: 1.
  • polypeptide obtained following the translation of the polynucleotide according to the invention comprises 3 peptide sequences having at least 80% identity and advantageously 100% identity with CDR1, CDR2 and CDR3 of the variable region of the heavy chain as previously defined.
  • polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following nucleotide sequence:
  • polynucleotide according to the present invention comprises at least one sequence nucleotide corresponding to the nucleotide sequence SEQ ID NO: 7.
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences having at least 80% identity, at least 85% identity, at least 90% identity, at least 95 % identity and / or at least 98% identity with respectively the complementary sequences of the nucleotide sequences SEQ ID NO: 3, SEQ ID NO: 5 and SEQ ID NO: 1.
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences respectively corresponding to the sequences complementary to the nucleotide sequences SEQ ID NO: 3, SEQ ID NO: 5 and SEQ ID NO: 1.
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 98% identity with the sequence complementary to the nucleotide sequence SEQ ID NO: 7.
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence corresponding to the sequence complementary to the nucleotide sequence SEQ ID NO: 7.
  • the polynucleotide according to the present invention comprises at least one minus three nucleotide sequences having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the sequences respectively following nucleotides:
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences corresponding respectively to the nucleotide sequences SEQ ID NO: 9, SEQ ID NO: 11 and SEQ ID NO: 13.
  • polypeptide obtained following the translation of the polynucleotide according to the invention comprises 3 peptide sequences having at least 80% identity and advantageously 100% identity with the CDR1, CDR2 and CDR3 of the variable region of the light chain as defined above.
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the following nucleotide sequence: GAC ATT GTG ATG TCA CAG TCT CCA TCC CTA CTA ATT GTG TCA GTT GGA CAG AAG GTT ACT ATG AAC TGC AAG TCC AGT CAG AAC CTT TTA TAT AGT GGC AAT CAA ACC ACC TTG GCC TGG TAC CAG CAG AAA CCA GGG CAG TCT CCT AAA CTG CTG ATT TAT TGG GCG TCC ACT AGG GAA TCT GGG GTC CCT GAT CGC TTC ACA GGC AGT GGA TCT GGG ACA GAT TTC ACT CTC ACC ATC AGC AGT GTG AAG GCT GAA GAC CTG GCA ATT TAT TAC TGT CAA CA
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence corresponding to the nucleotide sequence SEQ ID NO: 15.
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences presenting at least less than 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the complementary sequences of the SEQ ID nucleotide sequences, respectively NO: 9, SEQ ID NO: 11 and SEQ ID NO: 13.
  • the polynucleotide according to the present invention comprises at least three nucleotide sequences corresponding respectively to the complementary sequences of the nucleotide sequences SEQ ID NO: 9, SEQ ID NO: 11 and SEQ ID NO: 13.
  • the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity and / or at least 98% identity with the sequence complementary to the nucleotide sequence SEQ ID NO: 15.
  • the polynucleotide according to the present invention comprises at least a nucleotide sequence corresponding to the sequence complementary to the nucleotide sequence SEQ ID NO: 15.
  • the polynucleotide of the present invention comprises at least (or the) sequence (s) nucleotide (s) as (s) define (s) in the 1st embodiment and at least the (or) sequence (s) nucleotide (s) as (s) define (s ) in the 2 nd embodiment.
  • percentage of identity between two amino acid sequences (or between two nucleotide sequences) is meant, in the context of the present invention, a percentage of identical amino acid residues (or nucleotides) between the two compared sequences, this percentage being obtained after implementation of the best alignment (optimum alignment) between the two sequences.
  • the skilled person knows different techniques to obtain such a percentage of identity and involving homology algorithms or computer programs such as the BLAST program.
  • the percentage of identity is statistical and the differences between the two sequences are randomly distributed along these sequences.
  • the differences between the two sequences may consist of different types of sequence modifications: deletions, substitutions or additions of amino acid residues (or nucleotides).
  • the modifications implemented in the sequences result in substitutions with non-equivalent amino acids, ie amino acids having no structural homology. These modifications are likely to improve the biological properties of the antibody ie improved affinity and / or specificity, broadened recognition spectrum, increased stability, reduced immunogenicity, etc.
  • these modifications, insertions or deletions may target a CDR essential or not to the properties of the antibody according to the invention.
  • these modifications, insertions or deletions may also target an RF region, knowing that such regions, within the variable domains of the antibodies, may, depending on the antibodies, also play a role in the expression of the properties. of the antibody according to the invention.
  • the present invention also relates to a cloning and / or expression vector containing at least one polynucleotide according to the present invention.
  • a vector is particularly useful for transforming a host organism and expressing in the latter an antibody according to the present invention.
  • the vector according to the present invention further comprises one (or more) element (s) which allows (s) the expression of the polynucleotide according to the present invention and / or the secretion of the product resulting from the translation of the polynucleotide according to the present invention.
  • element (s) which allows (s) the expression of the polynucleotide according to the present invention and / or the secretion of the product resulting from the translation of the polynucleotide according to the present invention.
  • elements there may be mentioned a constitutive or inducible promoter, a transcription initiation signal or a transcription termination signal, a translation initiation sequence or an end of translation signal.
  • the vector according to the present invention comprises, operably linked, a promoter, a polynucleotide of the invention and a terminator element.
  • a promoter is operably linked to a coding sequence when it is able to affect the expression of the latter.
  • the regulatory elements for the transcription, translation and maturation of the peptides that the vector can comprise are known to those skilled in the art and the latter is capable of selecting them according to the host organism in which the expression or cloning must be done.
  • the vector according to the present invention is advantageously chosen from a plasmid, a cosmid, a bacteriophage and a virus such as a baculovirus.
  • the vector of the invention is a vector with autonomous replication comprising elements allowing its maintenance and its replication in the host organism as an origin of replication.
  • the vector may include elements allowing its selection in the host organism such as, for example, an antibiotic resistance gene or a selection gene which ensures complementation with the respective gene deleted at the level of the genome of the host organism.
  • Such cloning and / or expression vectors are well known to those skilled in the art and widely described in the literature.
  • the invention also relates to a host organism transformed with or comprising a polynucleotide according to the present invention or a vector according to the present invention.
  • host organism is meant any isolated, uni- or multicellular, lower or higher organism in which a polynucleotide of the invention is introduced for the production of an antibody according to the present invention.
  • this method can be electroporation, lipofection, a biological transformation of a plant using Agrobacterium tumefasciens, a thermal shock or a chemical process.
  • the host organism is a microorganism such as a yeast, a bacterium or a fungus.
  • a microorganism such as a yeast, a bacterium or a fungus.
  • the transformation of such microorganisms makes it possible to produce the antibody of the invention on a semi-industrial or industrial scale.
  • the host organism is an animal cell such as a mammalian cell, a plant cell, an insect cell, an animal with the exception of a human, or a plant.
  • a method for producing an antibody according to the present invention comprises the steps of:
  • the antibody according to the present invention is also modifiable in order to a) generate an antibody labeled with a radioactive isotope, a pro-drug, an enzyme or a toxin, and b) modify the binding specificity and / or affinity, and / or the stability, and / or immunogenicity of said antibody targeting cells that overexpress ETB-R, including cancer cells such as melanomas, glioblastomas etc ....
  • the antibody according to the present invention is also modifiable in order to couple it chemically or genetically to a peptide molecule; a protein molecule; a nucleic molecule such as DNA, RNA, RNAi, aptamer, PNA or LNA; a lipid molecule; a carbohydrate molecule or a chemical molecule.
  • the present invention therefore relates to a compound comprising an antibody according to the present invention conjugated to an element selected from the group consisting of a cytotoxic group, an easily detectable group or an effector group.
  • cytotoxic group is meant a directly or indirectly toxic group for the cells targeted by the antibody according to the present invention.
  • directly cytotoxic is meant a group which is in itself cytotoxic.
  • indirectly cytotoxic is meant a group which, although not cytotoxic in itself, can induce cytotoxicity, for example by its action on another molecule or by an additional action on it.
  • the cytotoxic moiety is a cytotoxic chemotherapeutic agent.
  • cytotoxic chemotherapeutic agents that can be used in the context of the present invention.
  • the activity of these agents can be increased under irradiation.
  • alkylating agents such as mechlorethamine or chlorambucil; methotrexate; 5-fluorouracil; vinblastine; gemcitabine; fludarabine; nicotinamide; doxorubicin; mitomycin; L-asparaginase; cisplatin; taxol and its analogues / derivatives.
  • the cytotoxic moiety is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
  • Cytotoxic (poly) peptide such as ricin, abrin, Pseudomonas exotoxin, TNF ⁇ and interleukin 2.
  • the cytotoxic moiety is a cytotoxic chemotherapeutic agent indirectly.
  • an agent also called pro-drug is not or little cytotoxic as such but is able to give, especially following an enzymatic reaction or irradiation, a cytotoxic substance (or drug) especially as defined in the 1st form of implementation.
  • a cytotoxic substance or drug especially as defined in the 1st form of implementation.
  • the cytotoxic moiety is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
  • indirectly cytotoxic poly (peptide) group is meant a polypeptide which has an enzymatic activity and can convert a relatively non-toxic pro-drug, especially as defined in the third embodiment, into a cytotoxic substance, in particular as defined in US Pat. the era the form of implementation.
  • indirectly cytotoxic poly (peptide) group is meant a polypeptide which has an enzymatic activity and can convert a relatively non-toxic pro-drug, especially as defined in the third embodiment, into a cytotoxic substance, in particular as defined in US Pat. the era the form of implementation.
  • peptidases indirectly cytotoxic there may be mentioned a peptidase such as a carboxypeptidase, an aminopeptidase or an endopeptidase; phosphatase; sulfatase; an amidase; a kinase; glycosidase; deaminase; a reductase; and an oxidase.
  • a peptidase such as a carboxypeptidase, an aminopeptidase or an endopeptidase
  • phosphatase such as a carboxypeptidase, an aminopeptidase or an endopeptidase
  • phosphatase such as a carboxypeptidase, an aminopeptidase or an endopeptidase
  • phosphatase such as a carboxypeptidase, an aminopeptidase or an endopeptidase
  • phosphatase such as a carboxypeptidase, an amino
  • the cytotoxic moiety is a nucleic acid molecule that is directly or indirectly cytotoxic such as an antisense oligonucleotide or an aptamer.
  • this conjugation may consist in producing the compound according to the invention in the form of a fusion compound by genetic recombination techniques, in which a polynucleotide comprises respective regions. encoding the antibody of the present invention and the cytotoxic moiety, adjacent to each other, juxtaposed or separated by a region encoding a peptide linker that does not destroy the desired properties of the final hybrid compound.
  • conjugated antibody retains its binding specificity for ETB-R and its character. antagonist, properties associated with those of the cytotoxic group.
  • an easily detectable group is meant in the context of the present invention, a group that can be detected by implementation an appropriately noninvasive appropriate detection technique such as microscopy, scintigraphy and magnetic resonance imaging (MRI).
  • a compound according to the invention comprising such an easily detectable group is particularly suited to the field of imaging and diagnosis. In particular, it makes it possible to identify and locate sites at which ETB-R is overexpressed due to the ETB-R binding specificity of the antibody present in this compound.
  • the easily detectable group may be an enzyme or a molecule capable of generating a detectable and possibly quantifiable signal under particular conditions such as when placing a suitable substrate in the presence.
  • an enzyme or a molecule capable of generating a detectable and possibly quantifiable signal under particular conditions such as when placing a suitable substrate in the presence.
  • biotin digoxygenine, 5-bromodeoxyuridine, alkaline phosphatase, peroxidase, acetylcholine esterase (AChE), glucose amylase and lysozyme.
  • the easily detectable group can be a fluorescent, chemofluorescent or bioluminescent label such as fluorescein and its derivatives, rhodamine and its derivatives, GFP (for "Green Fluorescent Protein”) and its derivatives. and umbelliferone; luminol; luciferase and luciferin.
  • fluorescent, chemofluorescent or bioluminescent label such as fluorescein and its derivatives, rhodamine and its derivatives, GFP (for "Green Fluorescent Protein”) and its derivatives. and umbelliferone; luminol; luciferase and luciferin.
  • the easily detectable moiety may be a radioactive label or isotope such as iodine-123, iodine-125, iodine-126, iodine-133, indium -111, indium-113m, the bromine-77, gallium-67, gallium-68, ruthenium-95, ruthenium-97, technetium-99m, fluorine-19, fluorine-18, carbon-13, nitrogen-15, oxygen-17, scandium-47, tellurium-122m, thulium-165 and yttrium-199. It should be noted that certain radioactive atoms used as easily detectable groups can also constitute cytotoxic groups because of the amount of radioactivity they can deliver.
  • conjugation of the antibody according to the invention with the cytotoxic groups applies mutatis mutandis to the conjugation of the antibody according to the invention with the easily detectable groups.
  • the conjugation of the antibody according to the invention with the easily detectable groups can also be carried out in relation to nano-objects, in order to densify their concentration, and thus to improve the emitted signal, the contrast or the toxicity. .
  • this easily detectable group is a radioactive marker
  • the latter can be introduced into the peptide sequence of the antibody according to the invention. This introduction can take place during the synthesis of the antibody using one or more labeled amino acids. Alternatively, this introduction can take place following this synthesis by fixing the radioactive label on residues of the peptide sequence of the synthesized antibody. For example, yttrium-90 can be attached via a lysine residue.
  • the radioactive marker may be indirectly attached to the antibody by known means. For example, EDTA or another chelating agent may be attached to the antibody of the invention and used to bind indium-111.
  • the present invention relates to the use of a compound comprising an antibody and an easily detectable moiety as a highly effective diagnostic, prognostic and in vivo monitoring tool in medical imaging.
  • the antibody format is chosen to generate the best signal-to-noise ratio and the best pharmacokinetics.
  • the present invention relates to a method for detecting and quantifying in vivo or in vitro expression or overexpression of endothelin receptor subtype B, comprising:
  • Such a method can be implemented to detect, diagnose, predict or follow a state in which the endothelin receptor subtype B is overexpressed and in particular to detect, diagnose, prognostic or follow a cancerous state (presence, size and evolution cancerous tumors).
  • effector group is meant, in the context of the present invention, a group capable of specifically recognizing a cancer marker, or which allows the recruitment of a) an effector cell of the immune system, ie NK cells, cytotoxic T cells, macrophages or b) complement system.
  • group capable of specifically recognizing a cancer marker is meant, in the context of the present invention, a ligand of a cancer marker; an antibody identical to or different from an antibody according to the present invention; a protein; a peptide; or a nucleic molecule such as DNA, RNA, RNAi, aptamer, PNA or LNA.
  • cancer marker an ETB-R is considered as well as another membrane marker.
  • the effector group recognizes a cancer marker, identical to or different from ETB-R, expressed on the surface of the cancer cells, thus ensuring a better specificity of recognition and therefore an increased targeting of the cancer cells.
  • the effector moiety has recognition specificity for a marker specifically present on the surface of effector cells of the immune system, ie, NK cells, macrophages, or cytotoxic T cells.
  • a marker specifically present on the surface of effector cells of the immune system ie, NK cells, macrophages, or cytotoxic T cells.
  • Such recruitment provides targeted lysis of the cancer cells recognized by the antibody of the present invention.
  • the effector group has a recognition specificity for the complement system and, in particular, for the Cl protein or its truncated form Clq, which initiates the cascade of molecular events that lead to death. of the targeted cell.
  • Such Recruitment provides targeted lysis of cancer cells recognized by the antibody of the present invention.
  • the effector group has a recognition specificity for the complement system and, in particular, for the C3 protein or its truncated C3b form, thus ensuring the recruitment of effector cells of the immune system, cells which induce the death of the targeted cell.
  • Such recruitment provides targeted lysis of the cancer cells recognized by the antibody of the present invention.
  • the present invention relates to an antibody according to the present invention, a polynucleotide according to the present invention or a compound according to the present invention for use as a medicament.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, as active ingredient, an antibody according to the present invention, or a polynucleotide according to the present invention or a compound according to the present invention and a pharmaceutically acceptable vehicle.
  • pharmaceutically acceptable carrier any substance which is added to an antibody, a polynucleotide or a compound according to the present invention to promote its transport, to avoid its substantial degradation in said composition, to increase its half-life. and / or preserve its antagonistic properties.
  • a pharmaceutically acceptable carrier is sterile and pyrogen-free. It is chosen according to the type of application of the pharmaceutical composition of the invention and in particular according to its mode of administration.
  • the pharmaceutical composition according to the invention consists of at least one antibody, or a polynucleotide or a compound according to the present invention in free form or in the form of an addition salt with a pharmaceutically acceptable acid, in the state pure or in the form of a composition in which it is associated with any other pharmaceutically compatible product.
  • the pharmaceutical compositions according to the invention can be used systemically; parenterally, for example intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intrasternal, intracranial, intramuscular or subcutaneous; topically; oral; rectally; intranasally or by inhalation.
  • compositions for oral administration it is possible to use tablets, pills, powders, etc. where the antibody, the polynucleotide or the compound according to the invention are mixed with one or more inert diluents conventionally used, and optionally to other substances such as, for example, a lubricant, a dye, a coating, etc.
  • compositions for oral or ocular administration suspensions, solutions, emulsions, syrups can be used.
  • the sterile compositions for parenteral administration may be aqueous solutions or not, suspensions or emulsions.
  • solvent or vehicle water, propylene glycol, vegetable oils or other suitable organic solvents may be employed.
  • These compositions may also contain adjuvants, such as wetting agents, isotonizing agents, emulsifiers, etc.
  • compositions for topical administration may be, for example, creams, lotions, mouthwashes, nasal or eye drops or aerosol.
  • the daily dose level of the antibody, polynucleotide or compound according to the present invention is usually 1 to 1000 mg per adult (i.e., about 0.015 to 15 mg / kg), administered in single or split doses. These doses are given for illustrative purposes only. In any case, the doctor will be able to determine the actual dose that is best for a given individual patient, and this varies according to the patient's age, weight and response.
  • the present invention relates to an antibody according to the present invention, a polynucleotide according to the present invention, a compound according to the present invention or a pharmaceutical composition according to the present invention for treating and / or preventing a disorder or pathology involving a dysfunction, direct or in combination with another physiological pathway, of the axis comprising an endothelin and at least one of its receptors such as, in particular, the endothelin receptor subtype B.
  • such a disorder or such a pathology is selected from the group consisting of arterial hypertension, atherosclerosis, coronary heart disease, renal dysfunction, cerebrovascular diseases, Crohn's disease, pulmonary fibrosis, lymphadenopathy. asthma, angiogenesis and cancer.
  • cancers there may be mentioned melanoma, colon cancer, Kaposi's sarcoma, glioblastoma, ovarian cancer and bladder cancer.
  • the present invention relates to an antibody according to the present invention, a polynucleotide according to the present invention, a compound according to the present invention or a pharmaceutical composition according to the present invention for treating and / or preventing a disorder or pathology involving a lack of lymphocyte infiltration. by the immune system especially at the level of tumors or cancer cells.
  • such a disorder or pathology is selected from the group consisting of cancer and any pathology (infection or viral focus) that affects the immune system in particular by a lack of lymphocyte infiltration.
  • any pathology infection or viral focus
  • an antibody according to the present invention can improve or rectify a defect Lymphocyte infiltration by the immune system makes it possible to use it to treat all types of cancer and not exclusively cancers associated with overexpression of endothelin receptor subtype B.
  • the present invention relates to the use of an antibody according to the present invention, a polynucleotide according to the present invention, a compound according to the present invention or a pharmaceutical composition according to the present invention for the preparation of a medicament for the treatment, prevention and / or prophylaxis of a disorder or pathology as defined above.
  • the present invention relates to a method for treating and / or preventing a disorder or pathology involving a dysfunction, direct or in combination with another physiological pathway, of the axis comprising an endothelin and at least one of its receptors such as, in particular, the subtype B endothelin receptors in a patient suffering or likely to suffer from such a disorder or such a pathology.
  • the present invention also relates to a method for treating and / or preventing a disorder or pathology involving a defect of lymphocyte infiltration by the immune system in a patient suffering or likely to suffer from such a disorder or pathology.
  • the present invention relates to the use of an antibody according to the present invention or a compound according to the present invention as a research tool particularly suitable for the study of signaling pathways associated with the endothelin axis / receptors. endothelin, as well as to progress in understanding the structural and functional characteristics of this family of receptors.
  • Figure 1 shows the flow cytometry (Guava) studies of the attachment on CHO cells overexpressing ETB-R (diamonds) of the 9 blood samples and containing the polyclonal antibodies, made during the process of gene immunization.
  • the samples are denoted B0 to B8, and correspond to the times DO, D28, D42, D52, D59, D76, D83, D104 and D112 days.
  • the responses of control mice immunized with empty plasmid vector (not containing ETB-R DNA) are indicated as dots.
  • Figure 2 shows the isotyping of Rendomab-B monoclonal antibody by ELISA technique.
  • Figure 3 shows the binding curves of Rendomab-B1 on two different sources of CHO cells overexpressing ETB-R: CHOs obtained in the laboratory (large triangles) and commercial cells (points) provided by Lonza. In both cases, a nanomolar affinity was measured. No binding of Rendomab-Bl on cells overexpressing endothelin receptor subtype A (ETA-R) is observed (small triangles).
  • ETA-R endothelin receptor subtype A
  • FIG. 4 shows the labeling of CHO-ETB-R cells by Rendomab-B1 (FIG. 4A) and the absence of labeling by Rendomab-B1 of CHO cells not expressing the endothelin receptor subtype B (FIG. Figure 4B).
  • Figure 5 shows the competitive experiments for binding Rendomab-B1 on CHO-ETB-R cells in the presence of increasing concentrations of endothelin 1, 2, 3 and sarafotoxin-c. An irrelevant peptide of 21 amino acids was tested as a negative control. The IC50 values of the different competing peptides are indicated.
  • Figure 6 shows images obtained by confocal microscopy on CHO-ETB-R cells in the presence of 2 nM labeled Rendomab-B ( Figure 6A) and in the presence of 2 nM labeled Rendomab-Bl and 20 nM endothelin 1 ( Figure 6B).
  • Figure 7 shows the competition curves of Rendomab-Bl (solid circles) and a non-antibody relevant (filled squares) to inhibit the binding of fluorescent ET-1 on CHO-ETB-R cells.
  • Figure 8 shows the activation curves for measuring the EC50 on ETB-R of Rendomab-B1 (Figure 8A) and BQ-788 (Figure 8B) respectively for a Rendomab-B1 range of 2 nM to 500 nM. final on CHO-ETB-R cells and for a range of BQ-788 from 0.8 nM to 500 nM final on CHO-ETB-R cells.
  • ETB-R inactivation curves after addition of Rendomab-B1, BQ-788, ET1 or an irrelevant antibody of the same isotype are also presented.
  • FIG. 9 shows the nucleic and deduced amino acid sequences of the variable domains of the light chain (VL) (FIG. 9A) and of the heavy chain (VH) (FIG. 9B) of the specific murine IgG2b / kappa Rendomab-B antibody. for the B receptor endothelins.
  • VL variable domains of the light chain
  • VH heavy chain
  • CDRs Hypervariable loops
  • the germinal parts of the different segments of the VL and VH are indicated under each sequence (IMGT annotation).
  • Figure 10 shows the mapping of the epitope recognized by Rendomab-B1, via overlapping dodecapeptides of 1 amino acid and corresponding to all the regions exposed to the surface of the ETB-R receptor. Dark spots indicate the peptides best recognized by Rendomab-Bl. The peptides are sequentially arranged from left to right from the N-terminus of the receptor. Controls Positive and negative are present at the bottom left of the nitrocellulose membrane.
  • Figure 11 shows the effect of adding different molecules including Rendomab-Bl, alone or in combination, on the growth of human endothelial cells of the umbilical vein (Huvec).
  • Figure 12 shows the effect of the addition of Rendomab-Bl at a concentration of 10 mg / kg on the development of human melanoma tumors implanted in two xenografted nude mice (stars and solid triangles), the negative control "vehicle” being performed in the absence of treatment (big round dots).
  • Figure 13 shows the effect of adding different molecules on the viability of Huvec cells.
  • Figure 14 shows the level of mRNA encoding ETBR in Huvec cells pre-incubated with different molecules including Rendomab-B1.
  • the immunization strategy implemented consisted of combining DNA injections with protein boosters in the form of injection of cells overexpressing ETB R.
  • Figure 1 were performed at times 0, 28, 42, 52, 59, 76, 83, 104 and 112 days ( Figure 1: D0, D28, D42, D52, D59, D76, D83, D104 and D112, respectively), to study the nature of the polyclonal antibody response. Figure 1 illustrates the intensity of this response.
  • mice The two best responder mice were sacrificed for cell fusion of lymphoid cells from their spleens with NS-1 murine myeloma.
  • the hybridomas obtained were first screened by ELISA on CHO cells stably expressing ETB-R, with negative control of CHO cells expressing the irrelevant NK1 receptor.
  • hybridomas retained were then screened in flow cytometry (Guava apparatus, Millipore).
  • a single hybridoma named "Rendomab-Bl" was finally selected at the end of these two screens.
  • the secreted antibody was then produced from tumors mice (ascites) induced in the mouse by intraperitoneal injection of the selected hybridoma. II. Biochemical characterization.
  • Rendomab-B1 After purification of Rendomab-B1, its biochemical properties were characterized.
  • Rendomab-B1 The heavy and light chain isotyping of Rendomab-B1 was performed using Pierce's Rapid ELISA Mouse mAb lsotyping kit. The result is shown in Figure 2. It is an immunoglobulin type G, isotype 2b for the heavy chain and kappa for the light chain. Rendomab-Bl is an immunoglobulin type IgG2b / kappa.
  • Rendomab-B1 The binding specificity of Rendomab-B1 was established by flow cytometry and confocal microscopy, by direct labeling of Rendomab-B1, or indirectly by means of a fluorescent anti-mouse secondary antibody.
  • FIGS. 5 and 6 The specific inhibition of the binding of Rendomab-B1 to ETB-R at the surface of CHO cells by the three human endothelines (ET1, ET2 and ET3) as well as by an analog, sarafotoxin c, are illustrated in FIGS. 5 and 6.
  • BQ-788 peptide N- [(cis-2,6-dimethyl-1-piperidinyl) carbonyl] -4-methyl-L-leucyl-1- (methoxycarbonyl) -D-tryptophyl-D sodium salt - norleucine, CAS: 156161-89-6), specific for ETB-R, was performed in parallel.
  • Peak calcium flow was established in the presence of ET-1 alone or in combination with irrelevant control antibody of the same isotype as Rendomab-B1.
  • the cloning of the nucleic precursors encoding the heavy chain and the light chain of Rendomab-B1 was carried out using the "Gene-Elute / Total RNA” (Sigma) and “RACE-PCR” (Invitrogen) kits.
  • Rendomab-Bl on the surface of ETB-R was made by the "Pep-scan” technique in collaboration and according to the protocols developed within the UMR 3145 "SysDiag” CNRS / BioRad located in adjoin (Dr. Claude Granier ).
  • Rendomab-Bl is shown in Figure 10.
  • Rendomab-B1 The three peptides identified in this analysis as being the most recognized by Rendomab-B1 are sequence peptides:
  • IMTPPTKTLWPKGSNASLARSLAPAEV corresponding to the amino acid residues 45 to 71 of the sequence amino acids of endothelin receptor subtype B (SEQ ID NO: 1);
  • SPPRTISPPPCQGPI corresponding to amino acid residues 80 to 94 of the amino acid sequence of endothelin receptor subtype B (SEQ ID NO: 1);
  • TMDYKGSYLRICLLHPVQKTAFMQFYKTA corresponding to amino acid residues 244 to 272 of the amino acid sequence of endothelin receptor subtype B (SEQ ID NO: 1).
  • HUVEC cells which are endothelial cells of the human umbilical vein.
  • Rendomab-Bl The potential of Rendomab-Bl to slow the proliferation of human melanoma cancer cells, and naturally expressing at least ETB-R, was tested on tumors implanted in nude mice.
  • Rendomab-B1 is injected intraperitoneally every 3 days at a concentration of 10 mg / kg of mouse, ie 0.2 mg of antibody per mouse.
  • Human vascular endothelial cells are known to express the ETB receptor. In addition, these cells are also capable of producing ET-1, thereby establishing an autocrine loop that promotes proliferation, survival and formation of new ships.
  • the Huvec cell line composed of human umbilical vein endothelial cells, was used to evaluate the pharmacological potential of Rendomab-Bl in a physiological cell model, expressing naturally ETBR.
  • HUVEC cells were exposed for 5 days to 500 nM Rendomab-B1, control antibody, BQ788 or anti-ET-1 neutralizing antibody. At the end of the treatment, the cell viability was measured using an MTT test.
  • Rendomab-Bl induces a sharp drop in cell viability (a decrease of about 50% compared to the control antibody of the same isotype). A significant decrease in viability is also observed with the anti-ET1 neutralizing antibody which confirms the role of the ET1 / ETBR autocrine loop in the survival of these cells.
  • the treatment of cells with BQ788 causes only a slight decrease in the viability of Huvec.
  • Rendomab-B1 was also evaluated for its ability to modulate ETB receptor expression in Huvec cells.
  • Huvec cells were preincubated with 500 nM Rendomab-B1, control antibody or BQ788 before being stimulated with 10 nM ETl.
  • the level of mRNA encoding ETBR is determined by RT-PCR. The results obtained are shown in FIG. 14. It is found that Rendomab-Bl is not only capable of inhibiting the ET1 increase dependent on the level of mRNA encoding ETBR, but also of causing a significant 25% decrease in the amount of mRNA compared to unstimulated control cells. On the other hand, no significant effect is observed with BQ788.
  • Rendomab-Bl has been pharmacological activity in a physiological cell model and show the superiority of this antibody compared to the peptide antagonist BQ788.
  • Rendomab-B1 appears as a promising therapeutic agent for cancer therapy.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Neurology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Pulmonology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

La présente invention concerne un anticorps antagoniste du sous-type B des récepteurs aux endothélines notamment monoclonal, un fragment ou un dérivé de celui-ci. La présente invention concerne également l'utilisation thérapeutique, diagnostique ou comme outil de recherche d'un tel anticorps.

Description

ANTICORPS ANTAGONISTE DU SOUS-TYPE B DES RECEPTEURS AUX ENDOTHÉLINES ET SES UTILISATIONS
DESCRIPTION
DOMAINE TECHNIQUE
La présente invention appartient au domaine technique des anticorps, de leur utilisation thérapeutique et diagnostique ainsi que de leur utilisation comme outil de recherche.
Plus particulièrement, la présente invention propose un anticorps, avantageusement monoclonal, spécifique de la conformation native et fonctionnelle du sous-type B des récepteurs aux endothélines et notamment des récepteurs humains aux endothélines, ledit anticorps étant capable de bloquer les propriétés pharmacologiques de tels récepteurs.
La présente invention concerne également l'utilisation de cet anticorps à des fins thérapeutiques et diagnostiques ainsi qu'à des fins de recherche .
ÉTAT DE LA TECHNIQUE ANTÉRIEURE
Les récepteurs des différentes endothélines (désignées ET1, ET2 et ET3 chez l'homme) appartiennent à la famille des récepteurs à 7 domaines transmembranaires également désignés RCPG pour « Récepteurs Couplés aux Protéines G ». Les récepteurs aux endothélines présentent, chez l'homme, deux principaux sous-types que sont le sous-type A (ETA-R) et le sous-type B (ETB-R) . L'axe endothéline et ses récepteurs est impliqué dans plusieurs fonctions et dysfonctionnements physiopathologiques . A titre d'exemples non limitatifs, on peut citer l'hypertension artérielle, l'athérosclérose, les maladies coronariennes, les dysfonctionnements rénaux, les maladies cérébrovasculaires , la maladie de Crohn, la fibrose pulmonaire, l'asthme, etc.. (Voir la revue de R. Shah, 2007, « Endothelins in health and disease », Eur . J. Int. Med., vol. 18, pages 272-282) .
De plus, les récepteurs aux endothélines se sont également avérés être associés au développement de nombreux cancers, en favorisant la prolifération, la survie et la dissémination des cellules cancéreuses ainsi que 1 ' angiogenèse (Bagnato & Rosano, 2008, « The endothelin axis in cancer », Int. J. of Biochem. & Cell Biology, vol. 40, pages 1443-1451) . Concernant le sous- type B des récepteurs aux endothélines, ce dernier présente une modification de son niveau d'expression en particulier dans les mélanomes, le cancer du colon, dans le Sarcome de Kaposi, dans les glioblastomes (tumeurs du cerveau) , et dans des cas de cancer de la vessie .
Il est également établi que le sous-type B des récepteurs aux endothélines est impliqué dans le défaut de reconnaissance de certaines cellules cancéreuses, en particulier les cellules de cancers de l'ovaire par le système immunitaire, en induisant une forte réduction de l'infiltration lymphocytaire (Buckanovich et al., 2008, « Endothelin B receptor médiates the endothélial barrier to T cell homing to tumors and disables immune therapy », Nature Médecine, vol. 14, pages 28-36) . Ainsi, bloquer les propriétés physiologiques et/ou pharmacologiques des récepteurs aux endothélines et, plus particulièrement, du sous-type B des récepteurs aux endothélines apparaît donc particulièrement pertinent en biologie clinique humaine (Kandalaft et al., 2009, « Endothelin B receptor, a new target in cancer immune therapy », Clin. Cancer Res., vol. 15, pages 4521-4528) .
Différentes stratégies existent pour bloquer des récepteurs notamment à des fins thérapeutiques telles que l'utilisation d'antagonistes peptidiques ou non et l'utilisation d'anticorps monoclonaux antagonistes de ces récepteurs.
Toutefois, dans l'arsenal d'immunothérapie passive des cancers utilisant des anticorps monoclonaux (15 anticorps ont été approuvés à ce jour), aucun ne cible les RCPG. En effet, la difficulté pour obtenir des anticorps monoclonaux spécifiques des RCPG est une conséquence des problèmes liés à l'obtention de ces mêmes récepteurs, sous une forme native et fonctionnelle, en dehors de leur contexte membranaire. L'article de Kondoh et al., 1990, intitulé
« Isolation of anti-endothelin receptor monoclonal antibodies for use in receptor characterization » dans BBRC, vol. 172, pages 503-510 décrit les propriétés de liaison de 4 anticorps monoclonaux (A2, G9, E7 et G10) vis-à-vis de complexes solubilisés de récepteurs aux endothélines présents à la surface de membranes pulmonaires de rats. Les anticorps G9 et G10 sont des immunoglobulines de type G et d' isotype 2a (IgG2a), alors que les anticorps A2 et E7 sont des immunoglobulines IgGl. Si ces quatre anticorps sont bien spécifiques de récepteurs solubilisés aux endothélines , l'article de Kondoh et al. ne fournit aucune information quant à la spécificité fine de ces anticorps (ETA-R et/ou ETB-R) , quant à la reconnaissance des récepteurs d'origine humaine, ni quant à une éventuelle propriété antagoniste.
La demande de brevet JP 2008280266 au nom de Seikisui Chemical Co Ltd et publiée le 20 novembre 2008 concerne un anticorps monoclonal appelé ha21. II s'agit d'une immunoglobuline de souris d' isotype IgG2a/kappa, qui est exclusivement spécifique du sous-type A humain des récepteurs aux endothélines, et qui ne reconnaît pas les récepteurs murins ou de rat. L'analyse de la séquence d' ETA-R, réalisée via des peptides chevauchants, a permis d'identifier une région de la seconde boucle extracytoplasmique d' ETA-R comme faisant partie de l'épitope reconnu par hA21. Enfin, ces auteurs ont montré que l'anticorps hA21 était capable de bloquer la libération intracellulaire de calcium, avec toutefois une efficacité 10 fois inférieure à celle obtenue avec l'antagoniste peptidique d' ETA-R qu'est « BQ-123 », ( cyclopeptide de 5 acides aminés, de formule D-tryptamine-D-acide aspartique-L-proline-D- valine-L-leucine ; CAS : 136553-81-6) .
La demande de brevet US 2010/003240 déposée au nom de l'Université de New York et publiée le 7 janvier 2010 concerne des protocoles thérapeutiques et des mélanges pharmaceutiques dans le cadre du traitement et de la prévention des cancers et notamment des mélanomes. A cet effet et plus spécifiquement, l'utilisation d'antagonistes d'ETB-R est revendiquée. Les exemples décrits quant à ces antagonistes concernent uniquement des formes modifiées de 1' endothéline-1, mais par extension, l'usage d'anticorps antagonistes d'ETB-R est revendiqué sans qu'aucun exemple particulier de tels anticorps ne soit décrit ou fourni.
Enfin, l'article de Yamaguchi et al., 2004, intitulé « Characterization and application of monoclonal antibodies against human endothelin B receptor expressed in insect cells » dans Biotechnology Letters, vol. 26, pages 293-299, concerne la caractérisation des propriétés de liaison de 5 anticorps monoclonaux de souris obtenus après immunisation protéique avec de l'ETB-R humain recombinant produit dans des cellules d'insectes. Quatre d'entre eux présentent une affinité similaire (de l'ordre du nanomolaire) pour ETB-R, alors que le cinquième est 10 fois moins affin. L'analyse épitopique de 3 d'entre eux (N-6, N-3 et N-l) a révélé qu'ils reconnaissent le domaine N-terminal d'ETB-R et plus particulièrement la séquence correspondant aux acides aminés 27-35 du ETB-R pour N-6 ; la séquence correspondant aux acides aminés 27-41 du ETB-R pour N-3 et la séquence correspondant aux acides aminés 71-85 pour N-l. Enfin, ces 5 anticorps sont capables de reconnaître des cellules COS surexprimant ETB-R. Il convient de remarquer qu' aucune expérience présentant l'étude de la spécificité vis-à-vis d'ETA-R n'est fournie dans cette publication, seule preuve que les anticorps monoclonaux décrits sont bien des anticorps spécifiques d' ETB-R. Ces anticorps reconnaissent également de l' ETB-R exprimé en surface de cellules eucaryotes supérieures. Cependant, rien n'est décrit concernant leur capacité à empêcher la fixation des ligands naturels (les endothélines ) , ni à bloquer la libération de calcium intracellulaire. Il ne s'agit donc pas, en l'état, d'anticorps antagonistes d'ETB-R.
Les inventeurs se sont donc fixés pour but l'obtention d'anticorps aptes à reconnaître spécifiquement le sous-type B du récepteur aux endothélines, présentant des propriétés antagonistes efficaces les rendant utiles aussi bien dans le domaine thérapeutique que diagnostique.
EXPOSÉ DE L' INVENTION
La présente invention permet de résoudre les problèmes techniques tels que précédemment définis et d'atteindre le but que se sont fixés les inventeurs.
En effet, les travaux des inventeurs ont permis de développer une stratégie d' immunisation et de sélection particulière. Cette stratégie consiste, tout d'abord, à procéder à plusieurs immunisations géniques par injection dans le muscle tibial de souris d'ADN plasmidique contenant l'ADN codant ETB-R. Ces injections sont systématiquement suivies d'une électroporation in vivo. Après 3 immunisations géniques, un premier rappel d'immunisation par injection de cellules d' eucaryotes supérieurs, surexprimant ETB-R sous sa forme fonctionnelle a été réalisé .
La fonctionnalité de l' ETB-R exprimé à la surface des cellules utilisées pour le rappel d'immunisation a été vérifiée par différentes expériences de liaison d' endothéline-1 marquée radio- activement ou par fluorescence. Cette stratégie couplée à une procédure de criblage des hybridomes en ELISA- cell puis par cytométrie de flux privilégie l'obtention d'anticorps monoclonaux spécifiques d' ETB-R dans sa conformation native. Cette approche présente, en outre, l'avantage de ne pas avoir besoin du récepteur d'intérêt extrait et purifié, ce qui constitue toujours aujourd'hui un défi difficile à relever.
Par cette stratégie, les inventeurs ont pu sélectionner un anticorps monoclonal antagoniste des propriétés pharmacologiques du sous-type B des récepteurs aux endothélines et notamment du sous-type B humain, nommé ci-après Rendomab-Bl . Concernant le caractère antagoniste de cet anticorps, il convient de souligner que, en comparaison avec le seul antagoniste peptidique spécifique d'ETB-R (BQ-788) disponible à ce jour, l'anticorps objet de la présente invention est un antagoniste 10 fois plus efficace (voir paragraphe III ci-après) .
De plus, l'intérêt, par rapport au BQ-788 par exemple, est également lié au fait que l'anticorps selon la présente invention est susceptible, via son domaine Fc, de recruter différents effecteurs cellulaires comme les lymphocytes NK (pour « Natural Killers ») , et donc d' induire la lyse des cellules ciblées (ADCC) , ou moléculaire comme le complément. Le marquage de l'anticorps avec un radionucléide tel que l'yttrium-90 est également envisageable, ainsi que son utilisation en imagerie sous une forme recombinante plus petite comme un fragment tel que défini ci-après.
La présente invention concerne un anticorps antagoniste du sous-type B des récepteurs aux endothélines , un fragment ou dérivé de celui. ci.
Avant d'entrer plus en détail dans la description de l'invention, nous rappelons ou proposons les définitions suivantes.
Les termes « anticorps » et « immunoglobuline » sont équivalents et peuvent être utilisés de façon interchangeable dans la présente invention.
Un anticorps est une glycoprotéine comprenant au moins deux chaînes lourdes (H) et au moins deux chaînes légères (L) reliées entre elles par un ou plusieurs ponts disulfure. Chaque chaîne lourde comprend une région (ou domaine) variable (VH) et une région constante comprenant 3 domaines, habituellement désignés CH1, CH2 et CH3. Chaque chaîne légère comprend une région (ou domaine) variable (VL) et une région constante comprenant un seul domaine, habituellement désigné CL. Les régions variables des chaînes lourdes et des chaînes légères impliquées dans la reconnaissance de l'antigène peuvent encore être subdivisées en 3 régions hypervariables , également appelées « régions déterminant la complémentarité » (CDR) , encadrées par 4 régions plus conservées, également appelées régions charpentes (FR) . L'organisation de chaque région variable de chaîne lourde (ou de chaîne légère) est, de l'extrémité N- terminale à l'extrémité C-terminale, comme suit : FR1, CDR1, FR2, CDR2 , FR3, CDR3 et FR4. Dans le cadre de la présente invention, la définition des CDR et FR qui a été utilisée est celle de l'IMGT (the international ImMunoGeneTics database http : //imgt . cines . fr : 8104 ) . Les calculs des pourcentages d' identité des séquences CDR mentionnés et revendiqués ci-après sont donc à prendre en compte sur la base de cette annotation.
De plus, le terme « anticorps » inclut, dans le cadre de la présente invention, non seulement des molécules d'anticorps complètes mais aussi des fragments et des dérivés de celui-ci.
Par « fragment d' anticorps », on entend, dans le cadre de la présente invention, aussi bien un fragment monovalent qui présente un seul site de liaison à l'antigène qu'un fragment divalent qui présente deux sites de combinaison à l'antigène. Ainsi, un fragment selon l'invention présente au moins un site de liaison à l'antigène. Parmi ces fragments, on peut citer les fragments Fab, F(ab' )2f Fv, et d'autres fragments qui conservent le site de liaison à l'antigène (scFv et diabody) . Un fragment Fab est un fragment monovalent constitué de la chaîne légère en entier et d'une partie de la chaîne lourde (Fd) comprenant les domaines VH et CHl tels que précédemment définis. Un fragment F(ab' )2 est un fragment divalent correspondant à l'association de deux fragments Fab reliés par les ponts disulfure présents au niveau de la région charnière des immunoglobulines (« Hinge ») située entre les domaines constants CH1 et CH2. Un fragment Fv est un fragment monovalent uniquement constitué des régions variables VL et VH des chaînes légère et lourde d'un anticorps. Un fragment scFv est un fragment polypeptidique monovalent, uniquement obtenu par génie génétique, correspondant aux domaines variables reliés par un lien peptidique. Un diabody est une molécule d'anticorps recombinante et divalente constituée de deux molécules de scFv tête-bêche en raison d'un lien peptidique trop court pour permettre la formation d'un scFv. Les fragments selon l'invention couvrent également les fragments tels que précédemment cités dont la demi-vie a été augmentée par modification chimique notamment par incorporation dans un liposome ou par introduction d'un poly ( alkylene ) glycol tel qu'un poly ( ethylène ) glycol (PEG) , cette technique étant appelée « PEGylation » et donnant des fragments tels que Fab-PEG, F(ab')2-PEG ou Fv-PEG. Par voie recombinante, il est également possible de générer des fragments seuls ou fusionnés de l'anticorps selon la présente invention, présentant des propriétés de pénétrabilité des tumeurs solides et de pharmacocinétique plus efficaces et mieux contrôlées. Les fragments d'anticorps utiles dans le cadre de la présente invention peuvent être naturels ou recombinants .
Par « dérivé d' anticorps », on entend, dans le cadre de la présente invention, des fragments d'anticorps obtenus par génie génétique comme des molécules Fv à chaîne unique (scFv) et des anticorps simple domaine (dAb) . Le terme inclut aussi des molécules du type anticorps qui peuvent être produites en utilisant des techniques d'exposition sur phage (pour « phage display ») ou d'autres techniques de sélection aléatoires pour des molécules qui se lient au sous-type B des récepteurs aux endothélines ou à des régions spécifiques de ce sous-type.
Ainsi, les « fragments d'anticorps » et « dérivés d' anticorps » couvrent toutes les molécules qui contiennent une structure, avantageusement peptidique, qui fait partie du site de reconnaissance (c'est-à-dire la partie de l'anticorps qui se lie à ou se combine à l'épitope ou à l'antigène) d'un anticorps selon la présente invention. De plus, les fragments et dérivés d'anticorps selon la présente invention présentent une activité antagoniste vis-à-vis du sous- type B des récepteurs aux endothélines.
Par « antagoniste », on entend, dans le cadre de la présente invention, un anticorps antagoniste des propriétés pharmacologiques du sous-type B des récepteurs aux endothélines (ETB-R) . Plus particulièrement, un tel anticorps est capable de diminuer, d'inhiber ou de bloquer une (ou plusieurs) activité (s) biologique ( s ) du ETB-R. Un anticorps, fragment ou dérivé de celui-ci, antagoniste peut agir :
en réduisant, altérant ou en bloquant complètement, et ce de manière directe ou indirecte les interactions entre un ETB-R et une endothéline telle que ET1, ET2 ou ET3 ;
- en interférant de manière directe ou indirecte avec l'activation du ETB-R normalement médiée par la liaison d'une endothéline telle que ET1, ET2 ou ET3
en interférant de manière directe ou indirecte avec la transduction du signal normalement médiée par la liaison d'une endothéline telle que ET1, ET2 ou ET3 sur ETB-R ;
en perturbant ou en bloquant l'acquisition par ETB-R d'une conformation ou d'une organisation homodimérique et/ou oligomérique nécessaire à l'expression de ses propriétés pharmacologiques, un tel potentiel antagoniste étant, dans ce cas, indépendant de la liaison des effecteurs naturels que sont les endothélines ET-1, ET-2 et ET-3 ; et/ou
en induisant l' internalisation d' ETB-R (« down-regulation ») , internalisation qui se traduit par une forte baisse, voire une disparition d' ETB-R de la surface des cellules ciblées, un tel effet, entraînant l'arrêt des effets induits par la fixation des endothélines sur ETB-R, notamment les effets responsables de la prolifération des cellules cancéreuses .
Plus particulièrement, les anticorps selon la présente invention couvrent les anticorps qui se lient à un ETB-R, liaisons qui perturbent directement ou indirectement la formation du complexe ETB- R/endothéline telle que ET1, ET2 ou ET3.
Parmi les activités biologiques des ETB-R que l'anticorps peut diminuer, inhiber ou bloquer, on peut citer la prolifération, la survie et/ou la dissémination des cellules notamment cancéreuses ; la libération du monoxyde d'azote (NO) ; 1 ' angiogenèse ; la libération de la prostacycline, du VEGF (facteur de croissance de 1 ' endothélium vasculaire) ou de MMP (métallo-protéinases ) ; la prévention de l'apoptose ; la vasodilatation et/ou la vasoconstriction. L'anticorps de la présente invention est également susceptible de lever, au moins partiellement, le défaut d' infiltration lymphocytaire par le système immunitaire au niveau des cellules cancéreuses.
La présente invention concerne un anticorps antagoniste du sous-type B des récepteurs aux endothélines présentant au moins une région variable de chaîne lourde comprenant un CDR3 (ci-après désigné CDR3H) présentant au moins 80% d'identité avec la séquence en acides aminés suivante : ARNYDGYFDFW (SEQ ID NO: 2) .
Dans le cadre de la présente invention, les séquences en acides aminés sont données conformément au code international à 1 lettre.
Avantageusement, l'anticorps selon la présente invention présente au moins une région variable de chaîne lourde dont le CDR1 (ci-après désigné CDR1H) , le CDR2 (ci-après désigné CDR2H) et le CDR3 présentent respectivement au moins 80% d'identité avec les séquences en acides aminés suivantes :
- GFSLTTYA (SEQ ID NO: 4) ;
- IWTGGDT (SEQ ID NO: 6) ;
- ARNYDGYFDFW (SEQ ID NO: 2) .
Le CDR1 de la région variable de chaîne lourde de l'anticorps selon l'invention (CDR1H) présente au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés suivante : GFSLTTYA (SEQ ID NO: 4) .
Le CDR2 de la région variable de chaîne lourde de l'anticorps selon l'invention (CDR2H) présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés suivante : IWTGGDT (SEQ ID NO: 6) .
Le CDR3 de la région variable de chaîne lourde de l'anticorps selon l'invention (CDR3H) présente au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés suivante : ARNYDGYFDFW (SEQ ID NO: 2) .
En particulier, l'anticorps selon l'invention présente au moins une région variable de chaîne lourde comprenant un CDR1 (CDR1H) , un CDR2 (CDR2H) et un CDR3 (CDR3H) présentant respectivement les séquences en acides aminés suivantes :
- GFSLTTYA (SEQ ID NO: 4) ;
- IWTGGDT (SEQ ID NO: 6) ;
- ARNYDGYFDFW (SEQ ID NO: 2) .
Plus particulièrement, l'anticorps selon l'invention comprend une région variable de chaîne lourde dont la séquence en acides aminés présentant au moins 80% d'identité avec la séquence suivante : QVQLKESGPGLVAPSQSLSLTCTVTGFSLTTYAIVWVRQPPGKGLEW LGVIWTGGDTNYNSDLRSRLRIDKDNSRNQVFLKMSSLQTDDTARYYCARNYDGY FDFWGQGTTLTVSS (SEQ ID NO : 8) .
Ainsi, l'anticorps selon l'invention comprend une région variable de chaîne lourde dont la séquence en acides aminés présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés SEQ ID NO: 8.
Plus particulièrement encore, l'anticorps selon l'invention comprend une région variable de chaîne lourde dont la séquence en acides aminés correspond à la séquence en acides aminés SEQ ID NO: 8.
De plus, l'anticorps selon la présente invention présente au moins une région variable de chaîne légère dont le CDR1 (ci-après désigné CDR1L) présente au moins 80% d'identité avec la séquence en suivante : QNLLYSGNQKTY (SEQ ID NO: 10) .
Enfin, l'anticorps selon la présente invention présente au moins une région variable de chaîne légère dont le CDR1 (ci-après désigné CDR1L) , le CDR2 (ci- après désigné CDR2L) et le CDR3 (ci-après désigné CDR3L) présentent respectivement au moins 80% d'identité avec les séquences en acides aminés suivantes :
- QNLLYSGNQKTY (SEQ ID NO: 10) ;
- WAS (SEQ ID NO: 12; ) ;
- QQYFIYPRT (SEQ ID NO: 14) . Avantageusement, le CDR1 de la région variable de chaîne légère de l'anticorps selon l'invention (CDR1L) présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d' identité avec la séquence en acides aminés suivante : QNLLYSGNQKTY (SEQ ID NO: 10) .
Le CDR2 de la région variable de chaîne légère de l'anticorps selon l'invention (CDR2L) présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés suivante : WAS (SEQ ID NO: 12) .
Enfin, le CDR3 de la région variable de chaîne légère de l'anticorps selon l'invention (CDR3L) présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés suivante : QQYFIYPRT (SEQ ID NO: 14) .
En particulier, l'anticorps selon l'invention présente au moins une région variable de chaîne légère dont le CDR1 (CDR1L) , le CDR2 (CDR2L) et le CDR3 (CDR3L) présentent respectivement les séquences en acides aminés suivantes :
- QNLLYSGNQKTY (SEQ ID NO: 10) ;
- WAS (SEQ ID NO: 12) ;
- QQYFIYPRT (SEQ ID NO: 14) . Plus particulièrement, l'anticorps selon l'invention comprend une région variable de chaîne légère dont la séquence en acides aminés présentant au moins 80% d'identité avec la séquence en acides aminés suivante :
DIVMSQSPSSLIVSVGQKVTMNCKSSQNLLYSGNQKTYLAWYQQKPG QSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAIYYCQQYFIYPR TFGGGTKLEIKR (SEQ ID NO: 16) .
Ainsi, l'anticorps selon l'invention comprend une région variable de chaîne légère dont la séquence en acides aminés présente au moins 80% d'identité et peut présenter au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence en acides aminés SEQ ID NO: 16.
Plus particulièrement encore, l'anticorps selon l'invention comprend une région variable de chaîne légère dont la séquence en acides aminés correspond à la séquence en acides aminés SEQ ID NO: 16.
Avantageusement, l'anticorps selon l'invention présente une région variable de chaîne légère et une région variable de chaîne lourde telles que précédemment définies.
Ainsi, l'anticorps selon l'invention présente au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR2H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR1L, un CDR2L et un CDR3L tels que précédemment définis. La chaîne légère de l'anticorps selon l'invention est typiquement une chaîne légère kappa.
La chaîne lourde de l'anticorps selon l'invention est notamment une chaîne lourde gamma 2b
En particulier, l'anticorps selon la présente invention est une immunoglobuline de type G.
Plus particulièrement, l'anticorps selon la présente invention est une immunoglobuline de type IgG2b/kappa .
Dans des formes de mise en œuvre particulières, l'anticorps selon l'invention présente :
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR1L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR2L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR1L tel que précédemment défini ; - au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR2L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR1L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR2L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR2H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR1L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR2H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR2L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR2H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR1L et un CDR2L tels que précédemment définis ; - au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR3L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR1H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L tel que précédemment défini ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR1H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H tel que précédemment défini et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H, un CDR2H et un CDR1H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR2L tels que précédemment définis ;
- au moins une région variable de chaîne lourde comprenant un CDR3H et un CDR2H tels que précédemment définis et au moins une région variable de chaîne légère comprenant un CDR3L et un CDR1L et un CDR2L tels que précédemment définis.
Les travaux des inventeurs ont permis de montrer que l'anticorps antagoniste du sous-type B des récepteurs aux endothélines , objet de la présente invention se lie sélectivement à trois segments extracellulaires du ETB-R, segments respectivement constitués des résidus d'acides aminés 45 à 71, des résidus d'acides aminés 80 à 94 et des résidus d'acides aminés 244 à 272 du sous-type B humain des récepteurs aux endothélines (SEQ ID NO: 17) .
Les séquences du sous-type B humain des récepteurs aux endothélines sélectivement reconnues par l'anticorps objet de la présente invention sont :
- IMTPPTKTLWPKGSNASLARSLAPAEV correspondant aux résidus d'acides aminés 45 à 71 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO: 17) ;
SPPRTISPPPCQGPI correspondant aux résidus d'acides aminés 80 à 94 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO : 17) ;
TMDYKGSYLRICLLHPVQKTAFMQFYKTA correspondant aux résidus d'acides aminés 244 à 272 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO: 17) .
Ces séquences mentionnées ci-avant, ont été identifiées via des peptides chevauchants correspondant à l'ensemble des domaines extracellulaires du récepteur ETB-R humain.
Par « anticorps qui lie sélectivement » au moins un domaine ou une région spécifié (e) du ETB-R notamment du ETB-R humain, on entend, dans le cadre de la présente invention, un anticorps qui lie le (ou les) domaine (s) spécifique ( s ) avec une plus grande affinité que toute autre région du ETB-R. Avantageusement, l'anticorps lie le (ou les) domaine (s) spécifié (s) du ETB-R avec une affinité au moins 2, ou au moins 5, ou au moins 10, ou au moins 50 fois supérieure à celle qu'il présente pour toute autre région du ETB-R. Cette liaison peut être déterminée par des procédés bien connus dans le domaine tels que cytométrie de flux, radio-immuno-dosage (RIA) , microscopie confocale, enzymo-immuno-dosage marquage (EIA) par révélation directe ou indirecte de l'anticorps à tester (ELISA) .
L'anticorps objet de la présente invention peut être obtenu à partir d'un animal immunisé contre le sous-type B des récepteurs aux endothélines ou contre un fragment de ce récepteur comprenant le (s) épitope(s) reconnu (s) par l'anticorps selon la présente invention. L'animal immunisé peut être un quelconque animal habituellement utilisé pour la production d'anticorps tel qu'une souris, un rat, un lapin, une chèvre, un chien, un cheval ou un camélidé tel que chameau ou lama.
L'anticorps ainsi obtenu peut être purifié sur une colonne d'affinité sur laquelle le sous-type B des récepteurs aux endothélines ou une des séquences reconnues spécifiquement par l'anticorps selon l'invention a été préalablement immobilisée. Cette purification peut également impliquer une chromatographie d'affinité sur protéine A.
Dans le cadre de la présente invention, l'anticorps peut être un anticorps polyclonal polyspécifique ou monospécifique, ou un anticorps monoclonal .
Avantageusement, l'anticorps de la présente invention est monoclonal. Un « anticorps monoclonal » se réfère, par définition habituelle en immunologie, à un anticorps obtenu à partir d'une population d'anticorps substantiellement homogènes i.e. une population d'anticorps identiques, une quantité relativement faible de ces derniers pouvant éventuellement présenter une mutation. Un anticorps monoclonal est obtenu à partir de la prolifération d'un seul clone de cellules tel qu'un hybridome.
Plus particulièrement, l'anticorps selon la présente invention est l'anticorps murin monoclonal obtenu à partir de l' hybridome déposé à la CNCM le 30 septembre 2010 sous le numéro CNCM 1-4370. La présente invention concerne également un tel hybridome. En variante, l'anticorps selon la présente invention peut être un anticorps chimérique i.e. un anticorps qui contient des régions variables ou des régions hypervariables de chaîne (s) lourde (s) et légère (s) dérivées d'un anticorps d'une espèce donnée en combinaison avec les régions constantes de chaîne (s) lourde (s) et légère (s) dérivées d'un anticorps d'une autre espèce hétérologue à la précédente.
Une première variante de la présente invention correspond à un anticorps chimérisé et notamment un anticorps monoclonal chimérisé, c'est-à-dire un anticorps dont les domaines variables issus de l'anticorps murin précédemment décrits sont associés à des domaines constants d'origine humaine. Il convient de rappeler que plusieurs anticorps thérapeutiques en usage chez l'homme sont des anticorps chimérisés.
Une seconde variante particulièrement intéressante peut être un anticorps humanisé et notamment un anticorps monoclonal humanisé. En effet, il est préférable d'utiliser un anticorps humanisé, si ce dernier doit être administré de manière répétée à un sujet humain.
Dans le cas d'un anticorps monoclonal humanisé selon la présente invention, ce dernier pourra être préparé par insertion des CDR d'un anticorps murin et notamment de l'anticorps murin issu de l'hybridome déposé le 30 septembre 2010 à la CNCM sous le numéro CNCM 1-4370 au sein d'un anticorps humain, quel que soit son isotype (IgG, IgA, IgM) . Les anticorps humanisés peuvent être fabriqués en utilisant les techniques et les approches décrites dans l'article de Verhoeyen et al., 1988, intitulé « Reshaping human antibodies: Grafting an antilysozyme activity », dans Science, vol. 239, pages 1534-1536 et dans le brevet US 4, 816, 567 au nom de Genentech et publié le 28 mars 1989.
Les anticorps peuvent aussi être des anticorps humains dans le sens où ils ont la séquence d'acides aminés d'anticorps humains anti-ETB-R via des procédés de préparation connus dans le domaine qui ne nécessitent pas la vaccination d'humains. Par exemple, de tels anticorps peuvent être obtenus par immunisation génique/rappels d' immunisation cellulaires de souris transgéniques qui sont disponibles et qui contiennent par essence des gènes d' immunoglobulines humaines (voir l'article de Vaughan et al., 1998, intitulé « Human antibodies by design » dans Nature Biotechnol. vol. 16, pages 535-539) . En variante, de tels anticorps peuvent être obtenus par le clonage des ADNc codant à partir de lymphocytes B humains dirigés contre ETB-R.
La présente invention concerne également un polynucléotide isolé choisi parmi les différents polynucléotides ci-après :
i) un polynucléotide codant un anticorps tel que précédemment défini ;
ii) un polynucléotide complémentaire du polynucléotide tel que défini au point (i) ;
iii) un polynucléotide d'au moins 18 nucléotides, capable de s'hybrider dans des conditions de forte stringence aux polynucléotides tels que définis aux points (i) et (ii) .
Par « polynucléotide », on entend, dans le cadre de la présente invention un acide nucléique, une séquence nucléique, une séquence d'acide nucléique, un oligonucléotide, une séquence polynucléotidique, une séquence nucléotidique, un ADN simple-brin, un ADN double-brin ou un ARN. Un polynucléotide selon la présente invention peut comprendre des nucléotides naturels et des nucléotides non naturels.
Le polynucléotide selon l'invention ne correspond pas à une séquence nucléotidique dans son état naturel i.e. dans son environnement chromosomique naturel. Au contraire, le polynucléotide selon l'invention a été isolé et éventuellement purifié, son environnement a, par conséquent, été modifié. Le polynucléotide selon l'invention peut également être obtenu par recombinaison génétique ou par synthèse chimique .
Les conditions de forte stringence correspondent à des conditions de température et de force ionique qui permettent de maintenir une hybridation entre deux séquences nucléotidiques complémentaires. L'homme du métier saura déterminer les conditions de forte stringence les mieux adaptées notamment en fonction de la taille des séquences nucléotidiques et ce, en se référant à l'enseignement de Sambrook et al. (Molecular cloning, 1989, Noland C. éd., New York : Cold Spring Harbor Laboratory Press) . Le polynucleotide selon la présente invention comprend au moins une séquence nucléotide présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence nucléotidique suivante :
- GCC AGA AAT TAT GAT GGA TAC TTT GAC TTC TGG (SEQ ID NO: 1) . En variante, le polynucleotide selon la présente invention comprend au moins une séquence nucléotidique présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence complémentaire de la séquence nucléotidique suivante :
- GCC AGA AAT TAT GAT GGA TAC TTT GAC TTC TGG (SEQ ID NO: 1) . Dans un 1er mode de réalisation, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec respectivement les séquences nucléotidiques suivantes :
- GGC TTC TCA TTA ACC ACT TAT GCT (SEQ ID NO:
3) ,
- ATA TGG ACT GGT GGA GAC ACA (SEQ ID NO: 5) et - GCC AGA AAT TAT GAT GGA TAC TTT GAC TTC TGG
(SEQ ID NO: 1) . Avantageusement, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques correspondant respectivement aux séquences nucléotidiques SEQ ID NO: 3, SEQ ID NO: 5 et SEQ ID NO: 1.
Il est clair que les trois séquences ci-dessus listées (i.e. SEQ ID NO: 3, SEQ ID NO: 5 et SEQ ID NO: 1) doivent être organisées les unes par rapport aux autres de façon à ce que le polypeptide obtenu suite à la traduction du polynucléotide selon l'invention comprenne 3 séquences peptidiques présentant au moins 80% d'identité et avantageusement 100% d'identité avec les CDR1, CDR2 et CDR3 de la région variable de la chaîne lourde tels que précédemment définis.
En particulier, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence nucléotidique suivante :
CAG GTG CAG CTG AAG GAG TCA GGA CCT GGC CTG GTG GCG CCC TCT CAG AGC CTG TCC CTC ACG TGC ACT GTC ACT GGC TTC TCA TTA ACC ACT TAT GCT ATT GTT TGG GTT CGC CAG CCA CCG GGA AAG GGT CTG GAG TGG CTT GGA GTA ATA TGG ACT GGT GGA GAC ACA AAT TAT AAT TCA GAT CTC AGA TCT AGA TTG CGC ATC GAC AAA GAC AAC TCC AGG AAT CAA GTT TTC TTA AAA ATG AGC AGT CTA CAA ACT GAT GAC ACA GCC CGG TAC TAC TGT GCC AGA AAT TAT GAT GGA TAC TTT GAC TTC TGG GGC CAG GGC ACC ACT CTC ACA GTC TCC TCA (SEQ ID NO: 7) .
Plus particulièrement, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique correspondant à la séquence nucléotidique SEQ ID NO: 7.
En variante de ce 1er mode de réalisation, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec respectivement les séquences complémentaires des séquences nucléotidiques SEQ ID NO: 3, SEQ ID NO: 5 et SEQ ID NO: 1.
Avantageusement, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques correspondant respectivement aux séquences complémentaires des séquences nucléotidiques SEQ ID NO: 3, SEQ ID NO: 5 et SEQ ID NO: 1.
En particulier, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité ou au moins 98% d'identité avec la séquence complémentaire de la séquence nucléotidique SEQ ID NO: 7.
Plus particulièrement, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique correspondant à la séquence complémentaire à la séquence nucléotidique SEQ ID NO: 7. Dans un 2n mode de réalisation, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec respectivement les séquences nucléotidiques suivantes :
- CAG AAC CTT TTA TAT AGT GGC AAT CAA AAG ACC TAC (SEQ ID NO: 9) ,
- TGG GCG TCC (SEQ ID NO: 11) et
- CAA CAA TAT TTT ATC TAT CCT CGG ACG (SEQ ID NO: 13) .
Avantageusement, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques correspondant respectivement aux séquences nucléotidiques SEQ ID NO: 9, SEQ ID NO: 11 et SEQ ID NO: 13.
Il est clair que les trois séquences ci-dessus listées (i.e. SEQ ID NO: 9, SEQ ID NO: 11 et SEQ ID NO: 13) doivent être organisées les unes par rapport aux autres de façon à ce que le polypeptide obtenu suite à la traduction du polynucléotide selon l'invention comprenne 3 séquences peptidiques présentant au moins 80% d'identité et avantageusement 100% d'identité avec les CDR1, CDR2 et CDR3 de la région variable de la chaîne légère tels que précédemment définis.
En particulier, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence nucléotidique suivante : GAC ATT GTG ATG TCA CAG TCT CCA TCC TCC CTA ATT GTG TCA GTT GGA CAG AAG GTT ACT ATG AAC TGC AAG TCC AGT CAG AAC CTT TTA TAT AGT GGC AAT CAA AAG ACC TAC TTG GCC TGG TAC CAG CAG AAA CCA GGG CAG TCT CCT AAA CTG CTG ATT TAT TGG GCG TCC ACT AGG GAA TCT GGG GTC CCT GAT CGC TTC ACA GGC AGT GGA TCT GGG ACA GAT TTC ACT CTC ACC ATC AGC AGT GTG AAG GCT GAA GAC CTG GCA ATT TAT TAC TGT CAA CAA TAT TTT ATC TAT CCT CGG ACG TTC GGT GGA GGC ACC AAG CTG GAA ATC AAA CGG (SEQ ID NO: 15) .
Plus particulièrement, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique correspondant à la séquence nucléotidique SEQ ID NO: 15. En variante de ce 2nd mode de réalisation, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec respectivement les séquences complémentaires des séquences nucléotidiques SEQ ID NO: 9, SEQ ID NO: 11 et SEQ ID NO: 13.
Avantageusement, le polynucléotide selon la présente invention comprend au moins trois séquences nucléotidiques correspondant respectivement aux séquences complémentaires des séquences nucléotidiques SEQ ID NO: 9, SEQ ID NO: 11 et SEQ ID NO: 13.
En particulier, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique présentant au moins 80% d'identité, au moins 85% d'identité, au moins 90% d'identité, au moins 95% d'identité et/ou au moins 98% d'identité avec la séquence complémentaire de la séquence nucléotidique SEQ ID NO: 15.
Plus particulièrement, le polynucléotide selon la présente invention comprend au moins une séquence nucléotidique correspondant à la séquence complémentaire à la séquence nucléotidique SEQ ID NO: 15. Dans un 3eme mode de réalisation, le polynucléotide selon la présente invention comprend au moins la (ou les) séquence (s) nucléotidique ( s ) telle (s) que définie (s) dans le 1er mode de réalisation et au moins la (ou les) séquence (s) nucléotidique ( s ) telle (s) que définie (s) dans le 2eme mode de réalisation.
De même, les différentes formes de mise en œuvre envisagées pour l'anticorps selon la présente invention de la page 18 à la page 20 sont également envisagées pour les polynucléotides et séquences nucléotidiques selon la présente invention mutatis mutandis .
Par « pourcentage d' identité » entre deux séquences d'acides aminés (ou entre deux séquences nucléotidiques), on entend, dans le cadre de la présente invention, un pourcentage de résidus d'acides aminés (ou de nucléotides) identiques entre les deux séquences comparées, ce pourcentage étant obtenu après mise en œuvre du meilleur alignement (alignement optimum) entre les deux séquences. L'homme du métier connaît différentes techniques permettant d'obtenir un tel pourcentage d' identité et impliquant des algorithmes d'homologie ou des programmes d'ordinateur tels que le programme BLAST.
Le pourcentage d' identité est statistique et les différences entre les deux séquences sont réparties aléatoirement le long de ces séquences. Les différences entre les deux séquences peuvent consister en différents types de modifications des séquences : des délétions, des substitutions ou des additions de résidus d'acides aminés (ou de nucléotides) .
Dans un 1er mode de réalisation, les modifications mises en œuvre dans les séquences résultent en des substitutions entre acides aminés équivalents i.e. des acides aminés présentant des homologies structurales ou ne modifiant pas substantiellement l'activité biologique des anticorps correspondants .
Dans un 2nd mode de réalisation, les modifications mises en œuvre dans les séquences résultent en des substitutions par des acides aminés non équivalents i.e. des acides aminés ne présentant pas d'homologie structurale. Ces modifications sont susceptibles d'améliorer les propriétés biologiques de l'anticorps i.e. affinité et/ou spécificité améliorées, spectre de reconnaissance élargi, augmentation de la stabilité, réduction de 1 ' immunogénicité etc...
Appliquées aux deux modes de réalisation précédemment exposés, ces modifications, insertions ou délétions peuvent cibler un CDR essentiel ou non aux propriétés de l'anticorps selon l'invention. Appliquées aux deux modes de réalisation précédemment exposés, ces modifications, insertions ou délétions peuvent également cibler une région FR, sachant que de telles régions, au sein des domaines variables des anticorps, peuvent selon les anticorps également jouer un rôle dans l'expression des propriétés de l'anticorps selon l'invention.
La présente invention concerne également un vecteur de clonage et/ou d'expression contenant au moins un polynucléotide selon la présente invention. Un tel vecteur est notamment utile pour transformer un organisme hôte et exprimer dans ce dernier un anticorps selon la présente invention.
Le vecteur selon la présente invention comprend en outre un (ou plusieurs) élément (s) qui permet (tent) l'expression du polynucléotide selon la présente invention et/ou la sécrétion du produit résultant de la traduction du polynucléotide selon la présente invention. Parmi ces éléments, on peut citer un promoteur constitutif ou inducible, un signal d' initiation de la transcription ou un signal de terminaison de la transcription, une séquence d' initiation de la traduction ou un signal de fin de traduction.
Avantageusement, le vecteur selon la présente invention comprend, liés entre eux de façon opérationnelle, un promoteur, un polynucléotide de l'invention et un élément terminateur. On entend par « liés entre eux de façon opérationnelle » selon l'invention, des éléments liés entre eux de façon à ce que le fonctionnement d'un des éléments soit affecté par celui d'un autre. A titre d'exemple, un promoteur est lié de façon opérationnelle à une séquence codante lorsqu'il est capable d'affecter l'expression de cette dernière. Les éléments régulateurs de la transcription, de la traduction et de la maturation des peptides que le vecteur peut comprendre sont connus de l'homme du métier et ce dernier est capable de les choisir en fonction de l'organisme hôte dans lequel l'expression ou le clonage doivent être réalisés.
Le vecteur selon la présente invention est avantageusement choisi parmi un plasmide, un cosmide, un bactériophage et un virus tel qu'un baculovirus. En particulier, le vecteur de l'invention est un vecteur à réplication autonome comportant des éléments permettant son maintien et sa réplication dans l'organisme hôte comme une origine de réplication. En outre, le vecteur peut comporter des éléments permettant sa sélection dans l'organisme hôte comme, par exemple, un gène de résistance à un antibiotique ou un gène de sélection qui assure la complémentation avec le gène respectif délété au niveau du génome de l'organisme hôte. De tels vecteurs de clonage et/ou d'expression sont bien connus de l'homme du métier et largement décrits dans la littérature.
L'invention concerne également un organisme hôte transformé par ou comprenant un polynucléotide selon la présente invention ou un vecteur selon la présente invention. Par « organisme hôte », on entend tout organisme, isolé, uni- ou pluricellulaire, inférieur ou supérieur, dans lequel un polynucléotide de l'invention est introduit pour la production d'un anticorps selon la présente invention.
L'homme du métier connaît différentes méthodes pour introduire de façon efficace un polynucléotide dans un organisme hôte et ce, afin que, dans l'organisme hôte, l'anticorps codé par ledit polynucléotide soit produit. A titre d'exemple et de façon non exhaustive, cette méthode peut être une électroporation, une lipofection, une transformation biologique d'un végétal en utilisant Agrobacterium tumefasciens, un choc thermique ou un procédé chimique.
Avantageusement, l'organisme hôte est un microorganisme tel qu'une levure, une bactérie ou un champignon. La transformation de tels microorganismes permet de produire l'anticorps de l'invention à échelle semi-industrielle ou industrielle.
En variante, l'organisme hôte est une cellule animale telle qu'une cellule de mammifère, une cellule végétale, une cellule d'insectes, un animal à l'exception d'un humain, ou une plante.
De tels organismes hôtes peuvent être utilisés pour produire un anticorps selon la présente invention. En effet, un procédé pour produire un anticorps selon la présente invention comprend les étapes consistant à :
a) mettre en culture un organisme hôte selon la présente invention et notamment un organisme hôte unicellulaire dans un milieu de culture et dans des conditions appropriées ;
b) récupérer ledit anticorps à partir du milieu de culture dudit organisme hôte cultivé ou à partir dudit organisme hôte cultivé.
L'anticorps selon la présente invention est également modifiable afin de a) générer un anticorps marqué par un isotope radioactif, par une pro-drogue, une enzyme ou une toxine, et b) modifier la spécificité et/ou l'affinité de liaison, et/ou la stabilité, et/ou 1 ' immunogénicité dudit anticorps assurant le ciblage des cellules qui surexpriment le ETB-R, notamment des cellules cancéreuses telles que des mélanomes, des glioblastomes etc....
L'anticorps selon la présente invention est également modifiable afin de le coupler chimiquement ou génétiquement à une molécule peptidique ; une molécule protéique ; une molécule nucléique telle qu'un ADN, un ARN, un ARNi, un aptamère, un PNA ou un LNA ; une molécule lipidique ; une molécule glucidique ou une molécule chimique.
La présente invention concerne donc un composé comprenant un anticorps selon la présente invention conjugué à un élément choisi dans le groupe constitué par un groupement cytotoxique, un groupement facilement détectable ou un groupement effecteur.
Par « groupement cytotoxique », on entend un groupement directement ou indirectement toxique pour les cellules ciblées par l'anticorps selon la présente invention. Par « directement cytotoxique », on entend un groupement qui est en lui-même cytotoxique. Par « indirectement cytotoxique », on entend un groupement qui, bien que non cytotoxique en lui-même, peut induire une cytotoxicité, par exemple par son action sur une autre molécule ou par une action supplémentaire sur lui .
Dans une lere forme de mise en œuvre, le groupement cytotoxique est un agent chimiothérapeutique cytotoxique. L'homme du métier connaît différents agents chimiothérapeutiques cytotoxiques utilisables dans le cadre de la présente invention. L'activité de ces agents peut être augmentée sous irradiation. A titre d'exemples illustratifs et non limitatifs, on peut citer les agents alkylants comme la méchloréthamine ou le chlorambucile ; le méthotrexate ; la 5-fluoro-uracile ; la vinblastine ; la gemcitabine ; la fludarabine ; la nicotinamide ; la doxorubicine ; la mitomycine ; la L-asparaginase ; le cisplatine ; le taxol et ses analogues/dérivés.
Dans une 2eme forme de mise en œuvre, le groupement cytotoxique est un groupement
(poly) peptidique cytotoxique tel que la ricine, l'abrine, l'exotoxine de Pseudomonas, le TNFa et 1 ' interleukine 2.
Dans une 3eme forme de mise en œuvre, le groupement cytotoxique est un agent chimiothérapeutique indirectement cytotoxique. Un tel agent également appelé pro-drogue n' est pas ou peu cytotoxique en tant que tel mais est apte à donner, notamment suite à une réaction enzymatique ou à une irradiation, une substance cytotoxique (ou drogue) notamment telle que définie dans la lere forme de mise en œuvre. A titre d'exemples illustratifs et non limitatifs, on peut citer la méthotrexate-alanine ; la mitomycine phosphate, la 5-fluorocytosine ; la photofrine et la capécitabine .
Dans une 4eme forme de mise en œuvre, le groupement cytotoxique est un groupement
(poly) peptidique indirectement cytotoxique. Par groupement poly (peptidique ) indirectement cytotoxique, on entend un polypeptide qui présente une activité enzymatique et peut convertir une pro-drogue relativement non toxique notamment telle que définie dans la 3eme forme de mise en œuvre en une substance cytotoxique notamment telle que définie dans la lere forme de mise en œuvre. Parmi de tels groupements
(poly) peptidiques indirectement cytotoxiques , on peut citer une peptidase telle qu'une carboxypeptidase, une aminopeptidase ou une endopeptidase ; une phosphatase ; une sulfatase ; une amidase ; une kinase ; une glycosidase ; une désaminase ; une réductase ; et une oxydase .
Dans une 5eme forme de mise en œuvre, le groupement cytotoxique est une molécule d' acide nucléique qui est directement ou indirectement cytotoxique telle qu'un oligonucléotide anti-sens ou un aptamère .
L'homme du métier connaît différentes techniques permettant de conjuguer de tels groupements à un anticorps selon la présente invention une fois ce dernier obtenu ou produit. Ces techniques permettent un couplage covalent entre un anticorps selon l'invention et un groupement cytotoxique en mettant à profit des groupes chimiques particuliers portés par l'anticorps selon l'invention et par le groupement cytotoxique. Parmi ces groupes chimiques particuliers, on peut citer un groupe thiol, un groupe ester, un groupe amino, un groupe acide et tout élément chimique susceptible d'être mis en œuvre dans la « click-chemistry ».
En variante et notamment lorsque le groupement cytotoxique est un groupement de nature peptidique, cette conjugaison peut consister à produire le composé selon l'invention sous forme d'un composé de fusion par les techniques de recombinaison génétique, dans lesquelles un polynucléotide comprend des régions respectives codant l'anticorps selon la présente invention et le groupement cytotoxique, adjacentes l'une à l'autre, juxtaposées ou séparées par une région codant un lieur peptidique qui ne détruit pas les propriétés souhaitées du composé hybride final.
Qu'elle que soit la technique utilisée pour conjuguer un anticorps selon la présente invention avec un groupement cytotoxique, la seule contrainte à respecter dans le cadre de cette conjugaison est que l'anticorps conjugué conserve sa spécificité de liaison pour ETB-R et son caractère antagoniste, propriétés associées à celles du groupement cytotoxique.
Par « groupement facilement détectable », on entend, dans le cadre de la présente invention, un groupement qui peut être détecté par mise en œuvre d'une technique de détection appropriée avantageusement non invasive telle que la microscopie, la scintigraphie et l'imagerie par résonance magnétique (IRM) . Un composé selon l'invention comprenant un tel groupement facilement détectable est particulièrement adapté au domaine de l'imagerie et du diagnostic. Il permet notamment d'identifier et localiser des sites au niveau desquels le ETB-R est surexprimé du fait de la spécificité de liaison au ETB-R de l'anticorps présent dans ce composé.
Dans une lere forme de mise en œuvre, le groupement facilement détectable peut être une enzyme ou une molécule capable de générer un signal détectable et éventuellement quantifiable dans des conditions particulières comme lors de la mise en présence d'un substrat adapté. A titre d'exemples illustratifs et non limitatifs, on peut citer la biotine, la digoxygénine, la 5-bromodeoxyuridine, une phosphatase alcaline, une peroxydase, une acétylcholine estérase (AChE) , une glucose amylase et une lysozyme.
Dans une 2eme forme de mise en œuvre, le groupement facilement détectable peut être un marqueur fluorescent, chimiofluorescent ou bioluminescent tels que la fluorescéine et ses dérivés, la rhodamine et ses dérivés, la GFP (pour « Green Fluorescent Protein ») et ses dérivés et l' umbelliférone ; le luminol ; la luciférase et la luciférine.
Dans une 3eme forme de mise en œuvre, le groupement facilement détectable peut être un marqueur ou isotope radioactif tel que l'iode-123, l'iode-125, l'iode-126, l'iode-133, l' indium-111, l' indium-113m, le brome-77, le gallium-67, le gallium-68, le ruthénium- 95, le ruthénium- 97 , le technetium-99m, le fluor-19, le fluor-18, le carbone-13, l'azote-15, l' oxygène-17, le scandium-47, le tellurium-122m, le thulium-165 et 1' yttrium-199. Il convient de remarquer que certains atomes radioactifs utilisés comme groupements facilement détectables peuvent aussi constituer des groupements cytotoxiques du fait de la quantité de radioactivité qu'ils peuvent délivrer.
Tout ce qui a été précédemment expliqué pour la conjugaison de l'anticorps selon l'invention avec les groupements cytotoxiques s'applique mutatis mutandis à la conjugaison de l'anticorps selon l'invention avec les groupements facilement détectables. La conjugaison de l'anticorps selon l'invention avec les groupements facilement détectables, peut également être réalisée en relation avec des nano-objets, et ce afin de densifier leur concentration, et donc d'améliorer le signal émis, le contraste ou la toxicité.
Dans le cas où ce groupement facilement détectable est un marqueur radioactif, ce dernier peut être introduit dans la séquence peptidique de l'anticorps selon l'invention. Cette introduction peut avoir lieu lors de la synthèse de l'anticorps en utilisant un ou plusieurs acides aminés marqués. En variante, cette introduction peut avoir lieu suite à cette synthèse en fixant le marqueur radioactif sur des résidus de la séquence peptidique de l'anticorps synthétisée. Par exemple, l'yttrium-90 peut être fixé via un résidu lysine. En variante encore, le marqueur radioactif peut être indirectement fixé à l'anticorps par des moyens connus. Par exemple, de l'EDTA ou un autre agent chélateur peut être fixé à l'anticorps selon l'invention et utilisé pour fixer l' indium-111.
La présente invention concerne l'utilisation d'un composé comprenant un anticorps et un groupement facilement détectable comme un outil de diagnostic, de pronostic et de suivi in vivo très efficace en matière d'imagerie médicale. Le format d'anticorps est choisi de manière à générer le meilleur rapport signal sur bruit et la meilleure pharmaco-cinétique .
En d'autres termes, la présente invention concerne un procédé pour détecter et quantifier in vivo ou in vitro l'expression ou la surexpression du sous- type B des récepteurs aux endothélines , consistant à :
ai) mettre en contact un échantillon biologique avec un composé selon la présente invention ;
bi) détecter l'éventuel complexe entre ledit composé et ledit sous-type B des récepteurs aux endothélines .
Un tel procédé peut être mis en œuvre pour détecter, diagnostiquer, prognostiquer ou suivre un état dans lequel le sous-type B des récepteurs aux endothélines est surexprimé et notamment pour détecter, diagnostiquer, prognostiquer ou suivre un état cancéreux (présence, taille et évolution des tumeurs cancéreuses) .
Par « groupement effecteur », on entend, dans le cadre de la présente invention, un groupement capable de reconnaître spécifiquement un marqueur cancéreux, ou qui permette le recrutement a) d'une cellule effectrice du système immunitaire i.e. des cellules NK, des cellules T cytotoxiques , des macrophages ou b) du système du complément. Par « groupement capable de reconnaître spécifiquement un marqueur cancéreux », on entend, dans le cadre de la présente invention, un ligand d'un marqueur cancéreux ; un anticorps identique ou différent à un anticorps selon la présente invention ; une protéine ; un peptide ; ou une molécule nucléique telle qu'un ADN, un ARN, un ARNi, un aptamère, un PNA ou un LNA. Par « marqueur cancéreux », on envisage aussi bien un ETB-R qu'un autre marqueur membranaire.
Dans une lere forme de mise en œuvre, le groupement effecteur reconnaît un marqueur cancéreux, identique à ou différent de ETB-R, exprimé à la surface des cellules cancéreuses, assurant ainsi une meilleure spécificité de reconnaissance et donc un ciblage accru des cellules cancéreuses.
Dans une 2nde forme de mise en œuvre, le groupement effecteur présente une spécificité de reconnaissance pour un marqueur spécifiquement présent à la surface de cellules effectrices du système immunitaire i.e. cellules NK, macrophages ou cellules T cytotoxiques. Un tel recrutement assure la lyse ciblée des cellules cancéreuses reconnues par l'anticorps de la présente invention.
Dans une 3ieme forme de mise en œuvre, le groupement effecteur présente une spécificité de reconnaissance pour le système du complément et, en particulier, pour la protéine Cl ou sa forme tronquée Clq, qui initie la cascade des événements moléculaires qui aboutissent à la mort de la cellule ciblée. Un tel recrutement assure la lyse ciblée des cellules cancéreuses reconnues par l'anticorps de la présente invention .
Dans une 4ieme forme de mise en œuvre, le groupement effecteur présente une spécificité de reconnaissance pour le système du complément et, en particulier, pour la protéine C3 ou sa forme tronquée C3b, assurerant ainsi le recrutement de cellules effectrices du système immunitaire, cellules qui induisent la mort de la cellule ciblée. Un tel recrutement assure la lyse ciblée des cellules cancéreuses reconnues par l'anticorps de la présente invention . La présente invention concerne un anticorps selon la présente invention, un polynucléotide selon la présente invention ou un composé selon la présente invention pour utilisation comme médicament.
Ainsi, la présente invention concerne une composition pharmaceutique comprenant, en tant que principe actif, un anticorps selon la présente invention, ou un polynucléotide selon la présente invention ou un composé selon la présente invention et un véhicule pharmaceutiquement acceptable.
Par « véhicule pharmaceutiquement acceptable », on entend selon la présente invention, toute substance qui est ajoutée à un anticorps, un polynucléotide ou un composé selon la présente invention pour favoriser son transport, éviter sa dégradation substantielle dans ladite composition, augmenter sa demi-vie et/ou préserver ses propriétés antagonistes. Avantageusement, un tel véhicule pharmaceutiquement acceptable est stérile et apyrogène. Il est choisi en fonction du type d'application de la composition pharmaceutique de l'invention et notamment en fonction de son mode d'administration.
Ainsi, la composition pharmaceutique selon l'invention est constituée par au moins un anticorps, ou un polynucléotide ou un composé selon la présente invention sous forme libre ou sous forme d'un sel d'addition avec un acide pharmaceutiquement acceptable, à l'état pur ou sous forme d'une composition dans laquelle il est associé à tout autre produit pharmaceutiquement compatible. Les compositions pharmaceutiques selon l'invention peuvent être employées par voie systémique ; par voie parentérale, par exemple intraveineuse, intraartérielle, intrapéritonéale, intrathécale, intraventriculaire, intrasternale, intracrânienne, intramusculaire ou sous- cutanée ; par voie topique ; par voie orale ; par voie rectale ; par voie intranasale ou par inhalation.
A titre de compositions solides pour administration orale, on peut utiliser des comprimés, des pilules, des poudres, etc.. où l'anticorps, le polynucléotide ou le composé selon l'invention sont mélangés à un ou plusieurs diluants inertes classiquement utilisés, et éventuellement à d'autres substances telles que, par exemple, un lubrifiant, un colorant, un enrobage etc....
A titre de compositions liquides pour administration orale ou oculaire, on peut utiliser des suspensions, des solutions, des émulsions, des sirops pharmaceutiquement acceptables contenant des diluants inertes classiquement utilisés, et éventuellement d'autres substances comme des produits mouillants, édulcorants, épaississants, etc....
Les compositions stériles pour administration parentérale peuvent être des solutions aqueuses ou non, des suspensions ou des émulsions. Comme solvant ou véhicule, on peut employer l'eau, le propylèneglycol , des huiles végétales ou d'autres solvants organiques convenables. Ces compositions peuvent également contenir des adjuvants, comme des agents mouillants, isotonisants , émulsifiants, etc....
Les compositions pour l'administration topique peuvent être par exemple des crèmes, lotions, collutoires, gouttes nasales ou oculaires ou aérosol.
Le niveau de dose quotidien de l'anticorps, du polynucléotide ou du composé selon la présente invention est habituellement de 1 à 1 000 mg par adulte (c'est-à-dire d'environ 0,015 à 15 mg/kg) , administrés en doses uniques ou fractionnées. Ces doses ne sont données qu'à titre illustratif. Le médecin, dans tous les cas, saura déterminer la dose réelle la plus adaptée à un patient individuel donné et cette dernière varie selon l'âge, le poids et la réponse du patient.
La présente invention concerne un anticorps selon la présente invention, un polynucléotide selon la présente invention, un composé selon la présente invention ou une composition pharmaceutique selon la présente invention pour traiter et/ou prévenir un trouble ou une pathologie impliquant un dysfonctionnement, direct ou en association avec une autre voie physiologique, de l'axe comprenant une endothéline et au moins un de ses récepteurs tel que, notamment, le sous-type B des récepteurs aux endothélines .
Avantageusement, un tel trouble ou une telle pathologie est choisi (e) dans le groupe constitué par l'hypertension artérielle, l'athérosclérose, les maladies coronariennes, les dysfonctionnements rénaux, les maladies cérébrovasculaires , la maladie de Crohn, la fibrose pulmonaire, l'asthme, 1 ' angiogenèse et un cancer. A titre de cancers, on peut citer un mélanome, un cancer du colon, un Sarcome de Kaposi, un glioblastome, un cancer des ovaires et un cancer de la vessie.
La présente invention concerne un anticorps selon la présente invention, un polynucléotide selon la présente invention, un composé selon la présente invention ou une composition pharmaceutique selon la présente invention pour traiter et/ou prévenir un trouble ou une pathologie impliquant un défaut d' infiltration lymphocytaire par le système immunitaire notamment au niveau des tumeurs ou cellules cancéreuses .
Avantageusement, un tel trouble ou une telle pathologie est choisi (e) dans le groupe constitué par un cancer et toute pathologie (infection ou foyer viral) qui affecte le système immunitaire en particulier par un défaut d'infiltration lymphocytaire. En effet, le fait qu'un anticorps selon la présente invention peut améliorer ou rectifier un défaut d' infiltration lymphocytaire par le système immunitaire rend possible son utilisation pour traiter tout type de cancers et pas exclusivement les cancers associés à une surexpression du sous-type B des récepteurs aux endothélines .
En d'autres termes, la présente invention concerne l'utilisation d'un anticorps selon la présente invention, d'un polynucléotide selon la présente invention, d'un composé selon la présente invention ou d'une composition pharmaceutique selon la présente invention pour la préparation d'un médicament destiné au traitement, à la prévention et/ou à la prophylaxie d'un trouble ou d'une pathologie tels que précédemment définis .
En d'autres termes encore, la présente invention concerne un procédé pour traiter et/ou prévenir un trouble ou une pathologie impliquant un dysfonctionnement, direct ou en association avec une autre voie physiologique, de l'axe comprenant une endothéline et au moins un de ses récepteurs tel que, notamment, le sous-type B des récepteurs aux endothélines chez un patient souffrant ou susceptible de souffrir d'un tel trouble ou d'une telle pathologie. La présente invention concerne également un procédé pour traiter et/ou prévenir un trouble ou une pathologie impliquant un défaut d' infiltration lymphocytaire par le système immunitaire chez un patient souffrant ou susceptible de souffrir d'un tel trouble ou d'une telle pathologie. Ces procédés consistent à administrer audit patient une quantité efficace d'un anticorps selon la présente invention, d'un polynucléotide selon la présente invention, d'un composé selon la présente invention ou d'une composition pharmaceutique selon la présente invention. Enfin, la présente invention concerne l'utilisation d'un anticorps selon la présente invention ou d'un composé selon la présente invention comme un outil de recherche particulièrement adapté à l'étude des voies de signalisation associées à l'axe endothéline/récepteurs aux endothélines , ainsi que pour progresser dans la compréhension des caractéristiques structurales et fonctionnelles de cette famille de récepteurs . D'autres caractéristiques et avantages de la présente invention apparaîtront encore à l'homme du métier à la lecture des exemples ci-dessous donnés à titre illustratif et non limitatif, en référence aux figures annexées.
BRÈVE DESCRIPTION DES DESSINS
La Figure 1 présente les études par cytométrie de flux (Guava) , de la fixation sur des cellules CHO surexprimant ETB-R (losanges) des 9 prélèvements sanguins et contenant les anticorps polyclonaux, réalisés au cours du processus d'immunisation génique. Les prélèvements sont notés B0 à B8, et correspondent aux temps DO, D28, D42, D52, D59, D76, D83, D104 et D112 jours. Les réponses des souris témoins, immunisées avec du vecteur plasmidique vide (ne contenant pas l'ADN d' ETB-R) sont indiquées sous la forme de points. La Figure 2 présente l'isotypage de l'anticorps monoclonal Rendomab-Bl par technique ELISA.
La Figure 3 présente les courbes de liaison du Rendomab-Bl sur deux sources différentes de cellules CHO surexprimant ETB-R : des CHO obtenues au laboratoire (gros triangles) et des cellules commerciales (points) fournies par la société Lonza. Dans les deux cas, une affinité de l'ordre du nanomolaire a été mesurée. Aucune liaison du Rendomab- Bl sur des cellules surexprimant le sous-type A des récepteurs aux endothélines (ETA-R) n'est observée (petits triangles) .
La Figure 4 présente le marquage de cellules CHO-ETB-R par le Rendomab-Bl (Figure 4A) et l'absence de marquage par le Rendomab-Bl de cellules CHO n' exprimant pas le sous-type B du récepteur aux endothélines (Figure 4B) .
La Figure 5 présente les expériences de compétition pour la fixation du Rendomab-Bl sur des cellules CHO-ETB-R en présence de concentrations croissantes d' endothéline 1, 2, 3 et de sarafotoxine-c . Un peptide non pertinent de 21 acides aminés a été testé comme témoin négatif. Les valeurs d' IC50 des différents peptides compétiteurs sont indiquées.
La Figure 6 présente des images obtenues en microscopie confocale sur des cellules CHO-ETB-R en présence de 2 nM de Rendomab-Bl marqué (Figure 6A) et en présence de 2 nM de Rendomab-Bl marqué et de 20 nM d' endothéline 1 (Figure 6B) .
La Figure 7 présente les courbes de compétition du Rendomab-Bl (cercles pleins) et d'un anticorps non pertinent (carrés pleins) à inhiber la liaison d'ET-1 fluorescente sur des cellules CHO-ETB-R.
La Figure 8 présente les courbes d' activation permettant de mesurer l'EC50 sur ETB-R du Rendomab-Bl (Figure 8A) et du BQ-788 (Figure 8B) respectivement pour une gamme de Rendomab-Bl de 2 nM à 500 nM final sur des cellules CHO-ETB-R et pour une gamme de BQ-788 de 0,8 nM à 500 nM final sur des cellules CHO-ETB-R. Les courbes d' inactivation d' ETB-R après ajout de Rendomab-Bl, de BQ-788, d'ETl ou d'un anticorps irrelevant de même isotype, sont également présentées.
La Figure 9 présente les séquences nucléiques et déduites en acides aminés des domaines variables de la chaîne légère (VL) (Figure 9A) et de la chaîne lourde (VH) (Figure 9B) de l'anticorps murin IgG2b/kappa Rendomab-Bl spécifique pour le récepteur B des endothélines . Les boucles hypervariables (CDR) sont soulignées dans les séquences déduites en acides aminés. Les pièces germinales des différents segments du VL et du VH sont indiquées sous chaque séquence (Annotation IMGT) .
La Figure 10 présente la cartographie de l'épitope reconnu par le Rendomab-Bl, via des dodecapeptides chevauchants de 1 acide aminé et correspondant à l'ensemble des régions exposées à la surface du récepteur ETB-R. Les tâches foncées indiquent les peptides les mieux reconnus par le Rendomab-Bl. Les peptides sont disposés séquentiellement de gauche à droite en partant de l'extrémité N-terminale du récepteur. Des contrôles positifs et négatifs sont présents en bas à gauche de la membrane de nitrocellulose .
La Figure 11 présente l'effet de l'ajout de différentes molécules dont Rendomab-Bl, seules ou en combinaison, sur la croissance de cellules endothéliales humaines de la veine ombilicale (Huvec) .
La Figure 12 présente l'effet de l'ajout du Rendomab-Bl à une concentration de 10 mg/Kg sur le développement de tumeurs de mélanome humain implantées chez deux souris nudes xénogreffées (étoiles et triangles pleins), le contrôle négatif « véhicule » étant réalisé en absence de traitement (gros points ronds) .
La Figure 13 présente l'effet de l'ajout de différentes molécules sur la viabilité des cellules Huvec .
La Figure 14 présente le taux d'ARNm codant pour ETBR dans des cellules Huvec pré-incubées avec différentes molécules dont Rendomab-Bl.
EXPOSÉ DÉ TAILLÉ DE MODES DE RÉALISATION PARTICULIERS
I . Matériels et méthodes.
I .1. Immuni sa ti on .
La stratégie d' immunisation mise en œuvre a consisté à combiner des injections d'ADN avec des rappels protéiques sous la forme d'injection de cellules surexprimant ETB R. Trois injections, dans le muscle tibial de souris, de 50 μg d'ADN plasmidique pcDNA3/ETB-R, ont été réalisées avec une périodicité de 14 jours (Figure 1 : D0, D14 et D28) . Chaque injection d'ADN a été suivie d'une électrostimulation selon les caractéristiques suivantes 8 impulsions de 20 ms chacune, 80 Volts, 1 Hz . 4 souris C57BL6 ont été immunisées avec du vecteur vide (témoin) , et 10 avec le vecteur recombinant. Trois rappels d'immunisation aux jours 49, 70 et 101 (Figure 1 : D49, D70 et D101, respectivement) ont ensuite été effectués, par injection par voie intrapéritonéale de 2.106 cellules COS surexprimant transitoirement ETB-R, ou de cellules témoins qui n'expriment pas le récepteur.
Neuf prélèvements sanguins notés B0 à B8 sur la
Figure 1 ont été effectués aux temps 0, 28, 42, 52, 59, 76, 83, 104 et 112 jours (Figure 1 : D0, D28, D42, D52, D59, D76, D83, D104 et D112, respectivement), afin d' étudier la nature de la réponse anticorps polyclonale. La Figure 1 illustre l'intensité de cette réponse .
Les deux meilleures souris répondeuses ont été sacrifiées afin de procéder à la fusion cellulaire des cellules lymphoïdes de leurs rates avec le myélome murin NS-1.
1.2. Criblage des hybridomes.
Les hybridomes obtenus ont, tout d'abord, été criblés par ELISA sur des cellules CHO exprimant de manière stable ETB-R, avec pour contrôle négatif des cellules CHO exprimant le récepteur non pertinent NKl.
Les hybridomes retenus ont ensuite été criblés en cytométrie de flux (appareil Guava, Millipore) . Un seul hybridome nommé « Rendomab-Bl » a finalement été retenu à l'issue de ces deux cribles. L'anticorps sécrété a ensuite été produit à partir de tumeurs liquides (ascites) induites chez la souris par injection par voie intrapéritonéale de l'hybridome sélectionné . II. Caractérisation biochimique.
Après purification du Rendomab-Bl, il a été procédé à la caractérisation de ses propriétés biochimiques .
L' isotypage des chaînes lourde et légère du Rendomab-Bl a été réalisé à l'aide du kit « Rapid ELISA Mouse mAb lsotyping » de chez Pierce. Le résultat est présenté à la Figure 2. Il s'agit d'une immunoglobuline de type G, d' isotype 2b pour la chaîne lourde et kappa pour la chaîne légère. Le Rendomab-Bl est donc une immunoglobuline de type IgG2b/kappa.
La spécificité de liaison du Rendomab-Bl a été établie par cytométrie de flux et par microscopie confocale, par marquage direct du Rendomab-Bl, ou indirect à l'aide d'un anticorps secondaire anti-souris fluorescent .
L'affinité (1 nM) et la spécificité exclusive du Rendomab-Bl pour le sous-type B humain de récepteur aux endothélines sont illustrées à la Figure 3.
La capacité du Rendomab-Bl à reconnaître l'ETB-
R lorsqu' il est surexprimé à la surface de cellules CHO est illustrée par microscopie confocale à la Figure 4.
L'inhibition spécifique de la liaison du Rendomab-Bl à ETB-R en surface de cellules CHO, par les trois endothélines humaines (ET1, ET2 et ET3) ainsi que par un analogue, la sarafotoxine c, sont illustrées aux Figures 5 et 6.
Les expériences de liaison par compétition ont été réalisées vis-à-vis de cellules CHO-ETB-R, en présence d' endothéline-1 marquée radio-activement à l'iode 125, ou fluorescente (ET-lfam) . Les résultats obtenus présentés à la Figure 7 montrent la capacité du Rendomab-Bl à inhiber la liaison d' ET-lfam, avec pour contrôle un anticorps témoin non pertinent de même isotype.
III. Propriétés pharmacologiques antagonistes.
L'étude des propriétés antagonistes du Rendomab-Bl a été réalisée sur une Station Flex 2 (Molecular Device) à l'aide d'un kit flux calcique de type Fluo4.
Le potentiel antagoniste du peptide BQ-788 (sel sodique de N- [ (cis-2, 6-diméthyl-l-piperidinyl) carbonyl] -4-méthyl-L-leucyl-l- (méthoxycarbonyl ) -D-tryptophyl-D- norleucine ; CAS : 156161-89-6), spécifique d'ETB-R, a été réalisé en parallèle.
Le flux calcique maximal a été établi en présence d'ET-1 seule ou associée à un anticorps témoin non pertinent de même isotype que le Rendomab-Bl.
Le potentiel antagoniste des propriétés pharmacologiques d'ETB-R (capacité à bloquer la libération de calcium intracellulaire normalement induite par l' endothéline-1 ) par le Rendomab-Bl ou par BQ-788, un inhibiteur peptidique classique d'ETB-R est présenté respectivement à la Figure 8A et à la Figure 8B. En conclusion, le Rendomab-Bl est un meilleur antagoniste d'ETB-R que le BQ-788.
IV. Clonage moléculaire.
Le clonage des précurseurs nucléiques codant la chaîne lourde et la chaîne légère du Rendomab-Bl, a été réalisé à l'aide des kits: « Gene-Elute/ARN totaux » (Sigma) et « RACE-PCR » (Invitrogen) .
Les séquences nucléiques et déduites en acides aminés des domaines variables de la chaîne légère (VL) et de la chaîne lourde (VH) du Rendomab-Bl sont présentées à la Figure 9.
V. Cartographie épitopique.
La cartographie de l'épitope reconnu par le
Rendomab-Bl à la surface d'ETB-R a été réalisée par la technique « Pep-scan » en collaboration et selon les protocoles développés au sein de I'UMR 3145 « SysDiag » CNRS/BioRad située à Montpellier (Dr. Claude Granier) .
Pour ce faire, 144 peptides de 12 acides aminés décalés d'un acide aminé chacun ont été utilisés. Ces peptides correspondent à l'ensemble des séquences d'ETB-R exposées du côté extra-cytoplasmique de la membrane .
Le résultat de l'analyse épitopique du
Rendomab-Bl est représenté à la Figure 10.
Les trois peptides identifiés dans cette analyse comme étant les mieux reconnus par le Rendomab- Bl sont les peptides de séquence :
- IMTPPTKTLWPKGSNASLARSLAPAEV correspondant aux résidus d'acides aminés 45 à 71 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO: 1) ;
SPPRTISPPPCQGPI correspondant aux résidus d'acides aminés 80 à 94 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO : 1 ) ;
TMDYKGSYLRICLLHPVQKTAFMQFYKTA correspondant aux résidus d'acides aminés 244 à 272 de la séquence en acides aminés du sous-type B des récepteurs aux endothélines (SEQ ID NO: 1) .
VI . Potentiel anti-prolifératif in vitro.
Le potentiel du Rendomab-Bl à ralentir la prolifération de cellules exprimant naturellement au moins de l'ETB-R a été testé sur des cellules HUVEC, qui sont des cellules endothéliales de la veine ombilicale humaine.
Après avoir établi l'effet prolifératif de l'ETl sur la multiplication cellulaire des HUVEC, une gamme du Rendomab-Bl, d'un anticorps témoin ou de BQ-
788, a été ajoutée dans le milieu de culture. L'effet de cet ajout a été suivi et mesuré.
Les résultats obtenus sont présentés à la
Figure 11. On observe 50% d'inhibition de croissance en présence du Rendomab-Bl par rapport à l'action prolifératrice de l' endothéline-1 (ET1) . L'ajout simultané du Rendomab-Bl et d'ETl ne modifie pas l'effet dû au Rendomab-Bl seul. Les deux contrôles négatifs, mettant en jeu un anticorps non pertinent (Ctrl IgG2b) seul ou en association à ET1, confirment bien l'effet anti-prolifératif induit par le Rendomab- Bl . Enfin, l'ajout d'un autre inhibiteur peptidique d'ETB-R (BQ-788) seul ou avec ET1 n'induit aucun effet sur la croissance des cellules Huvec. VII. Potentiel anti-prolifératif in vivo.
Le potentiel du Rendomab-Bl à ralentir la prolifération de cellules cancéreuses de mélanome humain, et exprimant naturellement au moins de l'ETB-R, a été testé sur des tumeurs implantées chez des souris nudes.
Le Rendomab-Bl est injecté par voie intra- péritonéale tous les 3 jours à une concentration de 10 mg/kg de souris, soit 0,2 mg d'anticorps par souris.
Les résultats obtenus sont présentés à la Figure 12. On observe un très net ralentissement du développement et ce, dès le sixième jour de traitement, volumique des tumeurs chez les souris traitées par le Rendomab-Bl, par rapport à l'absence de traitement. Ce résultat établit le potentiel et l'intérêt thérapeutique de l'anticorps objet de la présente demande, en particulier dans le cas de mélanomes, cancers contre lesquels aucun traitement spécifique n'existe à ce jour. VIII. Autres résultats obtenus sur des cellules
Huvec .
Les cellules endothéliales vasculaires humaines sont connues pour exprimer le récepteur ETB. De plus, ces cellules sont également capables de produire de l'ET-1, établissant ainsi une boucle autocrine qui favorise la prolifération, la survie et la formation de nouveaux vaisseaux. Ainsi, la lignée cellulaire Huvec, composée de cellules endothéliales humaines de veine ombilicale, a été utilisée pour évaluer le potentiel pharmacologique du Rendomab-Bl dans un modèle cellulaire physiologique, exprimant naturellement ETBR.
Les cellules HUVEC ont été exposées pendant 5 j à 500 nM de Rendomab-Bl, d'anticorps témoin, de BQ788 ou d'anticorps neutralisant anti-ET-1. A la fin du traitement, la viabilité cellulaire a été mesurée grâce à un test MTT.
Les résultats obtenus sont présentés dans la Figure 13. Après 5 j de traitement, le Rendomab-Bl induit une forte chute de la viabilité des cellules (une baisse d'environ 50% par rapport à l'anticorps témoin de même isotype) . Une baisse importante de la viabilité est également observée avec l'anticorps neutralisant anti-ETl ce qui confirme le rôle de la boucle autocrine ET1/ETBR dans la survie de ces cellules. Par contre, le traitement des cellules avec le BQ788 ne provoque qu'une légère diminution de la viabilité des Huvec.
Par ailleurs, le Rendomab-Bl a également été évalué pour sa capacité à moduler l'expression du récepteur ETB dans les cellules Huvec. Dans ces expériences, les cellules Huvec ont été préincubées avec 500 nM de Rendomab-Bl, d'anticorps témoin ou de BQ788 avant d'être stimulées avec 10 nM d'ETl. Après 24 h, le taux d'ARNm codant pour ETBR est déterminé par RT-PCR. Les résultats obtenus sont présentés dans la Figure 14. On constate que le Rendomab-Bl est non seulement capable d'inhiber l'augmentation ET1 dépendante du taux d'ARNm codant pour ETBR, mais aussi de provoquer une baisse significative de 25% de la quantité d'ARNm par rapport aux cellules témoins non stimulées. En revanche, aucun effet significatif n'est observé avec le BQ788. L'ensemble de ces résultats valident l'activité pharmacologique du Rendomab-Bl dans un modèle cellulaire physiologique et montrent la supériorité ce cet anticorps par rapport à l'antagoniste peptidique BQ788. De plus, étant donné l'importance du système ET1/ETBR dans les processus d' angiogenèse tumorale et d' immuno-évasion, le Rendomab-Bl apparaît donc comme un agent thérapeutique prometteur pour la thérapie cancéreuse .

Claims

REVENDICATIONS
1) Anticorps antagoniste du sous-type B des récepteurs aux endothélines , ledit anticorps présentant au moins une région variable de chaîne lourde comprenant un CDR3 présentant au moins au moins 80% d' identité avec la séquence en acides aminés suivante : ARNYDGYFDFW (SEQ ID NO: 2),
un fragment ou un dérivé de celui-ci.
2) Anticorps selon la revendication 1, caractérisé en ce que ledit anticorps présente au moins une région variable de chaîne lourde dont le CDR1, le CDR2 et le CDR3 présentent respectivement au moins 80% d'identité avec les séquences en acides aminés suivantes :
- GFSLTTYA (SEQ ID NO: 4) ;
- IWTGGDT (SEQ ID NO: 6) ;
- ARNYDGYFDFW (SEQ ID NO: 2) .
3) Anticorps selon la revendication 1 ou 2, caractérisé en ce que ledit anticorps comprend une région variable de chaîne lourde dont la séquence en acides aminés présentant au moins 80% d'identité avec la séquence suivante :
QVQLKESGPGLVAPSQSLSLTCTVTGFSLTTYAIVWVRQPPGKGLEW LGVIWTGGDTNYNSDLRSRLRIDKDNSRNQVFLKMSSLQTDDTARYYCARNYDGY FDFWGQGTTLTVSS (SEQ ID NO: 8) .
4) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps comprend une région variable de chaîne lourde dont la séquence en acides aminés correspond à la séquence en acides aminés SEQ ID NO: 8. 5) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps présente au moins une région variable de chaîne légère dont le CDR1 présente au moins 80% d' identité avec la séquence en acides aminés suivante : QNLLYSGNQKTY (SEQ ID NO: 10) .
6) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps présente au moins une région variable de chaîne légère dont le CDR1, le CDR2 et le CDR3 présentent respectivement au moins 80% d'identité avec les séquences en acides aminés suivantes :
- QNLLYSGNQKTY (SEQ ID NO: 10) ;
- WAS (SEQ ID NO: 12; ) ;
- QQYFIYPRT (SEQ ID NO: 14) .
7) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps comprend une région variable de chaîne légère dont la séquence en acides aminés présentant au moins 80% d'identité avec la séquence en acides aminés suivante :
DIVMSQSPSSLIVSVGQKVTMNCKSSQNLLYSGNQKTYLAWYQQKPG QSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAIYYCQQYFIYPR TFGGGTKLEIKR (SEQ ID NO: 16) . 8) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps comprend une région variable de chaîne légère dont la séquence en acides aminés correspond à la séquence en acides aminés SEQ ID NO: 16.
9) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps est une immunoglobuline de type IgG2b/kappa.
10) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps est monoclonal . 11) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps est l'anticorps murin monoclonal obtenu à partir de l'hybridome déposé à la CNCM le 30 septembre 2010 sous le numéro CNCM 1-4370.
12) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps est un anticorps chimérisé. 13) Anticorps selon l'une quelconque des revendications précédentes, caractérisé en ce que ledit anticorps est un anticorps humanisé.
14) Hybridome déposé à la CNCM le 30 septembre 2010 sous le numéro CNCM 1-4370. 15) Polynucléotide isolé choisi parmi les différents polynucléotides ci-après :
i) un polynucléotide codant un anticorps tel que défini à l'une quelconque des revendications 1 à 13 ;
ii) un polynucléotide complémentaire du polynucléotide tel que défini au point (i) ;
iii) un polynucléotide d'au moins 18 nucléotides, capable de s'hybrider dans des conditions de forte stringence aux polynucléotides tels que définis aux points (i) et (ii) .
16) Vecteur de clonage et/ou d'expression contenant au moins un polynucléotide selon la revendication 15.
17) Organisme hôte transformé par ou comprenant un polynucléotide selon la revendication 15 ou un vecteur selon la revendication 16.
18) Composé comprenant un anticorps selon l'une quelconque des revendications 1 à 13 conjugué avec un élément choisi dans le groupe constitué par un groupement cytotoxique, un groupement facilement détectable, ou un groupement effecteur.
19) Anticorps selon l'une quelconque des revendications 1 à 13, polynucléotide selon la revendication 15 ou composé selon la revendication 18 pour utilisation comme médicament. 20) Composition pharmaceutique comprenant, en tant que principe actif, un anticorps selon l'une quelconque des revendications 1 à 13, un polynucléotide selon la revendication 15 ou un composé selon la revendication 18 et un véhicule pharmaceutiquement acceptable .
21) Anticorps selon l'une quelconque des revendications 1 à 13, polynucléotide selon la revendication 15, composé selon la revendication 18 ou composition pharmaceutique selon la revendication 20, pour traiter et/ou prévenir un trouble ou une pathologie impliquant un dysfonctionnement, direct ou en association avec une autre voie physiologique, de l'axe comprenant une endothéline et au moins un de ses récepteurs tel que, notamment, le sous-type B des récepteurs aux endothélines .
22) Anticorps selon l'une quelconque des revendications 1 à 13, polynucléotide selon la revendication 15, composé selon la revendication 18 ou composition pharmaceutique selon la revendication 20, pour traiter et/ou prévenir un trouble ou une pathologie impliquant un défaut d' infiltration lymphocytaire par le système immunitaire.
23) Anticorps, polynucléotide, composé ou composition pharmaceutique selon la revendication 21 ou 22, caractérisé en ce que ledit trouble ou ladite pathologie est choisi (e) dans le groupe constitué par l'hypertension artérielle, l'athérosclérose, les maladies coronariennes, les dysfonctionnements rénaux, les maladies cérébrovasculaires , la maladie de Crohn, la fibrose pulmonaire, l'asthme, l' angiogenèse, un cancer et toute pathologie (infection ou foyer viral) qui affecte le système immunitaire en particulier par un défaut d'infiltration lymphocytaire ..
PCT/EP2011/067390 2010-10-06 2011-10-05 Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations WO2012045776A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR1058099A FR2965810B1 (fr) 2010-10-06 2010-10-06 Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations
FR1058099 2010-10-06

Publications (1)

Publication Number Publication Date
WO2012045776A1 true WO2012045776A1 (fr) 2012-04-12

Family

ID=44009975

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2011/067390 WO2012045776A1 (fr) 2010-10-06 2011-10-05 Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations

Country Status (2)

Country Link
FR (1) FR2965810B1 (fr)
WO (1) WO2012045776A1 (fr)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150183883A1 (en) * 2012-08-02 2015-07-02 Genentech, Inc. Anti-etbr antibodies and immunoconjugates
US20150196660A1 (en) * 2012-08-02 2015-07-16 Genentech, Inc. Anti-etbr antibodies and immunoconjugates
CN105669863A (zh) * 2014-12-05 2016-06-15 杭州鸿运华宁生物医药工程有限公司 一种能与人内皮素受体特异性结合的抗体及其应用
WO2017220739A1 (fr) 2016-06-24 2017-12-28 Commissariat A L'energie Atomique Et Aux Energies Alternatives Anticorps dirigé contre le sous-type bêta du récepteur de l'endothéline
WO2019155151A2 (fr) 2018-02-07 2019-08-15 Commissariat A L'energie Atomique Et Aux Energies Alternatives Anticorps dirigé contre le sous-type a des récepteurs aux endothélines et ses utilisations
CN113412280A (zh) * 2018-12-05 2021-09-17 海德格霍格有限公司 活性调节抗体
WO2024209089A1 (fr) * 2023-04-07 2024-10-10 Commissariat A L'energie Atomique Et Aux Energies Alternatives Utilisation d'anticorps contre le récepteur b de l'endothéline pour des applications diagnostiques et therapeutiques

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO2005095972A2 (fr) * 2004-03-19 2005-10-13 Bayer Healthcare Ag Composes destines au diagnostic et au traitement de maladies associees au recepteur couple aux proteines g etb (etb)
EP1609484A1 (fr) * 1999-05-04 2005-12-28 New York University Thérapie anticancéreuse faisant appel à des antagonistes du récepteur de l'endothèline
JP2008280266A (ja) 2007-05-09 2008-11-20 Sekisui Chem Co Ltd モノクローナル抗体

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP1609484A1 (fr) * 1999-05-04 2005-12-28 New York University Thérapie anticancéreuse faisant appel à des antagonistes du récepteur de l'endothèline
US20100003240A1 (en) 1999-05-04 2010-01-07 New York University Cancer treatment with endothelin receptor antagonists
WO2005095972A2 (fr) * 2004-03-19 2005-10-13 Bayer Healthcare Ag Composes destines au diagnostic et au traitement de maladies associees au recepteur couple aux proteines g etb (etb)
JP2008280266A (ja) 2007-05-09 2008-11-20 Sekisui Chem Co Ltd モノクローナル抗体

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
BAGNATO, ROSANO: "The endothelin axis in cancer", INT. J. OF BIOCHEM. & CELL BIOLOGY, vol. 40, 2008, pages 1443 - 1451, XP022655988, DOI: doi:10.1016/j.biocel.2008.01.022
BUCKANOVICH ET AL.: "Endothelin B receptor médiates the endothélial barrier to T cell homing to tumors and disables immune therapy", NATURE MEDECINE, vol. 14, 2008, pages 28 - 36
KANDALAFT ET AL.: "Endothelin B receptor, a new target in cancer immune therapy", CLIN. CANCER RES., vol. 15, 2009, pages 4521 - 4528
KONDOH ET AL.: "Isolation of anti-endothelin receptor monoclonal antibodies for use in receptor characterization", BBRC, vol. 172, 1990, pages 503 - 510, XP024843494, DOI: doi:10.1016/0006-291X(90)90701-N
R. SHAH: "Endothelins in health and disease", EUR. J. INT. MED., vol. 18, 2007, pages 272 - 282, XP022116662
SAMBROOK ET AL.: "Molecular cloning", 1989, COLD SPRING HARBOR LABORATORY PRESS
THIEME H ET AL: "Characterization of endothelin receptors in human trabecular meshwork cells", IOVS, vol. 45, no. Suppl. 2, 12 April 2004 (2004-04-12), & ANNUAL MEETING OF THE ASSOCIATION-FOR-RESEARCH-IN-VISION-AND-OPHTHALM OLOGY; FT LAUDERDALE, FL, USA; APRIL 24 -29, 2004, pages U434, XP008137101, ISSN: 0146-0404 *
VAUGHAN ET AL.: "Human antibodies by design", NATURE BIOTECHNOL., vol. 16, 1998, pages 535 - 539, XP000941675, DOI: doi:10.1038/nbt0698-535
VERHOEYEN ET AL.: "Reshaping human antibodies: Grafting an antilysozyme activity", SCIENCE, vol. 239, 1988, pages 1534 - 1536, XP002949269, DOI: doi:10.1126/science.2451287
YAMAGUCHI ET AL.: "Characterization and application of monoclonal antibodies against human endothelin B receptor expressed in insect cells", BIOTECHNOLOGY LETTERS, vol. 26, 2004, pages 293 - 299
YAMAGUCHI TOMOHIRO ET AL: "Characterization and application of monoclonal antibodies against human endothelin B receptor expressed in insect cells.", February 2004, BIOTECHNOLOGY LETTERS, VOL. 26, NR. 4, PAGE(S) 293-299, ISSN: 0141-5492, XP002638858 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9464141B2 (en) * 2012-08-02 2016-10-11 Genentech, Inc. Anti-ETBR antibodies and immunoconjugates
US20150196660A1 (en) * 2012-08-02 2015-07-16 Genentech, Inc. Anti-etbr antibodies and immunoconjugates
EP2879708A4 (fr) * 2012-08-02 2016-03-16 Genentech Inc Anticorps et immunoconjugués anti-etbr
EP2879711A4 (fr) * 2012-08-02 2016-03-16 Genentech Inc Anticorps et immunoconjugués anti-etbr
US20150183883A1 (en) * 2012-08-02 2015-07-02 Genentech, Inc. Anti-etbr antibodies and immunoconjugates
US9463251B2 (en) * 2012-08-02 2016-10-11 Genentech, Inc. Anti-ETBR antibodies and immunoconjugates
CN105669863B (zh) * 2014-12-05 2019-09-13 鸿运华宁（杭州）生物医药有限公司 一种能与人内皮素受体特异性结合的抗体及其应用
AU2016365191B2 (en) * 2014-12-05 2019-06-06 Gmax Biopharm Llc. Human endothelin receptor binding antibody and use thereof
US10376581B2 (en) 2014-12-05 2019-08-13 Gmax Biopharm Llc. Human endothelin receptor antibody and use thereof
CN105669863A (zh) * 2014-12-05 2016-06-15 杭州鸿运华宁生物医药工程有限公司 一种能与人内皮素受体特异性结合的抗体及其应用
US10869927B2 (en) 2014-12-05 2020-12-22 Gmax Biopharm Llc Human endothelin receptor antibody and use thereof
US11712470B2 (en) 2014-12-05 2023-08-01 Gmax Biopharm Llc Human endothelin receptor antibody and use thereof
WO2017220739A1 (fr) 2016-06-24 2017-12-28 Commissariat A L'energie Atomique Et Aux Energies Alternatives Anticorps dirigé contre le sous-type bêta du récepteur de l'endothéline
FR3053042A1 (fr) * 2016-06-24 2017-12-29 Commissariat Energie Atomique Anticorps dirige contre le sous-type b des recepteurs aux endothelines et ses utilisations
US11312780B2 (en) 2016-06-24 2022-04-26 Commissariat à l'énergie atomique et aux énergies alternatives Antibody directed against the endothelin receptor beta sub-type
WO2019155151A2 (fr) 2018-02-07 2019-08-15 Commissariat A L'energie Atomique Et Aux Energies Alternatives Anticorps dirigé contre le sous-type a des récepteurs aux endothélines et ses utilisations
US12084505B2 (en) 2018-02-07 2024-09-10 Commissariat A L'energie Atomique Et Aux Energies Alternatives Antibody against the endothelin receptor subtype A, and uses thereof
CN113412280A (zh) * 2018-12-05 2021-09-17 海德格霍格有限公司 活性调节抗体
WO2024209089A1 (fr) * 2023-04-07 2024-10-10 Commissariat A L'energie Atomique Et Aux Energies Alternatives Utilisation d'anticorps contre le récepteur b de l'endothéline pour des applications diagnostiques et therapeutiques

Also Published As

Publication number Publication date
FR2965810B1 (fr) 2012-12-28
FR2965810A1 (fr) 2012-04-13

Similar Documents

Publication Publication Date Title
CA2473039C (fr) Nouveaux anticorps anti-igf-ir et leurs applications
WO2012045776A1 (fr) Anticorps antagoniste du sous-type b des recepteurs aux endothelines et ses utilisations
KR20190104160A (ko) 항 gpr20 항체 및 항 gpr20 항체-약물 콘쥬게이트
KR20200060471A (ko) Cd39/cd73 축을 통한 t 세포 활성의 복원
FR3053042A1 (fr) Anticorps dirige contre le sous-type b des recepteurs aux endothelines et ses utilisations
KR20200088811A (ko) Atp 방출의 효과의 강화
HUE031151T2 (en) Pharmaceutical compositions resistant to soluble CEA
FR2888850A1 (fr) Nouveaux anticorps anti-igf-ir et leurs applications
EP1519960B1 (fr) Fragments fab mutans de l'anticorps anti-cd4 chimere 13b8.2 et leurs applications
FR2873699A1 (fr) Nouveaux anticorps anti igf ir rt leurs utilisations
HUE035910T2 (en) Anti-tumor combinations containing antibodies that specifically recognize cytarabine and CD38
FR2906533A1 (fr) Procede de generation d'anticorps actifs contre un antigene de resistance,anticorps obtenus par ledit procede et leurs utilisations
FR2929946A1 (fr) Nouveaux anticorps anti-cd151 et leur utilisation pour le traitement du cancer
WO2021170961A1 (fr) Conjugués anticorps-médicament anti-cd56 et leur utilisation en thérapie
CA3067380A1 (fr) Conjugues anticorps-medicament contenant des anticorps anti-globo h et leurs utilisations
KR20220075371A (ko) 면역계의 억제 수용체인 kir3dl3 및 그의 용도
WO2019155151A2 (fr) Anticorps dirigé contre le sous-type a des récepteurs aux endothélines et ses utilisations
JP7242082B2 (ja) 抗イヌｃｄ２０モノクローナル抗体
FR2834990A1 (fr) Nouveaux anticorps anti-igf-ir et leurs applications
FR2834991A1 (fr) Nouveaux anticorps anti-igf-ir et leurs applications
FR2834900A1 (fr) Nouvelles compositions a activite anti-igf-ir et anti-egfr et leurs applications
US20240254258A1 (en) Anti-alk antibodies and uses thereof
TW202408584A (zh) 抗體-藥物結合物與抗SIRPα抗體之組合
CA3140291A1 (fr) Adc pour un traitement concomitant ou posterieur au docetaxel
FR3101541A1 (fr) conjugués anticorps-médicament et leur utilisation en thérapie

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11767984

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11767984

Country of ref document: EP

Kind code of ref document: A1