WO2012009471A1 - Anti-angiogenic agent and method of using such agent - Google Patents

Anti-angiogenic agent and method of using such agent Download PDF

Info

Publication number
WO2012009471A1
WO2012009471A1 PCT/US2011/043907 US2011043907W WO2012009471A1 WO 2012009471 A1 WO2012009471 A1 WO 2012009471A1 US 2011043907 W US2011043907 W US 2011043907W WO 2012009471 A1 WO2012009471 A1 WO 2012009471A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
polypeptide
angiogenic
angiogenic agent
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/043907
Other languages
English (en)
French (fr)
Inventor
Zhi-Ren Liu
Jenny J. Yang
Yin LU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Georgia State University Research Foundation Inc
Original Assignee
Georgia State University Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2013519804A priority Critical patent/JP6353654B2/ja
Priority to AU2011279155A priority patent/AU2011279155B2/en
Priority to US13/739,241 priority patent/US9175063B2/en
Priority to PL11738546T priority patent/PL2593127T3/pl
Priority to DK11738546.8T priority patent/DK2593127T3/en
Priority to CA2804753A priority patent/CA2804753C/en
Priority to CN201180034591.9A priority patent/CN103002904B/zh
Priority to ES11738546.8T priority patent/ES2674409T3/es
Priority to EP11738546.8A priority patent/EP2593127B1/en
Priority to EP18168598.3A priority patent/EP3381462B1/en
Application filed by Georgia State University Research Foundation Inc filed Critical Georgia State University Research Foundation Inc
Publication of WO2012009471A1 publication Critical patent/WO2012009471A1/en
Anticipated expiration legal-status Critical
Priority to US14/928,890 priority patent/US11578114B2/en
Priority to AU2017201133A priority patent/AU2017201133A1/en
Priority to AU2019202174A priority patent/AU2019202174B2/en
Priority to AU2021201207A priority patent/AU2021201207A1/en
Priority to US18/169,097 priority patent/US12410230B2/en
Priority to AU2023202513A priority patent/AU2023202513A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70507CD2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis

Definitions

  • This disclosure relates to the inhibition or prevention of angiogenesis as a means to control or treat an angiogenic dependent condition, a condition characterized by, or dependent upon, blood vessel proliferation.
  • the disclosure further relates to the use of an anti-angiogenic agent in combination with a chemotherapeutic agent.
  • Angiogenesis is the process by which new blood vessels are formed from extant capillaries, while vasculogenesis involves the growth of vessels deriving from endothelial progenitor cells.
  • Angiogenesis is a combinatorial process that is regulated by a balance between pro- and anti-angiogenic molecules.
  • Angiogenic stimuli e.g. hypoxia or inflammatory cytokines
  • VEGF vascular endothelial growth factor
  • FGF fibroblast growth factor
  • These growth factors stimulate endothelial cells (EC) in the existing vasculature to proliferate and migrate through the tissue to form new endothelialized channels.
  • Angiogenesis is involved the proliferation of endothelial cells.
  • angiogenesis is involved in the growth of atherosclerotic plaque, diabetic retinopathy, degenerative maculopathy, retrolental fibroplasia, idiopathic pulmonary fibrosis, acute adult respiratory distress syndrome, and asthma. Furthermore, tumor progression is associated with neovascularization, which provides a mechanism by which nutrients are delivered to the progressively growing tumor tissue. While the concept of slowing or even halting the progression of cancer by targeting its blood supply was first proposed more than 30 years ago), angiogenesis inhibitors are only now entering the mainstream of cancer therapeutics.
  • FIG. 1A is schematic drawing of an anti-angiogenic showing the two short strands of anti-parallel ⁇ -sheet of the protein.
  • FIG. IB is another schematic drawing of an anti-angiogenic showing the two short strands of anti-parallel ⁇ -sheet of the protein in which the hydrophobic surface is facing outward.
  • FIG. 1C is another schematic drawing of an anti-angiogenic showing the two short strands of anti-parallel ⁇ -sheet of the protein in which the hydrophobic surface is facing inward.
  • FIG. 2 shows the NMR spectrum of a folded (top) and an unfolded (bottom) anti- angiogenic agent and host protein.
  • FIG. 3A shows a proliferation assay of an anti-angiogenic agent versus a prior art agent (Anginex) with HUVEC cells.
  • FIG. 3B shows a proliferation assay of an anti-angiogenic agent versus a prior art agent (Anginex) with M4A4 cancer cells.
  • FIG. 4A shows graphically that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 8 days.
  • FIG. 4B shows graphically that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 22 days.
  • FIG. 5 shows graphically that there were substantial differences in the tumor weights by the end of the first treatment with an anti-angiogenic agent.
  • FIG. 6 shows pictorially that the tumors grew in normal rate in the mice treated with buffer and the host proteins, and substantially slow in the mice treated with the anti-angiogenic agent.
  • FIG. 7 shows that the results of vessel density studies of mice treated with an anti- angiogenic agent.
  • FIG. 8 shows that no significant changes in mice body mass were observed in any treatment group.
  • FIG. 9 shows that cell viability can vary with dose.
  • FIG. 10 shows the growth curve of the tumor through 14 days or more of treatment using different doses of the anti-angiogenic agent.
  • FIG. 11 is the tumor growth curve of Avastin® and rProAgio-PEG.
  • FIG. 12 shows graphic representation of the weight of the tumor at end of 14 day treatment course
  • Angiogenesis is defined as any alteration of an existing vascular bed or the formation of new vasculature which benefits tissue perfusion. This includes the formation of new vessels by sprouting of endothelial cells from existing blood vessels or the remodeling of existing vessels to alter size, maturity direction or flow properties to improve blood perfusion of tissue.
  • amino acid refers to naturally occurring and non-natural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, by way of example only, an alpha. -carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group. Such analogs may have modified R groups (by way of example, norleucine) or may have modified peptide backbones, while still retaining the same basic chemical structure as a naturally occurring amino acid.
  • Non-limiting examples of amino acid analogs include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
  • “conservatively modified variants” applies to both natural and non-natural amino acid and natural and non-natural nucleic acid sequences, and combinations thereof.
  • “conservatively modified variants” refers to those natural and non-natural nucleic acids which encode identical or essentially identical natural and non-natural amino acid sequences, or where the natural and non-natural nucleic acid does not encode a natural and non-natural amino acid sequence, to essentially identical sequences.
  • a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
  • nucleic acid variations are "silent variations," which are one species of conservatively modified variations.
  • every natural or non-natural nucleic acid sequence herein which encodes a natural or non-natural polypeptide also describes every possible silent variation of the natural or non-natural nucleic acid.
  • each codon in a natural or non-natural nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • each silent variation of a natural and non-natural nucleic acid which encodes a natural and non-natural polypeptide is implicit in each described sequence.
  • an agent or a compound being administered refers to a sufficient amount of an agent or a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result can be reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
  • an agent or a compound being administered includes, but is not limited to, a natural amino acid polypeptide, non-natural amino acid polypeptide, modified natural amino acid polypeptide, or modified non-amino acid polypeptide.
  • compositions containing such natural amino acid polypeptides, non-natural amino acid polypeptides, modified natural amino acid polypeptides, or modified non-natural amino acid polypeptides can be administered for prophylactic, enhancing, and/or therapeutic treatments.
  • An appropriate "effective" amount in any individual case may be determined using techniques, such as a dose escalation study.
  • nucleic acid sequence refers to the order and identity of the nucleotides comprising a nucleic acid.
  • Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in single- or double-stranded form.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
  • PNAs peptide-nucleic acids
  • nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues.
  • nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
  • a particular nucleic acid sequence also implicitly encompasses "splice variants.”
  • a particular protein encoded by a nucleic acid implicitly encompasses any protein encoded by a splice variant of that nucleic acid.
  • "Splice variants,” as the name suggests, are products of alternative splicing of a gene. After transcription, an initial nucleic acid transcript may be spliced such that different (alternate) nucleic acid splice products encode different polypeptides.
  • Mechanisms for the production of splice variants vary, but include alternate splicing of exons. Alternate polypeptides derived from the same nucleic acid by read-through transcription are also encompassed by this definition. Any products of a splicing reaction, including recombinant forms of the splice products, are included in this definition.
  • polypeptide peptide
  • protein protein
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
  • pharmaceutically acceptable refers to a material, including but not limited, to a salt, carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively nontoxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
  • prophylactically effective amount refers that amount of a composition containing at least one non-natural amino acid polypeptide or at least one modified non-natural amino acid polypeptide prophylactically applied to a patient which will relieve to some extent one or more of the symptoms of a disease, condition or disorder being treated. In such prophylactic applications, such amounts may depend on the patient's state of health, weight, and the like. It is considered well within the skill of the art for one to determine such prophylactically effective amounts by routine experimentation, including, but not limited to, a dose escalation clinical trial.
  • substantially similar in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 75%, preferably at least 85%, more preferably at least 90%, 95% or higher or any integral value therebetween nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm such as those described below for example, or by visual inspection.
  • the substantial identity exists over a region of the sequences that is at least about 10, preferably about 20, more preferable about 40-60 residues in length or any integral value therebetween, preferably over a longer region than 60-80 residues, more preferably at least about 90-100 residues, and most preferably the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
  • synergistic refers to a combination of prophylactic or therapeutic effective agents which is more effective than the additive effects of any two or more single agents.
  • a synergistic effect of a combination of prophylactic or therapeutic agents may permit the use of lower dosages of one or more of the agents and/or less frequent administration of the agents to a subject with a specific disease or condition.
  • a synergistic effect of a combination of prophylactic or therapeutic agents may be used to avoid or reduce adverse or unwanted side effects associated with the use of any single therapy.
  • terapéuticaally effective amount refers to the amount of a composition containing at least one non-natural amino acid polypeptide and/or at least one modified non-natural amino acid polypeptide administered to a patient already suffering from a disease, condition or disorder, sufficient to cure or at least partially arrest, or relieve to some extent one or more of the symptoms of the disease, disorder or condition being treated.
  • the effectiveness of such compositions depend conditions including, but not limited to, the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
  • therapeutically effective amounts may be determined by routine experimentation, including but not limited to a dose escalation clinical trial.
  • This disclosure provides an anti-angiogenenic agent and a method of inhibiting angiogenesis in which the dependent condition in a mammal is treated by the administering an anti-angiogenic agent to the mammal, in a therapeutically effective amount and frequency to produce a regression or arrest of the condition without significant toxicity.
  • neoplasm including a solid tumor neoplasm, including breast carcinoma, lung carcinoma, prostate carcinoma, colon carcinoma, prostate carcinoma, ovarian carcinoma, neuroblastoma, central nervous system tumor, neuroblastoma, glioblastoma multiforme or melanoma. While no list can be complete, the anti-angiogenic agent may be used to produce a regression or arrest of most, if not all, solid tumors.
  • the mammal receiving the treatment can be a human.
  • the anti-angiogenic agent includes a variation of polypeptides derived from domain one of CD2, which may originate from human and non- human sources. More specifically, the structure and function of domain one of CD2 were altered to prepare new polypeptides with varied stability and activity. In some examples, the alterations could be used to prepare at least two short strands of anti-parallel ⁇ -sheet (e.g. FIGs. 1 A, IB, and 1C) that mimic the active moiety of several endogenous anti-angiogenic polypeptides, such as PF4, IL8, TSP-1, Endostatin, and other synthetic peptides.
  • endogenous anti-angiogenic polypeptides such as PF4, IL8, TSP-1, Endostatin, and other synthetic peptides.
  • the anti- angiogenic agent or polypeptide can have a ⁇ -sheet formed by two segments, an anti-parallel fold, an inward-facing hydrophobic surface, an outward-facing hydrophilic surface; and the two segment of have at least four amino acids. In other examples, it was found that six or more amino acids constituted a segment. In yet other examples , it was found that eight or more amino acids constituted a segment.
  • the amino acid residues may alternative between hydrophilicility and hydrophobicity (e.g., hydrophilic-hydrophobic-hydrophilic-hydrophobic or hydrophilic- hydrophobic-hydrophobic).
  • 1"hQ anti-angiogenic agents have many in vivo, in vitro and ex vivo utilities, which include anfi-atigiogenic properties in clinical and non-clinical settings.
  • Methods for preparing or creating systematic polypeptide variation through directed evolution techniques are known in the art. It is contemplated ⁇ nd understood that methods disclosed herein may be used to prepare other non-CD2 polypeptides with at least two short strands of anti-parallel ⁇ -sheet.
  • the anti-angiogenic agent can be prepared using rational polypeptide design.
  • Rational design includes methods in which the amino acid residues in a polypeptide sequence are identified and predicted to have a specific impact on a polypeptide.
  • one such method includes preparing a training set of a polypeptide variants in which the data provides activity and sequence information for each polypeptide variant in the training set; deriving an activity model that is able to predicts the activity based on alterations of specific amino acid; and using the model to identify one or more amino acids at specific positions in one or more polypeptide that have specific activities and properties.
  • the anti-angiogenic agent can be prepared by creating mutations within the host polypeptide or domain one of CD2 (e.g. Sequence ID Nos. 4, 5, and 7).
  • One of ordinary skill in the art can prepare specific anti-angiogenic agents using recombinant technology. For example, one may prepare the appreciate nucleic acid of the polypeptides or polypeptides in SEQ ID NOs: 1-11 using ordinary methods. Alternatively, the polypeptides of SEQ ID NOS: 1-11 can be generated by site directed mutagenesis techniques, to produce a desired anti-angiogenic agent. Any nucleic sequence which differs from any sequence, including Sequence ID Nos: 1 through 11, may be altered due to the degeneracy of the genetic code. The mutated nucleic acid sequence may then be subcloned into an appropriate expression vector and expressed in a host such as yeast or E. coli. After preparation, purification techniques are obvious to those with ordinary skill in the art.
  • the anti-angiogenic agent can include N-linked glycosylation.
  • the N-linked glycosylation process occurs in eukaryotes and has implications in polypeptide folding, polypeptide solubility, and long blood circulation.
  • N-linked glycosylation may require the consensus sequence Asn-X-Ser/Thr and occurs more often when this consensus sequence occurs in a loop in the peptide.
  • the N-linked glycosylation sites were at positions N65.
  • the anti-angiogenic agents control or inhibit angiogenesis.
  • the inhibition of angiogenesis is generally considered to be the halting of the development of new blood vessels, whether they develop by sprouting or by the arrival and subsequent differentiation into endothelial cells of circulating stem cells.
  • inhibition of angiogenesis should also be construed to include the killing of cells, particularly cells in existing vessels near or within a tumor when activated by tumor angiogenesis factors.
  • inhibition of angiogenesis should be construed to include inhibition of the development of new vessels, which inhibition may or may not be accompanied by the destruction of nearby existing vessels.
  • the anti-angiogenic agent appears to inhibit or prevent angiogenesis by inhibiting or controlling apoptosis.
  • the developed polypeptides demonstrated strong activity in the induction of endothelial cell apoptosis without effects on epithelial and fibroblast cells in the in vitro analyses.
  • the developed polypeptides exerted less effect on tube structure formed by HUVEC cells, which suggests less toxicity on already existing normal blood vessels.
  • Survival factors include vascular endothelial cell growth factors or mitogens, as well as those factors which do not appear to have a direct growth-stimulatory effect but allow the cells to recover from injury.
  • anti-angiogenic agents may be incorporated into methods of treating a mammal by inhibiting angiogenesis that include the steps of administering the anti-angiogenic agents.
  • the anti-angiogenic polypeptide exhibited extended circulation time compared to small molecules and short peptide agents.
  • Specific embodiments provide methods of inhibiting angiogenesis and methods of treating angiogenesis-associated diseases.
  • the present invention provides methods of inhibiting or reducing tumor growth and methods of treating an individual suffering from cancer. These methods involve administering to the individual a therapeutically effective amount of one or more polypeptide therapeutic agents as described above. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
  • angiogenesis-associated diseases include, but are not limited to, angiogenesis-dependent cancer, including, for example, solid tumors, blood born tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; inflammatory disorders such as immune and non-immune inflammation; chronic articular rheumatism and psoriasis; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis; Osier- Webber Syndrome; myocardial angiogenesis; plaque neovascularization; telangiectasia; hemophiliac joints; angiofibroma; and wound granulation and wound healing; telangiectasia ps
  • One potential benefit of the combination of an anti-angiogenic agent and a chemotherapeutic agent may be an improvement in the treatment and control of an angiogenic dependent condition with reduced doses of a chemotherapeutic agent.
  • the combination can be administered for a prolonged period of time, or optionally a shorter duration of treatment may be administered due to the increased effectiveness of the combination.
  • administration of the polypeptide therapeutic agents of the invention may be continued while the other therapy is being administered and/or thereafter.
  • Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses.
  • administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
  • the anti-angiogenesis agent can be administered in combination chemotherapeutic and other therapeutic agents, as well as radio-therapies.
  • the chemotherapeutic agent may be selected from the group consisting of vinca alkaloid, camptothecan, taxane, or platinum analogue, including vincristine, vinblastine, vinorelbine, vindesine, paclitaxel, docetaxel, 5 FU, cisplatin, carboplatin, irinotecan, topotecan or cyclophosphamide.
  • the chemotherapeutic agent can be administered in a low-dose regimen, in combination with the anti-angiogenic agent because of the anti-tumor effect of the anti-angiogenic agent.
  • the chemotherapeutic agent can be administered at less than the maximum tolerated dose.
  • the anti-angiogenic agent may be used with anti-neoplastic agents, including the following anti-neoplastic agents : Acivicin; Aclarubicin; Acodazole Hydrochloride; AcrQnine; Adozelesin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carbo
  • anti-neoplastic compounds include: 20-epi-l,25 dihydroxyvitamin D3; 5- ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL- TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; atrsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsalizing morphogenetic polypeptide- 1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara-CDP-DL-
  • Anti-cancer Supplementary Potentiating Agents include the following Supplementary Potentiating Agents: Anti-cancer Supplementary Potentiating Agents: Tricyclic anti-depressant drugs (e.g., imipramine, desipramine, amitryptyline, clomipramine, trimipramine, doxepin, nortriptyline, protriptyline, amoxapine and maprotiline); non-tricyclic anti-depressant drugs (e.g., sertraline, trazodone and citalopram); Ca.sup.++ antagonists (e.g., verapamil, nifedipine, nitrendipine and caroverine); Calmodulin inhibitors (e.g., prenylamine, trifluoroperazine and clomipramine); Amphotericin B; Triparanol analogues (e.g., tamoxi), imipramine, desipramine, amitryptyline,
  • One embodiment also includes a kit for treating an angiogenic dependent condition in a mammal comprising an anti-angiogenic agent and a chemotherapeutic agent.
  • the combination of agents is provided to allow administration in an amount and frequency therapeutically effective to produce an inhabitation or regression of angiogenesis.
  • the anti-angiogenic agent and/or polynucleotides are administered alone or in combination with an anti-inflammatory agent.
  • Anti-inflammatory agents that may be administered with the anti- angiogenic agents of the invention include, but are not limited to, corticosteroids (e.g.
  • Pharmaceutical agents include the following categories and specific examples. It is not intended that the category be limited by the specific examples. Those of ordinary skill in the art will be able to identify readily those pharmaceutical agents that have utility outside of the central nervous system. Those of ordinary skill in the art will recognize also numerous other compounds that fall within the categories and that are useful according to the invention.
  • polyethylene glycol may be used to derivatize polypeptides of the invention, include, for example, poly(ethylene glycol) (PEG), polyvinylpyrrolidone), polyoxomers, polysorbate and poly(vinyl alcohol), with PEG polymers being particularly preferred.
  • PEG polymers are PEG polymers having a molecular weight of from about 100 to about 40,000.
  • Other suitable hydrophilic polymers in addition to those exemplified above, will be readily apparent to one skilled in the art based on the present disclosure.
  • the polymers used may include polymers that can be attached to the polypeptides of the invention via alkylation or acylation reactions.
  • the anti-angiogenic agent was PEGylated with a PEG-chain of 20 kDa.
  • polyethylene glycol molecules should be attached to the polypeptide with consideration of effects on functional or antigenic domains of the polypeptide.
  • attachment methods available to those skilled in the art.
  • polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group.
  • Reactive groups are those to which an activated polyethylene glycol molecule may be bound.
  • the amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue.
  • Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules.
  • Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.
  • polyethylene glycol as an illustration of the present composition, one may select from a variety of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to polypeptide (polypeptide) molecules in the reaction mix, the type of pegylation reaction to be performed, and the method of obtaining the selected N-terminally pegylated polypeptide. Under the appropriate reaction conditions, substantially selective derivatization of the polypeptide at the N-terminus with a carbonyl group containing polymer is achieved.
  • a variety of administration routes are available. The particular mode selected can depend upon the anti-angiogenic agent, the particular condition being treated and the dosage required for efficacy. These methods may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces effective levels of an immune response without causing clinically unacceptable adverse effects. Certain modes of administration are parenteral routes.
  • compositions comprise a therapeutically effective amount of active component (e.g., the anti- angiogenic agent, the anti-angiogenic agent plus chemotherapeutic or the anti-angiogenic agent plus anti-inflammatory agent), and a pharmaceutically acceptable carrier.
  • active component e.g., the anti- angiogenic agent, the anti-angiogenic agent plus chemotherapeutic or the anti-angiogenic agent plus anti-inflammatory agent
  • pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • the composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
  • Such compositions will contain a therapeutically effective amount of the anti-angiogenic agent together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
  • the formulation should suit the mode of administration.
  • the amount of the anti-angiogenic agent that will be effective in the treatment can be determined by standard clinical techniques.
  • in vitro assays may optionally be employed to help identify optimal dosage ranges.
  • the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
  • the agent or pharmaceutical compositions can be tested in vitro, and then in vivo for the desired therapeutic or prophylactic activity, prior to use in humans.
  • in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include, the effect of a compound on a cell line or a patient tissue sample.
  • the effect of the compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays.
  • in vitro assays which can be used to determine whether administration of a specific compound is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the tissue sample is observed.
  • the anti-angiogenic agent can be formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
  • compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
  • the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
  • an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • a compound of the invention e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis, construction of a nucleic acid as part of a retroviral or other vector, etc.
  • Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
  • the compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
  • the anti-angiogenic agent may be desirable to administer the anti-angiogenic agent locally to the area in need of treatment.
  • This may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
  • the nucleic acid can be administered in vivo to promote expression of its encoded polypeptide, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector, or by direct injection, or by use of microparticle bombardment, or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-like peptide which is known to enter the nucleus, etc.
  • a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
  • inventions are directed to vectors containing a polynucleotide encoding anti- angiogenic agent, host cells, and the production of anti-angiogenic agent by synthetic and recombinant techniques.
  • the vector may be, for example, a phage, plasmid, viral, or retroviral vector. Retroviral vectors may be replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells.
  • the polynucleotides encoding the anti-angiogenic agent may be joined to a vector containing a selectable marker for propagation in a host.
  • a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid.
  • the polynucleotide insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few. Other suitable promoters will be known to the skilled artisan.
  • the expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome binding site for translation.
  • the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
  • the expression vectors will preferably include at least one selectable marker.
  • regulatory genes and sequence may be used with the expression and replication of the anti-angiogenic agent.
  • the nature of the regulatory sequences for gene expression may vary between species or cell types, but shall in general include, as necessary, 5' non-transcribing and 5' non-translating sequences involved with initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, and the like. Promoters may be constitutive or inducible. Regulatory sequences may also include enhancer sequences or upstream activator sequences, as desired.
  • polynucleotides encoding the anti-angiogenic agent may be fused to polynucleotides encoding signal sequences which will direct the localization of a polypeptide to particular compartments of a prokaryotic or eukaryotic cell and/or direct the secretion of a polypeptide.
  • signal sequences which will direct the localization of a polypeptide to particular compartments of a prokaryotic or eukaryotic cell and/or direct the secretion of a polypeptide.
  • E. coli one may wish to direct the expression of the protein to the periplasmic space.
  • vectors are commercially available for the construction of fusion proteins which will direct the localization of a protein.
  • stents comprising a generally tubular structure (which includes for example, spiral shapes), the surface of which is coated with an anti- angiogenic agent as described above.
  • a stent can be a scaffolding, usually cylindrical in shape, that may be inserted into a body passageway (e.g., bile ducts) or a portion of a body passageway, which has been narrowed, irregularly contoured, obstructed, or occluded by a disease process (e.g., ingrowth by a tumor) in order to prevent closure or reclosure of the passageway.
  • a body passageway e.g., bile ducts
  • a disease process e.g., ingrowth by a tumor
  • an anti-angiogenic agent a wide variety of surgical procedures.
  • an anti-angiogenic protein in the form of, for example, a spray or film
  • a spray or film may be utilized to coat or spray an area prior to removal of a tumor, in order to isolate normal surrounding tissues from malignant tissue, and/or to prevent the spread of disease to surrounding tissues.
  • surgical meshes which have been coated with anti-angiogenic protein may be utilized in any procedure wherein a surgical mesh might be utilized.
  • the anti-angiogenic agent was expressed and purified from bacterial E.coli. To help ensure the designed polypeptide still folds properly, the structure was confirmed with 1 H-NMR analyses.
  • the NMR spectrum of anti-angiogenic agent (120 ⁇ ) and CD2-D1 (120 ⁇ ) were compared. As shown in FIG. 2, the NMR spectrum of the anti-angiogenic agent was almost identical to that of CD2-D1 (top), whereas the unfolded polypeptide (by organic solvent) showed completely different spectrum (bottom).
  • the resulting polypeptide exhibited very similar structural property as demonstrated by similarity of 1 H-NMR, CD, and fluorescence spectrum of both the host protein and the developed protein.
  • cell viability assays were carried out using HUVEC cells.
  • the cells were treated by various concentrations of one example of developed anti-angiogenic agent, anginex, and host polypeptide with which the anti-angiogenic agent was derived.
  • the anti-angiogenic agent was more effective in apoptosis induction of the HUVEC cells (Fig. 2A).
  • cell proliferation assays were carried out with HUVEC, M4A4, cells in the presence of 5 ⁇ or 10 ⁇ of Anti-angiogenic agent, Anginex, and host protein.
  • FIGs. 3B and 9 it was clear that strong inhibition in cell proliferation by the agent with HUVEC cells, while no effects was observed with epithelial M4A4 cells. The observations indicated that the effects of anti-angiogenic agent were endothelial cell specific.
  • Example 3 Inhibition of tumor growth of xenograft of PC-3 cells
  • a xenograft model of PC-3 cells was prepared using immunodeficiency mice. Tumor bearing mice (6 mice per group) were treated with anti- angiogenic agent (10 mg/kg), PEGylated anti-angiogenic agent (10 mg/kg), host protein (10 mg/kg), and buffer saline for two weeks via daily dose. The treatments were started 7 days post tumor inoculation. The tumors were measured either by volume or by bioluminescence of tumor cells.
  • FIG. 4A shows graphically that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 8 days.
  • FIG. 4B shows graphically the dose dependant effect and that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 22 days. While as controls, the tumors grew in normal rate in the mice treated with buffer and the host proteins. At the end of treatment course, tumors in each treatment group were cut out and weighted.
  • Example 4 Vessel density after the treatments
  • FIG. 7 shows that the vessel density, monitored using immunofiuorecense staining of tumor tissue sections collected from treated mice, was dramatically reduced after treatment with Anti-angiogenic agent with PEGylated anti-angiogenic agent compared to the group of treatment with PEGylated host protein and buffer.
  • the tumors after treatments were harvested. Tissue slides were prepared from the collected tumors. The slides were immunostained with antibody against CD31, a molecular marker specific for endothelial cells. The immunostaining of the tumor tissue slides were visualized by confocal microscopy. The results indicated that anti-angiogenic agent and have specific effects on tumor angiogensis.
  • Toxicity of the parental protein of domain 1 of CD2 was previously analyzed and was not toxic in mice.
  • the toxicity of the anti-angiogenesis polypeptide was examined using CD-I mice. Firstly, the body weights of tumor bearing nude mice were carefully monitored during 14 days treatment course. As shown in FIG. 8, no significant changes in mice body weight were observed in any treatment group. In addition, the toxicity was test in normal CD-I mice. Three groups of mice (7 mice per group) were injected i.v. with one dose, two doses and three doses of 100 ⁇ of the polypeptide (100 mg/kg, 20 times of used dosage) with three days interval between each injection. The animals were returned to their cages for 30 days. No deaths were observed among the tested mice. All animals behaved normally (no change in eating habits; no abnormal weight gain or loss; no abnormal appearance on fur).
  • the toxicity studies showed that the anti-angiogenic agent and anti-angiogenic agent with PEG did not have acute toxicity for at least three doses that were approximately 20 fold higher than the dosage used in our tumor mice treatment.
  • the polypeptide shown in Sequence ID No: 11 was expressed and purified from the Pichia pastoris expression system. Expression of this polypeptide in yeast Pichia pastoris was achieved by both intracellular and secretion expression. This polypeptide was further purified using an ion exchange column. The polypeptide was expressed as a His-tag polypeptide. The His-tag was removed by thrombin cleavage. The glycosylated protein expressed and purified from Yeast Pichia pastoris was an anti-angiogenetic agent and was found have N-linked glycosylation. As shown in FIG. 13, cells treated by various examples of the anti-angiogenic agent showed robust viability.
  • SEQ ID NO:l is the amino acid sequence of domain one of CD2 from a rat (WT Rat CD2-D1):
  • SEQ ID NO:2 is the amino acid sequence of domain one of CD2 from human (WT Human CD2-D1): KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFK EKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER
  • SEQ ID NO:3 referred to as MIWT or Angiol, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NOl by mutations W7Q, G8M, A9K, D94N, R96K, I97V, L98I, and E99I:
  • SEQ ID NO: 4 is the amino acid sequence of a variant domain one of CD2 d derived from SEQ ID NOl by mutations E41I, K43V, K45L, M46G, K47S, P48V, and G53L:
  • SEQ ID NO:5 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NOl by mutations E41N, M46Q, and F49S:
  • SEQ ID NO:6 referred to as ProAngio-PEG or Angio2, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID N03 by mutations M23C:
  • SEQ ID NO: 7 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NOl by mutations E41I, K43V, K45L, M46G, K47S, and F49S:
  • SEQ ID NO:8 is the amino acid sequence of a variant domain one of CD2:
  • SEQ ID NO:9 referred to as hProAngioB or Angio3 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID N02 by mutations E8S, T9V, W10Q, Gl 1M, A12K, D99N, II 02V, Q103I, and El 041:
  • SEQ ID NO: 10 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO:9 by mutations M30C:
  • SEQ ID NO: 11 referred to as hProAngioY or Angio5
  • hProAngioY is the amino acid sequence of a variant domain one of CD2 form yeast:
  • FIG. 10 shows the growth curve of the tumor through 14 days or more of treatment.
  • the results show that hProAgio or Angio4, developed from the polypeptide encoding seq. Id. No. 10, was effective in suppressing tumor growth.
  • the experiments were carried out using PC-3 xenograft using hProAgio or Angio4 (10 mg/kg, daily dose) and using buffered saline as a control. The treatments were started 8 days post tumor inoculation.
  • FIG. 11 is the tumor growth curve of Avastin® and rProAgio-PEG or Angio2.
  • FIG. 12 shows graphic representation of the weight of the tumor at end of 14 day treatment course - the tumors in each treatment group were extracted and weighed. There were significant differences in the tumor weights and growth of the animal groups that were treated by Angio2 and Avastin®.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Diabetes (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Endocrinology (AREA)
  • Obesity (AREA)
  • Emergency Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Hematology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Cardiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2011/043907 2010-07-13 2011-07-13 Anti-angiogenic agent and method of using such agent Ceased WO2012009471A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
AU2011279155A AU2011279155B2 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and method of using such agent
US13/739,241 US9175063B2 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and methods of using such agent
PL11738546T PL2593127T3 (pl) 2010-07-13 2011-07-13 Środek antyangiogenny i sposób zastosowania takiego środka
DK11738546.8T DK2593127T3 (en) 2010-07-13 2011-07-13 ANTIANGIOGENTIC AGENT AND METHOD OF USING SUCH AGENTS
CA2804753A CA2804753C (en) 2010-07-13 2011-07-13 Anti-angiogenic cd2 derived polypeptide for treating angiogenesis-dependent disorder
CN201180034591.9A CN103002904B (zh) 2010-07-13 2011-07-13 抗血管生成药剂及使用这种药剂的方法
ES11738546.8T ES2674409T3 (es) 2010-07-13 2011-07-13 Agente antiangiogénico y método de uso de tal agente
EP18168598.3A EP3381462B1 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and method of using such agent
EP11738546.8A EP2593127B1 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and method of using such agent
JP2013519804A JP6353654B2 (ja) 2010-07-13 2011-07-13 抗血管新生剤及びこのような薬剤の使用方法
US14/928,890 US11578114B2 (en) 2010-07-13 2015-10-30 Anti-angiogenic agent and methods of using such agent
AU2017201133A AU2017201133A1 (en) 2010-07-13 2017-02-20 Anti-Angiogenic Agent and Method of Using Such Agent
AU2019202174A AU2019202174B2 (en) 2010-07-13 2019-03-29 Anti-angiogenic agent and method of using such agent
AU2021201207A AU2021201207A1 (en) 2010-07-13 2021-02-24 Anti-angiogenic agent and method of using such agent
US18/169,097 US12410230B2 (en) 2010-07-13 2023-02-14 Anti-angiogenic agent and methods of using such agent
AU2023202513A AU2023202513A1 (en) 2010-07-13 2023-04-26 Anti-angiogenic agent and method of using such agent

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US36393310P 2010-07-13 2010-07-13
US61/363,933 2010-07-13

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/739,241 A-371-Of-International US9175063B2 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and methods of using such agent
US14/928,890 Continuation US11578114B2 (en) 2010-07-13 2015-10-30 Anti-angiogenic agent and methods of using such agent

Publications (1)

Publication Number Publication Date
WO2012009471A1 true WO2012009471A1 (en) 2012-01-19

Family

ID=44629339

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/043907 Ceased WO2012009471A1 (en) 2010-07-13 2011-07-13 Anti-angiogenic agent and method of using such agent

Country Status (12)

Country Link
US (2) US9175063B2 (https=)
EP (2) EP2593127B1 (https=)
JP (2) JP6353654B2 (https=)
CN (1) CN103002904B (https=)
AU (5) AU2011279155B2 (https=)
CA (1) CA2804753C (https=)
DK (1) DK2593127T3 (https=)
ES (2) ES2923430T3 (https=)
HU (1) HUE040205T2 (https=)
PL (1) PL2593127T3 (https=)
PT (2) PT2593127T (https=)
WO (1) WO2012009471A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3265482A4 (en) * 2015-03-06 2018-11-21 Georgia State University Research Foundation, Inc. Integrin-targeting protein and methods of use thereof
RU2806524C2 (ru) * 2015-03-06 2023-11-01 Джорджия Стейт Юниверсити Рисерч Фаундейшн, Инк. Белок, нацеленный на интегрин, и способы его применения
WO2025250689A1 (en) * 2024-05-28 2025-12-04 Georgia State University Research Foundation Combination therapy with angiogenesis protein and immune checkpoint inhibitor with/without chemotherapeutics

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PT2593127T (pt) * 2010-07-13 2018-07-06 Georgia State Univ Research Foundation Agente antiangiogénico e método de usar esses agente
CN110498851B (zh) * 2015-11-10 2022-10-11 孙嘉琳 一种抗肿瘤蛋白内皮抑素的衍生物及应用
CN108148117A (zh) * 2017-12-26 2018-06-12 张艳雪 一种抗菌肽的蛋白质结构特性及其研究方法

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990008187A1 (en) * 1989-01-19 1990-07-26 Dana Farber Cancer Institute Soluble two domain cd2 protein
WO2005077018A2 (en) * 2004-02-06 2005-08-25 Astellas Us Llc Methods of treating skin disorders

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6162432A (en) * 1991-10-07 2000-12-19 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
US5595756A (en) * 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
WO2004022097A1 (en) * 2002-09-05 2004-03-18 Medimmune, Inc. Methods of preventing or treating cell malignancies by administering cd2 antagonists
JP5377965B2 (ja) * 2005-09-09 2013-12-25 ジョージア ステート ユニバーシティ リサーチ ファウンデーション、インコーポレイテッド 標的化された造影剤および造影剤を標的化するための方法
WO2009146099A2 (en) * 2008-04-02 2009-12-03 Georgia State University Research Foundation, Inc. Contrast agents, methods for preparing contrast agents, and methods of imaging
EP2599497A3 (en) * 2008-09-08 2013-09-25 Hoffman/Barrett, L.L.C. Porphyrazine-chemotherapeutic agents conjugates
PT2593127T (pt) * 2010-07-13 2018-07-06 Georgia State Univ Research Foundation Agente antiangiogénico e método de usar esses agente

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990008187A1 (en) * 1989-01-19 1990-07-26 Dana Farber Cancer Institute Soluble two domain cd2 protein
WO2005077018A2 (en) * 2004-02-06 2005-08-25 Astellas Us Llc Methods of treating skin disorders

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
A. J. MURRAY: "One Sequence, Two Folds: A Metastable Structure of CD2", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 92, no. 16, 1 August 1995 (1995-08-01), pages 7337 - 7341, XP055011344, ISSN: 0027-8424, DOI: 10.1073/pnas.92.16.7337 *
BODIAN D L ET AL: "Crystal structure of the extracellular region of the human cell adhesion molecule CD2 at 2.5a resolution", STRUCTURE, CURRENT BIOLOGY LTD., PHILADELPHIA, PA, US, vol. 2, no. 8, 1 August 1994 (1994-08-01), pages 755 - 766, XP024247970, ISSN: 0969-2126, [retrieved on 19940801], DOI: 10.1016/S0969-2126(94)00076-X *
E. YVONNE JONES ET AL: "Crystal structure at 2.8 °A resolution of a soluble form of the cell adhesion molecule CD2", NATURE, vol. 360, no. 6401, 19 November 1992 (1992-11-19), pages 232 - 239, XP055011342, ISSN: 0028-0836, DOI: 10.1038/360232a0 *
PAUL C. DRISCOLL ET AL: "Structure of domain 1 of rat T lymphocyte CD2 antigen", NATURE, vol. 353, no. 6346, 24 October 1991 (1991-10-24), pages 762 - 765, XP055011345, ISSN: 0028-0836, DOI: 10.1038/353762a0 *
RECNY: "N-glycosylation is required for human CD2 immunoadhesion functions.", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 267, no. 31, 1 January 1992 (1992-01-01), pages 22428, XP055011435, ISSN: 0021-9258 *
SEED B ET AL: "Molecular cloning of the CD2 anigen, the T-cell erythrocyte receptor, by a rapid immunoselection procedure", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC; US, vol. 84, 1 May 1987 (1987-05-01), pages 3365 - 3369, XP002098062, ISSN: 0027-8424, DOI: 10.1073/PNAS.84.10.3365 *
WILKINS A L ET AL: "Structural biology of the cell adhesion protein CD2: From molecular recognition to protein folding and design", CURRENT PROTEIN AND PEPTIDE SCIENCE, BENTHAM SCIENCE PULBISHERS, NL, vol. 4, no. 5, 1 October 2003 (2003-10-01), pages 367 - 373, XP009153746, ISSN: 1389-2037 *
WITHKA J M ET AL: "Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2", STRUCTURE, CURRENT BIOLOGY LTD., PHILADELPHIA, PA, US, vol. 1, no. 1, 15 September 1993 (1993-09-15), pages 69 - 81, XP024247880, ISSN: 0969-2126, [retrieved on 19930915], DOI: 10.1016/0969-2126(93)90009-6 *
YANG JENNY J ET AL: "Structural biology of the cell adhesion protein CD2: Alternatively folded states and structure-function relation", CURRENT PROTEIN AND PEPTIDE SCIENCE, BENTHAM SCIENCE PULBISHERS, NL, vol. 2, no. 1, 1 March 2001 (2001-03-01), pages 1 - 17, XP009153745, ISSN: 1389-2037 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3265482A4 (en) * 2015-03-06 2018-11-21 Georgia State University Research Foundation, Inc. Integrin-targeting protein and methods of use thereof
RU2806524C2 (ru) * 2015-03-06 2023-11-01 Джорджия Стейт Юниверсити Рисерч Фаундейшн, Инк. Белок, нацеленный на интегрин, и способы его применения
WO2025250689A1 (en) * 2024-05-28 2025-12-04 Georgia State University Research Foundation Combination therapy with angiogenesis protein and immune checkpoint inhibitor with/without chemotherapeutics

Also Published As

Publication number Publication date
ES2923430T3 (es) 2022-09-27
CA2804753C (en) 2021-05-25
CN103002904A (zh) 2013-03-27
US20160090408A1 (en) 2016-03-31
JP2013534538A (ja) 2013-09-05
JP6353654B2 (ja) 2018-07-04
AU2019202174A1 (en) 2019-04-18
EP2593127A1 (en) 2013-05-22
EP3381462B1 (en) 2022-06-08
CN103002904B (zh) 2017-01-18
CA2804753A1 (en) 2012-01-19
PL2593127T3 (pl) 2018-11-30
EP3381462A1 (en) 2018-10-03
AU2011279155A1 (en) 2013-01-24
AU2021201207A1 (en) 2021-03-11
AU2017201133A1 (en) 2017-03-09
AU2011279155B2 (en) 2017-03-09
US20130281357A1 (en) 2013-10-24
AU2023202513A1 (en) 2023-05-11
ES2674409T3 (es) 2018-06-29
EP2593127B1 (en) 2018-05-30
PT3381462T (pt) 2022-07-22
JP2016175913A (ja) 2016-10-06
AU2019202174B2 (en) 2020-11-26
DK2593127T3 (en) 2018-07-02
US11578114B2 (en) 2023-02-14
US9175063B2 (en) 2015-11-03
HUE040205T2 (hu) 2019-02-28
PT2593127T (pt) 2018-07-06

Similar Documents

Publication Publication Date Title
AU2019202174B2 (en) Anti-angiogenic agent and method of using such agent
WO2003097835A2 (en) Pharmaceutical compositions for the treatment of cancer
US20040156828A1 (en) Adeno-associated virus mediated B7.1 vaccination synergizes with angiostatin to eradicate disseminated liver metastatic cancers
US20210008173A1 (en) Endostatin peptides for the treatment of tumors, fibrosis and acute lung injury
US12410230B2 (en) Anti-angiogenic agent and methods of using such agent
EP4665378A2 (en) Anti-angiogenic agent and methods of using such agent
US20240390465A1 (en) Endostatin Peptides for the Treatment of Tumors, Fibrosis and Acute Lung Injury
US20240158521A1 (en) DNA-ENCODED BISPECIFIC ANTIBODIES TARGETING IL13Ra2 AND METHODS OF USE IN CANCER THERAPEUTICS
WO2010057962A2 (en) Crf conjugates with extended half-lives
US20230241167A1 (en) Use of Caveolin-1 Scaffolding Domain Peptides for Treating Disease and Disorders
Priebat Chemotherapy and Other Systemic Approaches to Adult Sarcomas

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11738546

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2804753

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2013519804

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011279155

Country of ref document: AU

Date of ref document: 20110713

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011738546

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13739241

Country of ref document: US