WO2011163462A2 - Amide-based insulin prodrugs - Google Patents

Amide-based insulin prodrugs Download PDF

Info

Publication number
WO2011163462A2
WO2011163462A2 PCT/US2011/041603 US2011041603W WO2011163462A2 WO 2011163462 A2 WO2011163462 A2 WO 2011163462A2 US 2011041603 W US2011041603 W US 2011041603W WO 2011163462 A2 WO2011163462 A2 WO 2011163462A2
Authority
WO
WIPO (PCT)
Prior art keywords
alkyl
group
prodrug
amino acid
chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/041603
Other languages
English (en)
French (fr)
Other versions
WO2011163462A3 (en
Inventor
Richard D. Dimarchi
Binbin Kou
Shujiang Cheng
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Indiana University Research and Technology Corp
Original Assignee
Indiana University Research and Technology Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Indiana University Research and Technology Corp filed Critical Indiana University Research and Technology Corp
Priority to JP2013516766A priority Critical patent/JP5912112B2/ja
Priority to CA2803164A priority patent/CA2803164C/en
Priority to CN201180040875.9A priority patent/CN103119057B/zh
Priority to EP20110798912 priority patent/EP2585102B1/en
Priority to US13/702,197 priority patent/US8946147B2/en
Priority to AU2011270832A priority patent/AU2011270832B2/en
Publication of WO2011163462A2 publication Critical patent/WO2011163462A2/en
Publication of WO2011163462A3 publication Critical patent/WO2011163462A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/62Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: One 27 KB ACII (Text) file named "IN216461" created on June 23, 2011.
  • Insulin is a peptide hormone comprised of a two chain heterodimer that is biosynthetically derived from a low potency single chain proinsulin precursor through enzymatic processing.
  • Human insulin is comprised of two peptide chains (an "A chain” (SEQ ID NO: 1) and "B chain” (SEQ ID NO: 2)) bound together by disulfide bonds and having a total of 51 amino acids.
  • the C-terminal region of the B-chain and the two terminal regions of the A-chain associate in a three-dimensional structure to assemble a site for high affinity binding to the insulin receptor.
  • Insulin demonstrates unparalleled ability to lower glucose in virtually all forms of diabetes. Unfortunately, its pharmacology is not glucose sensitive and as such it is capable of excessive action that can lead to life-threatening hypoglycemia. Inconsistent pharmacology is a hallmark of insulin therapy such that it is extremely difficult to normalize blood glucose without occurrence of hypoglycemia.
  • native insulin is of short duration of action and requires modification to render it suitable for use in control of basal glucose.
  • Established approaches to delay the onset of insulin action include reduction in solubility, and albumin binding.
  • insulin derivatives For example, two commercially available insulin derivatives have been prepared to provide a longer action profile. More particularly, the insulin derivative [GlyA21, ArgB31, ArgB 32] insulin was prepared to shift insulin's pi from 5.4 to 6.7 resulting in the peptide being precipitated at physiological pH and thus delaying adsoption and time of action (see Bolli et al., Diabetologia 1999, 42, 1151-1167). However, this insulin derivative has enhanced IGF-1 affinity, leading to increased proliferative actions and the possibility of tumorigenesis.
  • Another commercially available insulin derivative is [LysB29-tetradecanoyl, des(B30)]insulin, wherein LysB29 has been acylated with a C 14 fatty acid (Mayer et al., Peptide Science, 88, 5, 687-713).
  • the presence of the fatty acid chain enhances binding of the peptide to serum albumin, resulting in increased plasma half life.
  • this derivative suffers the disadvantage of having reduced potency in vivo.
  • both insulin derivatives exhibit variability in biological action from one patient to the next.
  • Prodrug chemistry offers the opportunity to precisely control the onset and duration of insulin action after clearance from the site of administration and equilibration in the plasma at a highly defined concentration.
  • the central virtue of such an approach, relative to current long-acting insulin analogs and formulations, is that the insulin reservoir is not the subcutaneous fatty tissue where injection occurs, but rather the blood compartment. This removes the variability in absorption encountered with prior art delayed onset insulin derivatives. It also enables administration of the peptide hormone by routes other than a subcutaneous injection.
  • Binding of insulin to its receptor will result in biological stimulation, but will also initiate the subsequent deactivation of insulin induced pharmacology through the enzymatic degradation of the insulin peptide.
  • An added advantage of using a prodrug derivative of insulin is that such an approach also extends insulin's biological half life based on a strategy of inhibiting recognition of the prodrug by the corresponding receptor.
  • the complex nature of preparing such prodrugs has, until now, prevented the preparation of an efficacious prodrug derivative of insulin.
  • an active site structural address is needed that can form the basis for the reversible attachment of a prodrug structural element.
  • the structural address needs to offer two key features; (1) the potential for selective chemical modification and (2) the ability to provide a high degree of activity in the native form upon removal of the prodrug structural element.
  • the insulin prodrugs disclosed herein are chemically converted to structures that can be recognized by the receptor, wherein the speed of this chemical conversion will determine the time of onset and duration of in vivo biological action.
  • the prodrug chemistry disclosed in this application relies upon an intramolecular chemical reaction that is not dependent upon additional chemical additives, or enzymes or enzyme inhibitors.
  • the ideal prodrug should be soluble in water at physiological conditions (for example, a pH of 7.2 and 37 °C), and it should be stable in the powder form for long term storage. It should also be immunologically silent and exhibit a low activity relative to the parent drug. Typically the prodrug will exhibit no more than 10% of the activity of the parent drug, in one embodiment the prodrug exhibits less than 10%, less than 5%, about 1%, or less than 1% activity relative to the parent drug.
  • the prodrug when injected in the body, should be quantitatively converted to the active drug within a defined period of time. Applicants are the first to disclose insulin prodrug analogs that meet each of these objectives.
  • Peptide-based drugs are highly effective medicines with relatively short duration of action and variable therapeutic index.
  • the present disclosure is directed to insulin prodrugs wherein the prodrug derivative is designed to delay onset of action and extend the half life of the drug.
  • the delayed onset of action is advantageous in that it allows systemic distribution of the prodrug prior to its activation. Accordingly, the administration of prodrugs eliminates complications caused by peak activities upon administration and increases the therapeutic index of the parent drug.
  • a prodrug derivative of insulin is prepared by covalently linking a dipeptide to an active site of the insulin peptide via an amide linkage.
  • the dipeptide is covalently bound to the insulin peptide at a position that interferes with insulin's ability to interact with the insulin and IGF-1 receptors. Subsequent removal of the dipeptide via an intramolecular reaction, resulting in diketopiperazine or diketomorpholine formation, under physiological conditions and in the absence of enzymatic activity, restores full activity to the polypeptide.
  • an insulin prodrug having the general structure of U-O-insulin, wherein U is an amino acid or a hydroxyl acid and O is an N- alkylated amino acid linked to the insulin peptide through formation of an amide bond between U-0 and an amine of an insulin peptide.
  • the U-0 dipeptide is bound at the N-terminus, or at the side chain of an amino acid corresponding to positions A19, B16 or B25, of the respective A chain or B chain via an amide bond.
  • the structure of U-0 is selected, in one embodiment wherein chemical cleavage of U-0 from the insulin peptide is at least about 90% complete within about 1 to about 720 hours in PBS under physiological conditions. In one embodiment the chemical cleavage half-life (t 1/2 ) of U-0 from the insulin peptide is at least about 1 hour to about 1 week in PBS under physiological conditions.
  • U and O are selected to inhibit enzymatic cleavage of the U-0 dipeptide from an insulin peptide by enzymes found in mammalian serum.
  • U and/or O are selected such that the cleavage half-life of U-0 from the insulin peptide, in PBS under physiological conditions, is not more than two fold the cleavage half-life of U-0 from the insulin peptide in a solution comprising a DPP- IV protease (i.e., cleavage of U-0 from the insulin prodrug does not occur at a rate more than 2x faster in the presence of DPP-IV protease and physiological conditions relative to identical conditions in the absence of the enzyme).
  • U, O, or the amino acid of the insulin peptide to which U-0 is linked is a non-coded amino acid.
  • U and/or O is an amino acid in the D stereoisomer configuration.
  • U is an amino acid in the D stereoisomer configuration and O is an amino acid in the L stereoisomer
  • U is an amino acid in the L stereoisomer configuration and O is an amino acid in the D stereoisomer
  • U is an amino acid in the D stereoisomer configuration and O is an amino acid in the D stereoisomer
  • O is an N-alkylated amino acid but is not proline.
  • R ⁇ R 2> R4 and Rg are independently selected from the group consisting of H, C1-C18 alkyl, C 2 -C 18 alkenyl, (Ci-Cie alkyl)OH, (Ci-Cie alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 + )NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , (CrC 4 alkyl)(C 3 -C 9 heteroaryl), and Cr C 12 alkyl(W)Ci
  • R 3 is selected from the group consisting of Ci-C ⁇ alkyl, (Ci-C ⁇ alkyl)OH, (C1-C18 alkyl)NH 2> (Ci-Ci 8 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • R ⁇ R 2> Ri and R 8 are independently selected from the group consisting of H, C1-C18 alkyl, C 2 -Ci 8 alkenyl, (Ci-Ci 8 alkyl)OH, (Ci-Ci 8 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-Cg alkyl or R 6 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • R is selected from the group consisting of H and Q-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-C 8 alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of Q-Cg alkyl, (C 1 -C 4 alkyl)OH, (C C 4 alkyl)SH, (C C 4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • R is Q-Cg alkyl and R 4 is selected from the group consisting of H, C - C 8 alkyl, (C 1 -C4 alkyl)OH, (C 1 -C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4
  • an insulin prodrug analog comprising an A chain and a B chain, wherein the A chain comprises the sequence Z- GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and the B chain comprises the sequence of J-Xi 4 -X 4 LCGX 5 X 6 LVEALX 7 LVCG ERGFXg (SEQ ID NO: 14).
  • the Z and J designations of the A and B chain formulas are independently H (forming an N- terminal amine) or a dipeptide comprising the general structure:
  • X 4 LCGX 5 X 6 LVEALX 7 LVCG ERGFXg (SEQ ID NO: 14) sequence or X 14 represents a 1 to 4 amino acid sequence selected from the group consisting of a FVNQ (SEQ ID NO: 11), VNQ, NQ and Q that joins the "J" element to the N-terminus of the
  • X 1 is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , NHR 10 and OCH 3 , wherein Rio is a dipeptide comprising the general structure:
  • X 3 is selected from the group consisting of asparagine, ornithine, glycine, alanine, threonine, and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • X 12 is selected from the group consisting of OH, NH 2 , NHR and OCH 3 , wherein Rn is a dipeptide comprising the general structure:
  • Xg is histidine, asparagine or an amino acid of the general structure
  • X 13 is selected from the group consisting of H, OH, NH 2 and OCH 3 , wherein R 12 is a dipeptide comprising the general structure:
  • R is selected from the group consisting of H and Q-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-C 8 alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 3 is selected from the group consisting of Q-Cg alkyl, (C 1 -C 4 alkyl)OH, (C C 4 alkyl)SH, (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH, with the proviso that one and only one of X, X 12 , X 13 , J and Z comprises a dipeptide of the general structure:
  • the insulin analog comprises the sequence identified immediately above with the exception that Xg is histidine or asparagine.
  • J or Z comprise the dipeptide of Formula I, and R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring, then both Ri and R 2 are not hydrogen
  • the dipeptide present at Z, J, R 10 , Rn or R 12 comprises a compound having the general structure of Formula I:
  • R 2> R4 and Rg are independently selected from the group consisting of H, Ci-Qg alkyl, C 2 -C 18 alkenyl, (Ci-C 18 alkyl)OH, (Ci-C 18 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 3 is selected from the group consisting of Ci-C 18 alkyl, (Ci-C 18 alkyl)OH, (C1-C18 alkyl)NH 2> (Ci-Ci 8 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-C 8 alkyl or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Ci-Ci 8 alkyl, C 2 -C 18 alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • the dipeptide present at Z, J, Rio, R11 or Ri 2 comprises a co al structure of Formula I:
  • Ri and R 8 are independently H or Ci-C 8 alkyl;
  • R 2 and R 4 are independently selected from the group consisting of H, Q-Cg alkyl, C 2 -C 8 alkenyl, (C 1 -C4 alkyl)OH, (C 1 -C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 +) NH 2 , (Co-C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkylXCe-Qo aryl)R 7 , and CH 2 (C 3 -C9 heteroaryl), or Ri and R 2 together with the atom
  • R 3 is C1-C18 alkyl
  • R 5 is NHR 6 ;
  • R 6 is H or Ci-Cg alkyl
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • GIVEQCCTSICSLYQLENX 2 CN (SEQ ID NO: 6) and the B chain comprising a sequence selected from the group consisting of HLCGSHLVEALYLVCGERGFF (SEQ ID NO: 7), FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 8) and FVNQHLCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 9) wherein Z is H or a dipeptide comprising the general structure:
  • X 2 is an amino acid of the general structure
  • R 10 is H or a dipeptide comprising the general structure: ith the proviso that Z and R 0 are not both H and are not bo g the general structure:
  • single-chain insulin prodrug analogs are provided.
  • the carboxy terminus of the human insulin B chain, or a functional analog thereof is covalently linked to the N-terminus of the human insulin A chain, or functional analog thereof, wherein a dipeptide prodrug moiety having the general structure:
  • O R4 is covalently bound at the N-terminus of the peptide or at the side chain of an amino acid corresponding to positions A19, B16 or B25 of the respective A chain or B chain via an amide bond.
  • the B chain is linked to the A chain via peptide linker of 4-12 or 4-8 amino acids.
  • the solubility of the insulin prodrug analogs is enhanced by the covalent linkage of a hydrophilic moiety to the peptide.
  • the hydrophilic moiety is linked to the insulin analog via a linker.
  • the hydrophilic moiety is linked (directly or indirectly through a linker) to either the N-terminal alpha amine of the B chain or to the side chain of an amino acid at position 28 of SEQ ID NO: 9 or the amino acid at position 29 of SEQ ID NO: 8.
  • the hydrophilic moiety is a polyethylene glycol (PEG) chain, having a molecular weight selected from the range of about 500 to about 40,000 Daltons.
  • the polyethylene glycol chain has a molecular weight selected from the range of about 500 to about 5,000 Daltons. In another embodiment the polyethylene glycol chain has a molecular weight of about 10,000 to about 20,000 Daltons.
  • Acylation or alkylation can increase the half-life of the insulin peptides in circulation. Acylation or alkylation can advantageously delay the onset of action and/or extend the duration of action at the insulin receptors upon activation of the prodrug.
  • the insulin analogs may be acylated or alkylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position.
  • a pharmaceutical composition comprising any of the novel insulin prodrug analogs disclosed herein, preferably at a purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a pharmaceutically acceptable diluent, carrier or excipient.
  • compositions may contain an A19 insulin analog as disclosed herein at a concentration of at least 0.5 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 11 mg/ml, 12 mg/ml, 13 mg/ml, 14 mg/ml, 15 mg/ml, 16 mg/ml, 17 mg/ml, 18 mg/ml, 19 mg/ml, 20 mg/ml, 21 mg/ml, 22 mg/ml, 23 mg/ml, 24 mg/ml, 25 mg/ml or higher.
  • the pharmaceutical compositions comprise aqueous solutions that are sterilized and optionally stored contained within various package containers.
  • the pharmaceutical compositions comprise a lyophilized powder.
  • the pharmaceutical compositions can be further packaged as part of a kit that includes a disposable device for administering the composition to a patient.
  • the containers or kits may be labeled for storage at ambient room temperature or at refrigerated temperature.
  • an improved method of regulating blood glucose levels in insulin dependent patients comprises the steps of administering an insulin prodrug analog of the present disclosure in an amount therapeutically effective for the control of diabetes.
  • the insulin prodrug analog is pegylated with a PEG chain having a molecular weight selected from the range of about 5,000 to about 40,000 Daltons
  • Fig. 1. is a schematic overview of the two step synthetic strategy for preparing human insulin. Details of the procedure are provided in Example 1.
  • Fig. 2 is a graph comparing insulin receptor specific binding of synthetic human insulin relative to purified native insulin. As indicated by the data presented in the graph, the two molecules have similar binding activities.
  • Fig. 3 is a graph comparing relative insulin receptor binding of native insulin and the A19 insulin analog (Insulin(p-NH 2 -F) 19 ). As indicated by the data presented in the graph, the two molecules have similar binding activities.
  • Fig. 4 is a graph comparing relative insulin receptor binding of native insulin and the IGFl(YL) B 16B 17 analog. As indicated by the data presented in the graph, the two molecules have similar binding activities.
  • Fig. 5 is a schematic drawing of the synthetic scheme used to prepare the IGFl(Y B16 L B17 )(p-NH 2 -F) A19 analog.
  • Fig. 6 is a graph comparing relative insulin receptor binding of
  • Fig. 7A-7C provides the activity of a dimer prepared in accordance with the present disclosure.
  • Fig 7 A shows the structure of an IGF-1 single chain dimer that comprises two single chain IGF B 16B 17 derivative peptides (IGF- IB
  • Fig 7B is a graph demonstrating the relative insulin receptor binding of insulin, IGF-1, a single chain IGF B16B17 derivative peptide dimer and a two chain IGF B16B17 derivative peptide dimer.
  • Fig 7C is a graph demonstrating the relative activity of insulin, IGF-1, and a two chain IGF B 16B 17 derivative peptide dimer to induce insulin receptor phosphorylation.
  • Fig 8A-8C shows the degradation of a prodrug form of an IGF B 16B 17 derivative peptide: (Aib-Pro on (pNH 2 -F) 19 of IGFlA(Ala) 6 ' 7 ' U ' 20 amide.
  • the dipeptide was incubated in PBS, pH 7.4 at 37°C for predetermined lengths of time. Aliquots were taken at 20 minutes (Fig. 8A), 81 minutes (Fig 8B) and 120 minutes (Fig. 8C) after beginning the incubation, were quenched with 0.1 TFA and tested by analytical HPLC.
  • Peak a (IGFlA(Ala) 6 ' 7 ' 11 ' 20 (pNH 2 -F) 1 amide) and b (IGFlA(Ala) 6 ' 7 ' n ' 20 (Aib- Pro-pNH-F) 19 amide) were identified with LC-MS and quantified by integration of peak area. The data indicate the spontaneous, non-enzymatic conversion of
  • FIG. 9 A & 9B are graphs depicting the in vitro activity of the prodrug
  • FIG 9A is a graph comparing relative insulin receptor binding of native insulin (measured at 1 hour at 4°C) and the A19 IGF prodrug analog ( Aib,dPro-IGF 1 YL) over time (0 hours, 2.5 hours and 10.6 hours) incubated in PBS.
  • Fig 9B is a graph comparing relative insulin receptor binding of native insulin (measured at 1.5 hour at 4°C) and the A19 IGF prodrug analog (Aib,dPro-IGFlYL) over time (0 hours, 1.5 hours and 24.8 hours) incubated in 20% plasma/PBS. As indicated by the data presented in the graph, increased activity is recovered form the A19 IGF prodrug analog sample as the prodrug form is converted to the active IGF1YL peptide.
  • Fig. 10A & 10B are graphs depicting the in vitro activity of the prodrug dK,(N-isobutylG)-IGFlYL (wherein the dipeptide dK,(N-isobutylG) is linked via an amide bond to the insulin analog through the A19 4-aminoPhe).
  • Fig 10A is a graph comparing relative insulin receptor binding of native insulin (measured at 1 hour at 4°C) and the A19 IGF prodrug analog (IGF1YL: dK,(N-isobutylG) over time (0 hours, 5 hours and 52 hours) incubated in PBS.
  • Fig 10B is a graph comparing relative insulin receptor binding of native insulin (measured at 1.5 hour at 4°C) and the A19 IGF prodrug analog (IGF1YL: dK,(N-isobutylG) over time (0 hours, 3.6 hours and 24.8 hours) incubated in 20% plasma/PBS. As indicated by the data presented in the graph, increased activity is recovered form the A19 IGF prodrug analog sample as the prodrug form is converted to the active IGF1YL peptide.
  • IGF1YL dK,(N-isobutylG
  • Fig. 11 A & 1 IB are graphs depicting the in vitro activity of the prodrug dK(e- acetyl),Sar)-IGFlYL (wherein the acylated dipeptide dK(e-acetyl),Sar) is linked via an amide bond to the insulin analog through the A19 4-aminoPhe).
  • Fig 11A is a graph comparing relative insulin receptor binding of native insulin (measured at 1 hour at 4°C) and the A19 IGF prodrug analog (IGF1YL: dK(e-acetyl),Sar) over time (0 hours, 7.2 hours and 91.6 hours) incubated in PBS.
  • Fig 1 IB is a graph comparing relative insulin receptor binding of native insulin (measured at 1.5 hour at 4°C) and the A19 IGF prodrug analog (IGF1YL: dK(e-acetyl),Sar) over time (0 hours, 9 hours and 95 hours) incubated in 20% plasma/PBS. As indicated by the data presented in the graph, increased activity is recovered from the A19 IGF prodrug analog sample as the prodrug form is converted to the active IGF1YL peptide.
  • IGF1YL dK(e-acetyl),Sar
  • FIG. 12 is a graph comparing relative insulin receptor binding of native insulin heteroduplex and the IGF- 1 A and B chain heteroduplex and a single chain IGF- 1 analog wherein the carboxy terminus of the B chain is directly linked to the N- terminus of the IGF-1 A chain.
  • Fig. 13 is a graph comparing relative insulin receptor binding of native insulin heteroduplex, IGF-1, the IGF-1 delta heteroduplex and a single chain IGF-1 delta single chain analog wherein the carboxy terminus of the B chain is linked to the N- terminus of the IGF- 1 A chain through a peptide linker consisting of the sequence GYGSSSOR (SEQ ID NO: 69), wherein the IGF-1 delta analog comprises the native IGF-1 sequence with the following amino acid substitutions: HA8, OA9, OA14, OA15, QA17, NA21, YB 16, LB17, OB22.
  • Fig. 14 is a bar graph depicting the relative in vitro binding activity of single chain insulin analogs at the IGF-1 receptor or the A or B subtype insulin receptors wherein the carboxy terminus of the native insulin B chain is linked to the amino terminus of the native insulin A chain via the IGF- 1 C peptide or various derivative of the IGF-1 C peptide.
  • the B°C 1 A° insulin analog nomenclature the B° and A 0 designations refer to the insulin sequences of the A and B chain, while C 1 designates the IGF-1 C peptide.
  • a single chain insulin analog that links the B chain to the A chain via the IGF- 1 C peptide is a potent insulin agonist.
  • Fig. 15 is a bar graph depicting the relative in vitro binding activity of single chain insulin analogs of the formula B°C 1 A° at the IGF-1 receptor or the A or B subtype insulin receptors wherein the native sequence of the linking IGF-1 C peptide has been modified by the indicated amino acid substitutions at position 1, 2, 3, 4 or 8.
  • B°C 1 A° insulin analog nomenclature the B° and A 0 designations refer to the insulin sequences of the A and B chain, while C 1 designates the IGF-1 C peptide.
  • Fig. 16 is a bar graph depicting the relative in vitro binding activity and phosphorylation activity of single chain B°C 1 A° insulin analogs at the A subtype insulin receptor. The activity of the native IGF-1 C peptide (010) relative to various amino acid substitutions or deletions was compared.
  • B°C 1 A° insulin analog nomenclature the B and A designations refer to the insulin sequences of the A and B chain, while C 1 designates the IGF-1 C peptide.
  • Fig. 17 is a graph demonstrating that insulin analogs comprising an IGF-1 A chain have enhanced resistance to degradation by the specific insulin degrading enzyme (IDE) relative to insulin analogs comprising an insulin A chain.
  • IDE specific insulin degrading enzyme
  • Fig. 18 is a graph demonstrating the relative activity of IGF-1, insulin and insulin/IGF chimera to induce in vitro cellular proliferation. T he results indicate that the insulin activity associated with the IGF-1 single chain insulin analogs does not correlate with the proliferation activity associated with native IGF-1.
  • Fig. 19A-19B show the activity of prodrug MIU-29: B 1 (Y16,L17,Y25)29a :
  • FIG. 19A shows that in vitro insulin receptor binding increase with time MIU-29 is incubated ex vivo in PBS buffer at 37°C and exhibiting a half life of about 4.4 hours.
  • Fig. 19B is a graph showing the results of a
  • the prodrug derivative MIU-29 comprises a 4-amino-phenylalanine substitution at position A19 wherein a dipeptide dLys(Ac),NLeu has been covalently linked at the 4-amino position of the A19 residue and the side chain of the lysine of the dipeptide element has been acylated with a C14 fatty acid.
  • MIU-29c This dipeptide will auto-cleave under physiological conditions with a half life of approximately 4.4 hours.
  • MIU-29c the resultant compound
  • Figs. 20A & 20B represents the results obtained from a comparative insulin tolerance test for insulin prodrug analog MIU-30a: B 1 (Y16,L17,Y25)29a :
  • a 1 (dLys(Ac),Sar-aF19) (wherein the acylated dipeptide dLys(Ac),Sar is linked via an amide bond to the insulin analog through the A19 4-aminoPhe).
  • the half life of the prodrug is estimated to be approximately 20 hours.
  • the data shown in Fig. 20A reveals that the parent compound has low potency, but after incubation in 20% plasma for 48 hours (generating "MIU-30c”) potency is increased.
  • vehicle control
  • T MIU 30a, 90 nm/kg
  • V MIU 30c, 90 nm/kg
  • MIU 30a, 270 nm/kg
  • 0 MIU 30c, 270 nm/kg.
  • Fig. 20B represents blood glucose AUC after 8 hours in C57/Blk mice indicating that the potency of the compounds increases with time incubated in vitro prior to administration.
  • Fig. 21 is a graph depicting the in vitro activity of the acylated insulin analog MIU 46: ⁇ , ⁇ Y16,L17,Y25, K29-C14)28a : ⁇ , aF19NH2) relative to its non-acylated counterpart (MIU-45) and to native insulin.
  • the acylated insulin comprises a 4-amino-phenylalanine substitution at position A19 and a lysine substitution at B29, wherein the side chain of the B29 lysine has been acylated with a C14 fatty acid.
  • the acylated analog has reduced potency relative to the parent compound.
  • Fig. 22 is a graph depicting the in vitro activity of the acylated prodrug MIU 42: B 1 (Y16,L17,Y25)29a : A 1 (dLys(rE-C14),Sar-aF19) (wherein an amino acid of the dipeptide prodrug element is acylated, linked at the gamma position "rE” of a glutamic acid linker) relative to time incubated ex vivo in 30% ACN/PBS at pH 7.4 and 37°C. As shown by the data, activity is restored to parent compound MIU 42 with increased time incubated ex vivo.
  • Figs. 23A-23D provide data from a comparative insulin tolerance test for Detemir and acylated insulin analog MIU-46 using C57/Blk mice.
  • the acylated derivative MIU 46: ⁇ , ⁇ Y16,L17,Y25, K29-C14)28a : ⁇ , aF19NH2) comprises a lysine substitution at position 29 that has been acylated with a C14 fatty acid through a gamma glutamic acid spacer.
  • acylated analog MIU-46 is not very potent relative to Detemir.
  • Fig. 24 is a generalized structure of one pegylated insulin prodrug embodiment wherein a 20 kDa PEG is linked to the N-terminal alpha amine of the B chain through a linker and the a chain comprises a 4-amino phenylalanine substitution at position A 19, wherein a dipeptide (AA1, AA2) is linked to the 4-amino group of 4-amino phenylalanine via an amide bond.
  • the dipeptide (AA1, AA2) is Norleucine, dlysine (acylated).
  • Fig. 25 is a is a schematic drawing of the synthetic scheme used to prepare the generalized structure of Fig. 24. A more detailed description of the synthesis is provided in Example 15.
  • Figs. 26 & 27 are graphs demonstrating the in vitro activity of various prodrug compounds (having the general structure of Fig. 24) at insulin A subtype receptor (Fig 26) and B subtype receptor (Fig. 27) receptors based on a phosphorylation assay.
  • Compounds tested were native insulin ( ⁇ ), B 1 Aoa2(H5, H10,Y16,L17)25a :
  • B 1 PEG-Aoa2(H5, H10,Y16,L17)25a A 1 (pNH 2 -F 19dLy s (rE- C14),Sar-aF19, N18, N21 ( A , having an N-terminal 20 kDa PEG but no dipeptide at A19), B 1 PEGAoa2(H5, H10,Y16,L17)25a : A ⁇ dLysirE-Cl ⁇ Ala-aF ⁇ , N18, N21 ( , having an N-terminal 20 kDa PEG and a poorly cleavable dipeptide (dLys(rE- C14),pAla) at A19), B 1 PEGAoa2(H5, H10,Y16,L17)25a : A ⁇ dL
  • B 1 PEGAoa2(H5, H10,Y16,L17)25a A 1 (dLys(rE-C14),Nleu-aF19, N18, N21 « having an N-terminal 20 kDa PEG and a self cleaving dipeptide (dLys(rE-C14),Nleu) at A19, administered after incubation in PBS for 78 hours).
  • the dipeptide dLys(rE-C14),Nleu will auto-cleave under physiological conditions with a half life of approximately 4.4 hours.
  • prodrug is defined as any compound that undergoes chemical modification before exhibiting its pharmacological effects.
  • bioactive polypeptide refers to polypeptides which are capable of exerting a biological effect in vitro and/or in vivo.
  • amino acid encompasses any molecule containing both amino and carboxyl functional groups, wherein the amino and carboxylate groups are attached to the same carbon (the alpha carbon).
  • the alpha carbon optionally may have one or two further organic substituents. Designation of an amino acid without specifying its stereochemistry is intended to encompass either the L or D form of the amino acid or a racemic mixture.
  • the D form of the amino acid is specified by inclusion of a lower case d before the three letter code and superscript number (e.g., dLys "1 ), wherein the designation lacking the lower case d (e.g., Lys " ) is intended to specify the native L form of the amino acid.
  • the inclusion of the superscript number designates the position of the amino acid in the IGF peptide sequence, wherein amino acids that are located within the IGF sequence are designated by positive superscript numbers numbered consecutively from the N-terminus.
  • Additional amino acids linked to the IGF peptide either at the N-terminus or through a side chain are numbered starting with 0 and increasing in negative integer value as they are further removed from the IGF sequence.
  • the position of an amino acid within a dipeptide prodrug linked to the N-terminus of IGF is designated aa _1 -aa°-IGF wherein aa° represents the carboxy terminal amino acid of the dipeptide and aa "1 designates the amino terminal amino acid of the dipeptide.
  • hydroxyl acid refers to amino acids that have been modified to replace the alpha carbon amino group with a hydroxyl group.
  • non-coded amino acid encompasses any amino acid that is not an L-isomer of any of the following 20 amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Val, Trp, Tyr.
  • a “dipeptide” is a compound formed by linkage of an alpha amino acid or an alpha hydroxyl acid to another amino acid, through a peptide bond.
  • chemical cleavage absent any further designation encompasses a non-enzymatic reaction that results in the breakage of a covalent chemical bond.
  • bioactive polypeptide refers to polypeptides which are capable of exerting a biological effect in vitro and/or in vivo.
  • a general reference to a peptide is intended to encompass peptides that have modified amino and carboxy termini.
  • an amino acid sequence designating the standard amino acids is intended to encompass standard amino acids at the N- and C- terminus as well as a corresponding hydroxyl acid at the N-terminus and/or a corresponding C-terminal amino acid modified to comprise an amide group in place of the terminal carboxylic acid.
  • an "acylated" amino acid is an amino acid comprising an acyl group which is non-native to a naturally- occurring amino acid, regardless by the means by which it is produced.
  • exemplary methods of producing acylated amino acids and acylated peptides are known in the art and include acylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical acylation of the peptide.
  • the acyl group causes the peptide to have one or more of (i) a prolonged half-life in circulation, (ii) a delayed onset of action, (iii) an extended duration of action, (iv) an improved resistance to proteases, such as DPP-IV, and (v) increased potency at the insulin peptide receptor.
  • an "alkylated” amino acid is an amino acid comprising an alkyl group which is non-native to a naturally- occurring amino acid, regardless of the means by which it is produced.
  • Exemplary methods of producing alkylated amino acids and alkylated peptides are known in the art and including alkylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical alkylation of the peptide.
  • alkylation of peptides will achieve similar, if not the same, effects as acylation of the peptides, e.g., a prolonged half-life in circulation, a delayed onset of action, an extended duration of action, an improved resistance to proteases, such as DPP-IV, and increased potency at the insulin peptide receptor.
  • the term "pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents.
  • the term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
  • pharmaceutically acceptable salt refers to salts of compounds that retain the biological activity of the parent compound, and which are not biologically or otherwise undesirable. Many of the compounds disclosed herein are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
  • Pharmaceutically acceptable base addition salts can be prepared from inorganic and organic bases.
  • Salts derived from inorganic bases include by way of example only, sodium, potassium, lithium, ammonium, calcium and magnesium salts.
  • Salts derived from organic bases include, but are not limited to, salts of primary, secondary and tertiary amines.
  • Salts derived from inorganic acids include hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Salts derived from organic acids include acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluene-sulfonic acid, salicylic acid, and the like.
  • treating includes prophylaxis of the specific disorder or condition, or alleviation of the symptoms associated with a specific disorder or condition and/or preventing or eliminating said symptoms.
  • treating diabetes will refer in general to maintaining glucose blood levels near normal levels and may include increasing or decreasing blood glucose levels depending on a given situation.
  • an "effective" amount or a “therapeutically effective amount” of a prodrug refers to a nontoxic but sufficient amount of the prodrug to provide the desired effect.
  • one desired effect would be the prevention or treatment of hyperglycemia.
  • the amount that is "effective” will vary from subject to subject, depending on the age and general condition of the individual, mode of administration, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate “effective” amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
  • parenteral means not through the alimentary canal but by some other route such as intranasal, inhalation, subcutaneous, intramuscular, intraspinal, or intravenous.
  • the term “native insulin peptide” is intended to designate the 51 amino acid heterodimer comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs that comprise SEQ ID NOS: 1 and 2.
  • insulin peptide as used herein, absent further descriptive language is intended to encompass the 51 amino acid heterodimer comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs thereof (including for example those disclosed in published international application W096/34882 and US Patent No.
  • insulin prodrug analog refers to an insulin peptide (or an IGF 1 -based insulin analog as disclosed in Example 9) that has been modified by the covalent attachment of a dipeptide, via an amide linkage, at a location that interferes with insulin's or IGFl-based insulin analog's activity (e.g., the ability to interact with the insulin and IGF-1 receptors).
  • single-chain insulin analog encompasses a group of structurally-related proteins wherein the insulin A and B chains are covalently linked.
  • an amino acid "modification” refers to a substitution, addition or deletion of an amino acid, or the derivation of an amino acid by the addition and/or removal of chemical groups to/from the amino acid, and includes substitution with or addition of any of the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
  • Commercial sources of atypical amino acids include Sigma-Aldrich (Milwaukee, WI), ChemPep Inc. (Miami, FL), and Genzyme Pharmaceuticals (Cambridge, MA).
  • Atypical amino acids may be purchased from commercial suppliers, synthesized de novo, or chemically modified or derivatized from naturally occurring amino acids.
  • amino acid substitution refers to the replacement of one amino acid residue by a different amino acid residue.
  • all references to a particular amino acid position by letter and number refer to the amino acid at that position of either the A chain (e.g. position A5) or the B chain (e.g. position B5) in the respective native human insulin A chain (SEQ ID NO: 1) or B chain (SEQ ID NO: 2), or the corresponding amino acid position in any analogs thereof.
  • a reference herein to "position B28" absent any further elaboration would mean the corresponding position B27 of the B chain of an insulin analog in which the first amino acid of SEQ ID NO: 2 has been deleted.
  • polyethylene glycol chain refers to mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula ⁇ ( ⁇ 3 ⁇ 4 3 ⁇ 4) ⁇ ⁇ , wherein n is at least 9. Absent any further characterization, the term is intended to include polymers of ethylene glycol with an average total molecular weight selected from the range of 500 to 80,000 Daltons. "Polyethylene glycol chain” or “PEG chain” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol chain having a total molecular weight average of about 5,000 Daltons.
  • pegylated refers to a compound that has been modified from its native state by linking a polyethylene glycol chain to the compound.
  • a “pegylated polypeptide” is a polypeptide that has a PEG chain covalently bound to the polypeptide.
  • Linker is a bond, molecule or group of molecules that binds two separate entities to one another. Linkers may provide for optimal spacing of the two entities or may further supply a labile linkage that allows the two entities to be separated from each other. Labile linkages include photocleavable groups, acid-labile moieties, base-labile moieties and enzyme-cleavable groups.
  • insulin dimer is a complex comprising two insulin peptides covalently bound to one another via a linker.
  • insulin dimer when used absent any qualifying language, encompasses both insulin homodimers and insulin heterodimers.
  • An insulin homodimer comprises two identical subunits (each comprising an A and B chain), whereas an insulin heterodimer comprises two subunits that differ, although the two subunits are substantially similar to one another.
  • C -C n alkyl wherein n can be from 1 through 6, as used herein, represents a branched or linear alkyl group having from one to the specified number of carbon atoms.
  • Typical CrC 6 alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, butyl, iso-butyl, sec-butyl, tert-butyl, pentyl, hexyl and the like.
  • C2-C n alkenyl wherein n can be from 2 through 6, as used herein, represents an olefinically unsaturated branched or linear group having from 2 to the specified number of carbon atoms and at least one double bond.
  • C 2 -C n alkynyl wherein n can be from 2 to 6, refers to an unsaturated branched or linear group having from 2 to n carbon atoms and at least one triple bond. Examples of such groups include, but are not limited to, 1-propynyl, 2- propynyl, 1-butynyl, 2-butynyl, 1-pentynyl, and the like.
  • aryl refers to a mono- or bicyclic carbocyclic ring system having one or two aromatic rings including, but not limited to, phenyl, naphthyl, tetrahydronaphthyl, indanyl, indenyl, and the like.
  • the size of the aryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present.
  • (Ci-C 3 alkyl) (C6-C 10 aryl) refers to a 5 to 10 membered aryl that is attached to a parent moiety via a one to three membered alkyl chain.
  • heteroaryl refers to a mono- or bi- cyclic ring system containing one or two aromatic rings and containing at least one nitrogen, oxygen, or sulfur atom in an aromatic ring.
  • the size of the heteroaryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present.
  • (C C n alkylXCs-Ce heteroaryl) refers to a 5 or 6 membered heteroaryl that is attached to a parent moiety via a one to "n" membered alkyl chain.
  • C 3 -C n cycloalkyl refers to a non-aromatic, monocyclic or polycyclic ring comprising carbon and hydrogen atoms with the subscript number indicating the number of carbon atoms present.
  • C 3 -C8 cycloalkyl represents the compounds cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
  • C 3 -C n heterocyclic refers to a cycloalkyl ring system containing from one to "n - 1 " heteroatoms wherein the heteroatoms are selected from the group consisting of oxygen, sulfur, and nitrogen.
  • the phrase "5-membered heterocycle” or “C 5 heterocycle” includes, but is not limited to, 5-membered heterocycles having one hetero atom (e.g. thiophenes, pyrroles, furans); 5-membered heterocycles having two heteroatoms in 1,2 or 1,3 positions (e.g. oxazoles, pyrazoles, imidazoles, thiazoles, purines); 5-membered heterocycles having three heteroatoms (e.g. triazoles, thiadiazoles).
  • C 3 -C n membered ring refers to a saturated or unsaturated hydrocarbon ring structure comprising a total of three to "n" number of elements linked to one another to form a ring, wherein the ring elements are selected from the group consisting of C, O, S and N.
  • the term is intended to encompass cycloalkyls, heterocyles, aryls and heteroaryls.
  • halo refers to one or more members of the group consisting of fluorine, chlorine, bromine, and iodine.
  • patient without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets) and humans.
  • the present disclosure provides insulin prodrug derivatives that are formulated to delay onset of action and enhance the half life of the insulin peptide, thus improving the therapeutic index of the underlying insulin peptide.
  • the insulin prodrug chemistry disclosed herein allows for activation of the prodrug via a non- enzymatic degradation mechanism.
  • the disclosed prodrug chemistry can be chemically conjugated to active site amines to form amides that revert to the parent amine upon diketopiperazine formation and release of the prodrug element.
  • This novel biologically friendly prodrug chemistry spontaneously degrades under physiological conditions (e.g. pH of about 7, at 37°C in an aqueous environment) and is not reliant on enzymatic degradation.
  • the duration of the prodrug derivative is determined by the selection of the dipeptide prodrug sequence, and thus allows for flexibility in prodrug formulation.
  • a prodrug having a non-enzymatic activation half time (tl/2) of between 1-100 hrs under physiological conditions.
  • Physiological conditions as disclosed herein are intended to include a temperature of about 35 to 40 °C and a pH of about 7.0 to about 7.4 and more typically include a pH of 7.2 to 7.4 and a temperature of 36 to 38 °C in an aqueous environment.
  • a dipeptide, capable of undergoing diketopiperazine formation under physiological conditions is covalently linked through an amide linkage to the insulin peptide.
  • the rate of cleavage, and thus activation of the prodrug depends on the structure and stereochemistry of the dipeptide pro-moiety and also on the strength of the nucleophile.
  • the prodrugs disclosed herein will ultimately be chemically converted to structures that can be recognized by the native receptor of the drug, wherein the speed of this chemical conversion will determine the time of onset and duration of in vivo biological action.
  • the prodrug chemistry disclosed in this application relies upon an intramolecular chemical reaction that is not dependent upon additional chemical additives, or enzymes.
  • the speed of conversion is controlled by the chemical nature of the dipeptide substituent and its cleavage under physiological conditions. Since physiological pH and temperature are tightly regulated within a highly defined range, the speed of conversion from prodrug to drug will exhibit high intra and interpatient reproducibility.
  • prodrugs wherein the bioactive polypeptides have extended half lives of at least 1 hour, and more typically greater than 20 hours but less than 100 hours, and are converted to the active form at physiological conditions through a non-enzymatic reaction driven by inherent chemical instability.
  • the a non-enzymatic activation tl/2 time of the prodrug is between 1-100 hrs, and more typically between 12 and 72 hours, and in one embodiment the tl/2 is between 24-48 hrs as measured by incubating the prodrug in a phosphate buffer solution (e.g., PBS) at 37°C and pH of 7.2.
  • a phosphate buffer solution e.g., PBS
  • activation of the prodrug occurs after cleavage of an amide bond linked dipeptide, and formation of a diketopiperazine or diketomorpholine, and the active insulin peptide.
  • Specific dipeptides composed of natural or synthetic amino acids have been identified that facilitate intramolecular decomposition under physiological conditions to release active insulin peptides.
  • the dipeptide can be linked (via an amide bond) to an amino group present on native insulin, or an amino group introduced into the insulin peptide by modification of the native insulin peptide.
  • the dipeptide structure is selected to resist cleavage by peptidases present in mammalian sera, including for example dipeptidyl peptidase IV (DPP-IV). Accordingly, in one embodiment the rate of cleavage of the dipeptide prodrug element from the bioactive peptide (e.g., insulin peptide (Q)) is not substantially enhanced (e.g., greater than 2X) when the reaction is conducted using physiological conditions in the presence of serum proteases, relative to conducting the reaction in the absence of the proteases.
  • DPP-IV dipeptidyl peptidase IV
  • the cleavage half-life of the dipeptide prodrug element from the insulin peptide is not more than two, three, four or five fold the cleavage half-life of the dipeptide prodrug element from the insulin peptide in a solution comprising a DPP-rV protease.
  • the solution comprising a DPP-IV protease is serum, more particularly mammalian serum, including human serum.
  • the dipeptide prodrug element comprises the structure U-O, wherein U is an amino acid or a hydroxyl acid and O is an N- alkylated amino acid.
  • U, O, or the amino acid of the insulin peptide to which U-0 is linked is a non-coded amino acid.
  • U and/or O is an amino acid in the D stereoisomer configuration.
  • U is an amino acid in the D stereoisomer configuration and O is an amino acid in the L stereoisomer configuration.
  • U is an amino acid in the L stereoisomer configuration and O is an amino acid in the D stereoisomer configuration.
  • U is an amino acid in the D stereoisomer configuration and O is an amino acid in the D stereoisomer configuration.
  • O is an N-alkylated amino acid but is not proline.
  • the N-alkylated group of amino acid O is a C Cig alkyl, and in one embodiment N-alkylated group is Ci-C6 alkyl.
  • U-0 is a dipeptide comprising the structure of Formula I as defined herein.
  • the dipeptide is linked to the insulin peptide at an amino group selected from the N-terminal amino group of the A or B chain, or the side chain amino group of an amino acid present at an active site of the insulin peptide.
  • the dipeptide extension is covalently linked to an insulin peptide through the side chain amine of a lysine residue that resides at or near the active site.
  • the dipeptide extension is attached through a synthetic amino acid or a modified amino acid, wherein the synthetic amino acid or modified amino acid exhibits a functional group suitable for covalent attachment of the dipeptide extension (e.g., the aromatic amine of amino-phenylalanine).
  • the dipeptide is linked to the insulin peptide at an amino group selected from the N-terminal amino group of the A or B chain, or the side chain amino group of an aromatic amine (e.g., a 4-amino-phenylalanine residue) present at position A19, B16 or B25.
  • an aromatic amine e.g., a 4-amino-phenylalanine residue
  • the U-0 dipeptide is bound at position A19 through a 4-amino phenylalanine present at position A19.
  • the dipeptide prodrug element is designed to spontaneously cleave its amide linkage to the insulin analog under physiological conditions and in the absence of enzymatic activity.
  • the N-terminal amino acid of the dipeptide extension comprises a C-alkylated amino acid (e.g. amino isobutyric acid).
  • the C-terminal amino acid of the dipeptide comprises an N-alkylated amino acid (e.g., proline or N-methyl glycine).
  • the dipeptide comprises the sequence of an N-terminal C-alkylated amino acid followed by an N- alkylated amino acid.
  • the dipeptide prodrug element is linked to the aromatic ring of an A19 4-aminophenylalanine via an amide bond, wherein the C-terminal amino acid of the dipeptide comprises an N- alkylated amino acid and the N-terminal amino acid of the dipeptide is any amino acid.
  • the dipeptide prodrug moiety can also be attached to additional sites of an insulin peptide to prepare a prodrug or depot analog of insulin.
  • an insulin prodrug/depot analog comprising an A chain, a B chain, and a dipeptide linked via an amide bond to one or more sites selected from the group consisting of the N-terminal amino group of the A chain or B chain, or the side chain amino group of an internal amino acid including for example, linked to the aromatic amine of a 4-amino-phenylalanine residue present at position A 19, B16 or B25.
  • the insulin peptide comprises two dipeptide elements, wherein the dipeptide elements are optionally pegylated, alkylated, acylated or linked to a depot polymer.
  • the dipeptide comprises an N-terminal C- alkylated amino acid followed by an N-alkylated amino acid.
  • the A chain and B chain comprising the insulin prodrug analog may comprise the native sequence of the respective peptides (i.e., SEQ ID NO: 1 and SEQ ID NO: 2) or may comprise a derivative of SEQ ID NO: 1 and/or SEQ ID NO: 2 wherein the derivative includes modification of the amino acid at position A 19, B16 or B25 to a 4- amino phenylalanine and/or one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A14, A15, A17, A18, A19 and A21, Bl, B2, B3, B4, B5, B9, BIO, B13, B14, B17, B20, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions Bl-4 and B26-30.
  • the dipeptide prodrug element is linked to an N-terminal amino group of the A or B chain, wherein the C- terminal amino acid of the dipeptide prodrug element comprises an N-alkylated amino acid and the N-terminal amino acid of the dipeptide prodrug element is any amino acid, with the proviso that when the C-terminal amino acid of the dipeptide is proline, the N-terminal amino acid of the dipeptide comprises a C-alkylated amino acid.
  • R 4 and Rg are independently selected from the group consisting of H, Ci-Cie alkyl, C 2 -C 18 alkenyl, (Ci-Cie alkyl)OH, (Ci-Cie alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4 alkyl)CONH 2 , (C 1 -C4 alkyl)COOH, (C 1 -C4 alkyl)NH 2 , (C 1 -C4
  • R 3 is selected from the group consisting of Ci-C ⁇ alkyl, (Ci-C ⁇ alkyl)OH, (C 1 -C18 alkyl)NH 2> (Ci-Ci 8 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C 1 -C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH, with the proviso that when R 4 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring, both Ri and R 2 are other than H.
  • Ri and R 8 are independently H or Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 +) NH 2 , (C 0 -C4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 , and CH 2 (C 3 -Cg heteroaryl), or Ri and R 2 together with the atoms to which they are attached form a C 3 -Ci
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-Cg alkyl, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH and halo, provided that when the dipeptide of Formula I is linked through the N-terminal amine of a peptide and R 4 and R together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring, both R and R 2 are not H.
  • either the first amino acid and/or the second amino acid of the dipeptide prodrug element is an amino acid in the D stereoisomer configuration.
  • prodrug element of Formula I wherein Ri is selected from the group consisting of H and C Cg alkyl; and
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (Ci-C 4 alkyl)OH, (Ci-C 4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (Ci-C 4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (C1-C4 alkyl)SH, (C1-C4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH and R 8 is H.
  • R is Q-Cg alkyl and R 4 is selected from the group consisting of H, Ci-Ce alkyl, CH 2 OH, (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and CH 2 (C 5 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring.
  • R5 is NHR 6 and R 8 is H.
  • the prodrug element of Formula I is provided wherein Ri is selected from the group consisting of H and Ci-Cg alkyl; and R 2 and R 4 are independently selected from the group consisting of H, Ci-Ce alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (C1-C4 alkyl)SH, (C1-C4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, C1-C18 alkyl, C 2 - Ci8 alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH and halo; and R 8 is H, provided that when R 4 and R together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring, both Ri and R 2 are not H.
  • either the first amino acid and/or the second amino acid of the dipeptide prodrug element is a non-coded amino acid and in one embodiment is an amino acid in the D stereoisomer configuration.
  • dipeptide prodrug element has the structure of Formula I, wherein
  • Ri and R 8 are independently H or Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 +) NH 2 , (Co-C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C6-Cio aryl)R 7 , and CH 2 (C 3 -C 9 heteroaryl), or Ri and R 2 together with the atoms to which they are attached form a C 3 -Ci 2 cyclo
  • R 3 is C1-C18 alkyl
  • R 5 is NHR 6 ;
  • R 6 is H or Ci-C 8 alkyl;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2 , (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo and Rg is H.
  • Ri and R 2 are independently Ci-Cig alkyl or (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 ; or Ri and R 2 are linked through -(CH 2 ) P , wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • Ri and R 2 are independently selected from the group consisting of hydrogen, C 1 -C 18 alkyl, (C 1 -C 18 alkyl)OH, (C 1 -C4 alkyl)NH 2 , and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-Ci 8 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of H, Ci-Cig alkyl, C 2 -Cig alkenyl,
  • dipeptide prodrug element has the structure of Formula I, wherein
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-Cg alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 is selected from the group consisting of hydrogen and Ci-Cg alkyl
  • Rg is hydrogen
  • R5 is NH 2 , with the proviso that both Ri and R 2 are not hydrogen.
  • dipeptide prodrug element has the structure of Formula I, wherein
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and (C1-C4 alkyl)NH 2 ;
  • R 3 is Ci-C 6 alkyl
  • R 4 and Rg are each hydrogen
  • R5 is NH 2 , with the proviso that both Ri and R 2 are not hydrogen.
  • dipeptide prodrug element has the structure of Formula I, wherein
  • Ri and R 2 are independently selected from the group consisting of hydrogen and Ci-Cg alkyl, (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-Cg alkyl
  • R 4 is (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, Q-Cg alkyl and (Co-C 4 alkyl)OH;
  • Rg is hydrogen, with the proviso that both Ri and R 2 are not hydrogen.
  • dipeptide prodrug element has the structure of Formula I, wherein
  • Ri is selected from the group consisting of hydrogen, Q-Cg alkyl and (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 2 is hydrogen
  • R 3 is C 1 -C 18 alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring; and R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo, with the proviso that, if R is alkyl or (C 0 -C 4 alkylXCe-Cio aryl)R 7 , then R and R 5 together with the atoms to which they are attached form a 4- 11 heterocyclic ring.
  • an insulin prodrug analog comprising an insulin peptide and an amide linked dipeptide. More particularly, the insulin prodrug analog comprises an A chain sequence and a B chain sequence wherein the A chain comprises the sequence Z-GIVEQCCX 1 SICSLYQLENX 2 CX 3 - R 13 (SEQ ID NO: 3), or an analog thereof comprising a sequence that differs from SEQ ID NO: 3 by 1 to 9, 1 to 5 or 1 to 3 amino acid modifications, selected from positions A5, A8, A9, A10, A14, A15, A17, A18 (relative to the native insulin A chain), and the B chain sequence comprises the sequence of J-X 14 - X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14), or an analog thereof comprising a sequence that differs from SEQ ID NO: 14 sequence by 1 to 10, 1 to 5 or 1 to 3 amino acid modifications, selected from positions Bl, B2, B3, B4, B5, B13, B
  • X 14 is either a bond joining the "J" element to the
  • X 4 LCGX 5 X 6 LVEALX 7 LVCG ERGFXg (SEQ ID NO: 14) sequence or X 14 represents a 1 to 4 amino acid sequence selected from the group consisting of a X 9 VNQ (SEQ ID NO: 21), VNQ, NQ and Q that joins the "J" element to the
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • m is an integer selected from 0-3 and X is selected from the group consisting of OH, NH 2 , NHRio and OCH 3 , wherein Rio is H or a dipeptide comprising the general structure of Formula I:
  • X 3 is selected from the group consisting of asparagine, glycine, alanine, threonine and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • m is an integer selected from 0-3 and X 12 is selected from the group consisting of OH, NH 2 , NHRn and OCH 3 , wherein Rn is H or a dipeptide comprising the general structure of Formula I:
  • Xg is histidine, arginine or an amino acid of the general structure
  • m is an integer selected from 0-3 and X 13 is selected from the group consisting of H, OH, NH 2 , NHR 12 and OCH 3 , wherein R 12 is H or a dipeptide comprising the general structure of Formula I:
  • X 9 is selected from the group consisting of phenylalanine and desamino- phenylalanine;
  • R ⁇ R 2> R4 and Rg are independently selected from the group consisting of H, C 1 -C 18 alkyl, C 2 -Ci 8 alkenyl, (Ci-Cig alkyl)OH, (Ci-Cig alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4 alkyl)CONH 2 , (C 1 -C4 alkyl)COOH, (C 1 -C4 alkyl)NH 2 , (C 1 -C4
  • R 3 is selected from the group consisting of Ci-Cig alkyl, (Ci-Cig alkyl)OH, (Ci-Cig alkyl)NH 2> (Ci-Cig alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-Cg alkyl or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • R 13 is COOH or CONH 2 .
  • Xg is histidine, arginine or tyrosine.
  • R 13 is COOH and the carboxy terminal amino acid of the B chain has an amide (CONH 2 ) in place of the natural alpha carbon carboxy group.
  • one or more of X, X 12, X 13 , J and Z is a dipeptide comprising the general structure of Formula I:
  • At least one of X, X 12j X 13 , J and Z is a dipeptide comprising the general structure of Formula I: , and in one embodiment one and only one of X, X 12> X 13 , J and Z comprises a dipeptide of the general structure of Formula I:
  • the A chain comprises the sequence GIVEQCCXiSICSLYQLENX 2 CX 3 -Ri 3 (SEQ ID NO: 3)
  • the B chain sequence comprises the sequence of X 14 -X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFXg (SEQ ID NO: 14)
  • m is 1
  • X 12 is OH
  • X 13 is H or OH
  • X is NHR 10
  • R 13 is COOH and the carboxy terminal amino acid of the B chain has an amide (CONH 2 ) in place of the natural alpha carbon carboxy group, with the remaining designations defined as immediately above.
  • dipeptide present at X, X 12j X 13 , J and Z is a dipeptide comprising the general structure of Formula I:
  • R ⁇ R 2> Ri and Rg are independently selected from the group consisting of H, C 1 -C18 alkyl, C 2 -Ci 8 alkenyl, (Ci-Ci 8 alkyl)OH, (Ci-Ci 8 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 + )NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , (C C 4 alkyl)(C 3 -C 9 heteroaryl), and C C 12 alkylC Ci-Cn
  • R 3 is selected from the group consisting of Ci-C ⁇ alkyl, (Ci-C ⁇ alkyl)OH, (C1-C18 alkyl)NH 2, (Ci-C 18 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, C1-C18 alkyl, C 2 -Ci8 alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo provided that when R 4 and R together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring, both Ri and R 2 are not H.
  • both Ri and R 2 are not hydrogen.
  • Ri is selected from the group consisting of H and Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Ce alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 3 is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (C1-C4 alkyl)SH, (C1-C4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH and R 8 is H.
  • m is 1, Rg is H, R 3 is CrC 6 alkyl and R 4 is selected from the group consisting of H, CrC 4 alkyl, (C 3 -C6)cycloalkyl, (CrC 4 alkyl)OH, (C C 4 alkyl)SH and (C 0 -C 4 alkyl)(C 6 aryl)R 7 , or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • m is 1, Rg is H, R 3 is CrC 6 alkyl and R 4 is selected from the group consisting of H, C C 4 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • X 9 is phenylalanine and a single dipeptide extension is linked to the insulin peptide through an amide bond to the N-terminus of the A chain or the B chain.
  • the insulin peptide comprises a 4 amino phenylalanine substitution at position 19 of the A chain and a single dipeptide extension is linked to the insulin peptide through an amide bond formed at the aromatic amine of the 4 amino phenylalanine.
  • insulin analogs disclosed herein comprise a C- terminal amide or ester in place of a C-terminal carboxylate on the A chain and/or B chain.
  • the dipeptide of Formula I is further modified to comprise a large polymer that interferes with the insulin analog's ability to interact with the insulin or IGF-1 receptor. Subsequent cleavage of the dipeptide releases the insulin analog from the dipeptide complex wherein the released insulin analog is fully active.
  • J comprises the dipeptide of Formula I, wherein the dipeptide of Formula I is further modified to comprises a large polymer that interferes with the bound insulin analog's ability to interact with the insulin or IGF-1 receptor.
  • one of X, X 12 , X 1 , J and Z comprises a dipeptide of the general structure of Formula I: , wherein the dipeptide of Formula I is pegylated, alkylated or acylated.
  • either J, Z or X comprises an acylated or pegylated dipeptide of Formula I
  • J comprises an acylated or pegylated dipeptide of Formula I.
  • the dipeptide prodrug element is covalently bound to the insulin peptide via an amide linkage at the N-terminus of the A chain or the B chain, or attached to an amine bearing side chain of an internal amino acid, wherein the dipeptide further comprises a depot polymer linked to dipeptide.
  • a native amino acid of the insulin peptide is substituted with an amino acid suitable for forming an amide bond with the dipeptide of Formula I.
  • a depot bearing dipeptide is linked at a position selected from A14, A19, B16, B28 and B29.
  • two or more depot polymers are linked to a single dipeptide element.
  • the depot polymer is selected to be biocompatible and of sufficient size that the insulin peptide modified by covalent attachment of the dipeptide remains sequestered at an injection site and/or incapable of interacting with its corresponding receptor upon administration to a patient. Subsequent cleavage of the dipeptide releases the insulin peptide to interact with its intended target.
  • the depot polymer is selected from biocompatible polymers known to those skilled in the art.
  • the depot polymers typically have a size selected from a range of about 20,000 to 120,000 Daltons. In one embodiment the depot polymer has a size selected from a range of about 40,000 to 100,000 or about 40,000 to 80,000 Daltons. In one embodiment the depot polymer has a size of about 40,000, 50,000, 60,000, 70,000 or 80,000 Daltons.
  • Suitable depot polymers include but are not limited to dextrans, polylactides, polyglycolides, caprolactone-based polymers, poly(caprolactone), polyanhydrides, polyamines, polyesteramides, polyorthoesters, polydioxanones, polyacetals, polyketals, polycarbonates, polyphosphoesters, polyesters, polybutylene terephthalate, polyorthocarbonates, polyphosphazenes, succinates, poly(malic acid), poly(amino acids), polyvinylpyrrolidone, polyethylene glycol, polyhydroxycellulose,
  • the depot polymer is selected from the group consisting of polyethylene glycol, dextran, polylactic acid, polyglycolic acid and a copolymer of lactic acid and glycolic acid, and in one specific embodiment the depot polymer is polyethylene glycol. In one embodiment the depot polymer is polyethylene glycol and the combined molecular weight of depot polymer(s) linked to the dipeptide element is about 40,000 to 80,000 Daltons.
  • the dipeptide of Formula I further comprises a polyethylene oxide, alkyl or acyl group.
  • one or more polyethylene oxide chains are linked to the dipeptide of Formula I wherein the combined molecular weight of the polyethylene oxide chains ranges from about 20,000 to about 80,000 Daltons, or 40,000 to 80,000 Daltons or 40,000 to 60,000 Daltons.
  • the polyethylene oxide is polyethylene glycol.
  • at least one polyethylene glycol chain having a molecular weight of about 40,000 Daltons or about 20,000 Daltons is linked to the dipeptide of Formula either directly or through a linker/spacer.
  • the dipeptide of Formula I is acylated with an acyl group of sufficient size to bind serum albumin, and thus inactivate the insulin analog upon administration.
  • the acyl group can be linear or branched, and in one embodiment is a C 16 to C30 fatty acid.
  • the acyl group can be any of a C16 fatty acid, CI 8 fatty acid, C20 fatty acid, C22 fatty acid, C24 fatty acid, C26 fatty acid, C28 fatty acid, or a C30 fatty acid. In one
  • the acyl group is a C16 to C20 fatty acid, e.g., a C18 fatty acid or a C20 fatty acid.
  • an insulin prodrug analog comprising an A chain sequence and a B chain sequence wherein the A chain comprises the sequence GIVEQCCXiSICSLYQLENXiCXs-Ris (SEQ ID NO: 3), and the B chain sequence comprises the sequence of X 14 - X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14), wherein
  • X 14 is selected from the group consisting of an N-terminal amine, X 9 VNQ
  • i is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • U is an amino acid or a hydroxyl acid and O is an N-alkylated amino acid linked through an amide bond;
  • X 3 is selected from the group consisting of asparagine, ornithine, glycine, alanine, threonine and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • m is an integer selected from 0-3 and X 12 is selected from the group consisting of OH, NH 2 and OCH ;
  • X 8 is an amino acid of the general structure
  • m is an integer selected from 0-3 and X 13 is selected from the group consisting of H, OH, NH 2 and OCH 3 ;
  • X 9 is selected from the group consisting of phenylalanine and desamino- phenylalanine; and R 13 and R 14 are independently COOH or CONH 2 .
  • X 7 and Xg are both tyrosine, R 13 is COOH and the carboxy terminal amino acid of the B chain has an amide (CONH 2 ) in place of the natural alpha carbon carboxy group.
  • a compound comprising the sequence Z- GrVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3), or an analog thereof comprising a sequence that differs from SEQ ID NO: 3 by 1 to 3 amino acid modifications, selected from positions A5, A8, A9, A10, A14, A15, A17, A18 (relative to the native insulin A chain sequence) is provided.
  • SEQ ID NO: 3 Z- GrVEQCCXiSICSLYQLENX 2 CX 3
  • an analog thereof comprising a sequence that differs from SEQ ID NO: 3 by 1 to 3 amino acid modifications, selected from positions A5, A8, A9, A10, A14, A15, A17, A18 (relative to the native insulin A chain sequence) is provided.
  • this embodiment is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , NHR 10 and OCH 3 ,
  • Z are independently H or a dipeptide of the structure U-O, wherein U is an amino acid or a hydroxyl acid and O is an N-alkylated amino acid, wherein O is linked to the peptide of SEQ ID NO: 3 through formation of an amide bond, with the proviso that R 10 and Z are not the same and that U, O or the amino acid of SEQ ID NO: 3 to which U-0 is linked is a non-coded amino acid.
  • the chemical cleavage of the dipeptide from SEQ ID NO: 3 is at least about 90% complete within about 1 to about 720 hours in PBS under
  • the chemical cleavage half-life (t 1/2 ) of U-0 from SEQ ID NO: 3 is at least about 1 hour to about 1 week in PBS under physiological conditions.
  • the compound in one embodiment further comprises an insulin B chain linked to the A chain of SEQ ID NO: 3 either through intermolecular disulfide linkages or as a recombinant single chain polypeptide.
  • an insulin prodrug comprising an A chain sequence and a B chain sequence, wherein the A chain comprises the sequence GIVEQCCX 1 SICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and the B chain sequence comprises the sequence of X 14 - X 4 LCGX 5 X 6 LVEALYLVCGERGFF (SEQ ID NO: 4) wherein
  • i is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , and
  • X is selected from the group consisting of asparagine, glycine, alanine, threonine and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X 5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid; and X 14 is selected from the group consisting of a bond, X 9 VNQ (SEQ ID NO:
  • VNQ, NQ and Q, and X 9 is selected from the group consisting of phenylalanine and desamino-phenylalanine, further wherein a dipeptide prodrug element comprises the structure:
  • Ri and R 2 are independently Ci-Cig alkyl or aryl; or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and Rg are each hydrogen
  • R5 is an amine
  • prodrugs having the prodrug element linked at the N- terminus and having a tm of, e.g., about 1 hour comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently Ci-Cig alkyl or (C 0 -C4 alkyl)(C 6 -Cio aryl)R 7 ; or Ri and R 2 are linked through -(CH 2 ) P , wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NH 2 ; and R 7 is selected from the group consisting of hydrogen, Ci-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin prodrug comprising an A chain sequence of GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and a B chain sequence of X 14 -X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) wherein the dipeptide prodrug element is linked to the alpha amino group of the N-terminal amino acid of the peptide of SEQ ID NO: 3 or SEQ ID NO: 14 and exhibits a t 1/2 between about 6 to about 24 hours in PBS under physiological conditions.
  • such compounds comprise a prodrug element of Formula I, wherein
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Ci 8 alkyl and aryl, or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is C 1 -C 18 alkyl or R and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen
  • Ci-C 8 alkyl and aryl Ci-C 8 alkyl and aryl
  • R5 is an amine, with the proviso that both Ri and R 2 are not hydrogen and provided that one of R 4 or R 8 is hydrogen.
  • an insulin prodrug comprising an A chain sequence of GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and a B chain sequence of Xi 4 -X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) wherein the dipeptide prodrug element is linked to the alpha amino group of the N-terminal amino acid of the peptide of SEQ ID NO: 3 or SEQ ID NO: 14 and exhibits a t 1/2 of about 72 to about 168 hours in PBS under physiological conditions.
  • such compounds comprise a prodrug element of Formula I, wherein
  • Ri is selected from the group consisting of hydrogen, Q-Cg alkyl and aryl;
  • R 2 is H
  • R 3 is C1-C18 alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is an amine or N-substituted amine or a hydroxyl
  • prodrugs having the dipeptide prodrug element linked to the N-terminal alpha amino acid of the insulin A or B chain peptide and having a t 1/2 , e.g., between about 12 to about 72 hours, or in one embodiment between about 12 to about 48 hours, comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, C1-C18 alkyl, (Ci-Ci 8 alkyl)OH, (C1-C4 alkyl)NH 2 , and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R3 is C1-C18 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, Ci-C 8 alkyl and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of H, Ci-C ⁇ alkyl, C 2 -Ci8 alkenyl, (Co-C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo; with the proviso that both Ri and R 2 are not hydrogen and provided that at least one of R 4 or Rg is hydrogen.
  • prodrugs having the dipeptide prodrug element linked to the N-terminal amino acid of the insulin A or B chain peptide and having a ti /2 comprise a dipeptide prodrug element with the structure: I
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P wherein p is 2-9;
  • R 3 is C1-C8 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 is selected from the group consisting of hydrogen and Ci-Cg alkyl; and
  • R5 is NH 2 . with the proviso that both Ri and R 2 are not hydrogen.
  • prodrugs having the dipeptide prodrug element linked to the N-terminal amino acid of the insulin A or B chain peptide and having a ti /2 comprise a dipeptide prodrug element with the structure: I
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-C 8 alkyl and (C 1 -C4 alkyl)NH 2 ;
  • R 3 is Ci-C 6 alkyl
  • R 4 is hydrogen
  • R5 is NH 2 . with the proviso that both Ri and R 2 are not hydrogen.
  • prodrugs having the dipeptide prodrug element linked to the N-terminal amino acid of the insulin A or B chain peptide and having a t comprise a dipeptide prodrug element with the structure: I
  • Ri and R 2 are independently selected from the group consisting of hydrogen and Ci-C8 alkyl, (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-C 8 alkyl
  • R 4 is (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, Q-Cg alkyl and (Co-C 4 alkyl)OH. with the proviso that both Ri and R 2 are not hydrogen.
  • a prodrug having the dipeptide prodrug element linked to the N- terminal alpha amino acid of the insulin A or B chain peptide and having a t 1/2 , e.g., of about 72 to about 168 hours is provided wherein the dipeptide prodrug element has the structure:
  • Ri is selected from the group consisting of hydrogen, Q-Cg alkyl and (Co-C 4 alkyl)(C 6 -C 10 aryl)R 7 ;
  • R 3 is C1-C18 alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Ci-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo, with the proviso that, if Ri is alkyl or (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 , then Ri and R5 together with the atoms to which they are attached form a 4- 11 heterocyclic ring.
  • the dipeptide prodrug element is linked to a side chain amine of an internal amino acid of the insulin peptide.
  • prodrugs having a ti /2 e.g., of about 1 hour have the structure:
  • Ri and R 2 are independently Ci-Cg alkyl or (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 ; or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is Ci-Cig alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NH 2 ; and R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Ci 8 alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • R and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl, and (C 0 -C 4 alkylXCe-Cio aryl)R 7 , or R and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is Ci-Cig alkyl or R and R 4 together with the atoms to which they are attached form a 4- 12 heterocyclic ring;
  • R 4 and Rg are independently hydrogen, C Qg alkyl or (C 0 -C 4 alkylXCe-Cio aryl)R 7 ;
  • R 5 is NHR 6 ;
  • R is H or C C 8 alkyl, or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo, with the proviso that both R and R 2 are not hydrogen and provided that at least one of R 4 or Rg is hydrogen.
  • a prodrug having a t 1/2 e.g., of about 72 to about 168 hours and having the dipeptide prodrug element linked to an internal amino acid side chain of the insulin peptide is provided wherein the dipeptide prodrug element has the structure:
  • Ri is selected from the group consisting of hydrogen, Ci-Cig alkyl and (C0-C4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 3 is C1-C18 alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H or Ci-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo; with the proviso that, if Ri and R 2 are both independently an alkyl or (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 , either Ri or R 2 is linked through (CH 2 ) P to R5, wherein p is 2-9.
  • n is an integer selected from 1 to 4. In one embodiment n is 3 or 4 and in one embodiment the internal amino acid is lysine. In one embodiment the dipeptide prodrug element is linked to a primary amine on a side chain of an amino acid located at position 28, or 29 of the B-chain of the insulin peptide.
  • a chain sequence and a B chain sequence wherein the A chain comprises the sequence GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and the B chain sequence comprises the sequence of X 14 -X 4 LCGXsX 6 LVEALX 7 LVCGERGFXg (SEQ ID NO: 14) wherein
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , NHR 10 and OCH 3 , wherein Rio is H or a dipeptide comprising the general structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl, and (C0-C4 alkyl)(C 6 -Cio aryl)R 7 , or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R3 is C1-C18 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and R 8 are independently hydrogen, Ci-Cig alkyl or (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 5 is NHR 6 ;
  • R 6 is H or C1-C8 alkyl, or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 - Ci8 alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 - C 4 alkyl)OH, and halo;
  • X 3 is selected from the group consisting of asparagine, glycine, alanine, threonine and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • X 12 is selected from the group consisting of OH, NH 2 , NHRn and OCH 3 , wherein Rn is H or a dipeptide comprising the general structure:
  • X 13 is selected from the group consisting of H, OH, NH 2 , NHR 12 and OCH 3 , wherein R 12 is H or a dipeptide comprising the general structure:
  • X 14 is selected from the group consisting of a Hydrogen (forming an N-terminal amine), X 9 VNQ (SEQ ID NO: 21), VNQ, NQ and Q, and X 9 is selected from the group consisting of phenylalanine and desamino-phenylalanine, with the proviso that one and only one of R ⁇ , Rn and R 12 is a dipeptide comprising the general structure:
  • prodrug formulations can be provided having the desired time of activation.
  • an insulin prodrug comprising the structure of Formula III:
  • an insulin prodrug comprises the structure of formula III and exhibits such a half life
  • Ri and R 2 are independently C -Cn alkyl or aryl
  • P 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen, Ci-Qg alkyl and aryl;
  • R5 is an amine or a hydroxyl. In one embodiment m is 1.
  • the dipeptide prodrug element is linked to the insulin peptide via an amine present on an aryl group of an aromatic amino acid of the insulin peptide, wherein prodrugs having a t 1/2 , e.g., of about 1 hour have a dipeptide structure of: wherein R and R 2 are independently C -Cu alkyl or (C 0 -C4 alkylXCe-Cio aryl)R 7 ;
  • R3 is C C ⁇ alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, C 1 -C18 alkyl and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 5 is NH 2 or OH
  • R 7 is selected from the group consisting of hydrogen, C C ⁇ alkyl, C 2 -Ci 8 alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin prodrug comprising the structure of Formula III, wherein m is an integer from 0 to 3 and has a tl/2 of about 6 to about 24 hours in PBS under physiological conditions.
  • Ri and R 2 are independently selected from the group consisting of hydrogen, C C ⁇ alkyl and aryl, or R and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is Ci-Cig alkyl or R and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen
  • R5 is an amine or N-substituted amine. In one embodiment m is 1.
  • prodrugs having the dipeptide prodrug element linked via an amine present on an aryl group of an aromatic amino acid and having a ti /2 , e.g., of about 6 to about 24 hours are provided wherein the dipeptide comprises a structure of:
  • Ri is selected from the group consisting of hydrogen, Ci-Cig alkyl, (Ci-Cig alkyl)OH, (C1-C4 alkyl)NH 2 , and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, C1-C18 alkyl and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 5 is NHR 6 ;
  • R 6 is H, Q-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Cig alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin prodrug comprising the structure of Formula III, wherein m is an integer from 0 to 3 and has a tl/2 of about 72 to about 168 hours in PBS under physiological conditions.
  • an insulin prodrug comprises the structure of formula III and exhibits such a half life
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and aryl;
  • R 3 is C1-C18 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and R 8 are each hydrogen
  • R5 is selected from the group consisting of amine, N-substituted amine and hydroxyl. In one embodiment m is 1.
  • prodrugs having the dipeptide prodrug element linked via an aromatic amino acid and having a t 1/2 , e.g., of about 72 to about 168 hours are provided wherein the dipeptide comprises a structure of:
  • Ri is selected from the group consisting of hydrogen, Ci-Cg alkyl, (C1-C4 alkyl)COOH, and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7> or Ri and R 5 together with the atoms to which they are attached form a 4-11 heterocyclic ring;
  • R 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 is hydrogen or forms a 4-6 heterocyclic ring with R 3 ;
  • Rg is hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H or Ci-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C2-Cig alkenyl, (C 0 -C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • the insulin prodrug analog comprises an A chain sequence of GIVEQCCXiSICSLYQLENX 2 CX 3 -R 13 (SEQ ID NO: 3) and a B chain sequence of Xi 4 -X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) wherein
  • Xi is selected from the group consisting of threonine, histidine, arginine and lysine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , and
  • X 3 is asparagine, glycine, alanine, threonine, or serine.
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is tyrosine
  • X 8 is tyrosine or phenylalanine
  • X 9 is selected from the group consisting of phenylalanine and desamino- phenylalanine;
  • X 10 is aspartate-lysine dipeptide, a lysine-proline dipeptide, or a proline-lysine dipeptide;
  • Xn is threonine, alanine, or a threonine-arginine-arginine tripeptide; further wherein the B chain comprises a carboxy terminus extension of 1 to 4 amino acids wherein said carboxy terminal extension comprises an amino acid having the structure of
  • n is an integer from 0-3;
  • n is an integer from 1-4;
  • R 12 is a dipeptide comprising the general structure
  • Ri is selected from the group consisting of H and Ci-Cg alkyl; and R 2 and R 4 are independently selected from the group consisting of H, Ci-C 8 alkyl, C 2 -C 8 alkenyl, (Ci-C 4 alkyl)OH, (Ci-C 4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (Ci-C 4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of alkyl, (C 1 -C 4 alkyl)OH, (C C 4 alkyl)SH, (C C 4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-C ⁇ alkyl, C 2 - Ci8 alkenyl, (C 0 -C 4 alkyl)CONH 2 , (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo; and
  • the insulin prodrug analog comprises an A chain sequence that includes the sequence GIVEQCCXiSICSLYQLENX 2 CX 3 -R 13 (SEQ ID NO: 3) and a B chain sequence that includes the sequence of J-X 14 - X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) or
  • X 14 is either a bond joining the "J" element to SEQ ID NO: 14 or X 14 represents a 1 to 4 amino acid sequence selected from the group consisting of a FVNQ (SEQ ID NO: 11), VNQ, NQ and Q that joins the "J" element to SEQ ID NO: 14;
  • Xi is selected from the group consisting of threonine, histidine, arginine and lysine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , and
  • OCH 3 OCH 3 ;
  • X 3 is asparagine, glycine, alanine, threonine, or serine.
  • X 4 is selected from the group consisting of histidine and threonine
  • X 5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • X 12 is selected from the group consisting of OH, OCH 3 , NH 2 , wherein Rn is a dipeptide comprising the general structure:
  • X 8 is an amino acid of the general structure
  • X 13 is selected from the group consisting of H, OH, OCH 3 , NH 2 , and NHR 12 , wherein R 12 is a dipeptide comprising the general structure:
  • X 9 is selected from the group consisting of phenylalanine and desamino- phenylalanine;
  • X 10 is aspartate-lysine dipeptide, a lysine-proline dipeptide, or a proline-lysine dipeptide;
  • Xn is threonine, alanine, or a threonine-arginine-arginine tripeptide
  • R is selected from the group consisting of H and Q-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-C 8 alkyl, C 2 -C 8 alkenyl, (C 1 -C4 alkyl)OH, (C 1 -C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of Q-Cg alkyl, (C 1 -C 4 alkyl)OH, (C C 4 alkyl)SH, (C C 4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • R 1 and R 14 are independently COOH or CONH 2 , with the proviso that one and only one of X 12 , X 1 , or J is a dipeptide comprising the general structure:
  • J is a dipeptide comprising the general structure:
  • X and X 12 are each OH and X 13 is H, with the further proviso that when R 4 and R 3 together with the atoms to which they are attached form a 5 member heterocyclic ring, both R and R 2 are other than H.
  • X 12 is NHRn
  • J and X 13 are each H and X is OH.
  • X 13 is NHR 12
  • X and X 12 are each OH and J is H.
  • the B chain comprises the sequence J-
  • X 9 VNQX 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 YTPKT SEQ ID NO: 15
  • J- X 9 VNQX 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 YTKPT SEQ ID NO: 16
  • J, X 4 , X 5 , X 6 , X 7 , Xg and X 9 are defined as immediately above.
  • R 3 is C -C alkyl and R 4 is selected from the group consisting of H, C C 4 alkyl, or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • X 4 is histidine
  • X 5 is serine
  • X 6 is histidine.
  • an insulin prodrug analog comprising an A chain sequence of (SEQ ID NO: 3) and a B chain sequence comprising a sequence of X 4 LCGXsX 6 LVEALYLVCGERGFF (SEQ ID NO: 4) wherein
  • Z is H or a dipeptide comprising the general structure:
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure O
  • X is selected from the group consisting of OH, NH 2 , NHR 10 and OCH 3 , wherein Rio is a dipeptide comprising the general structure:
  • X3 is selected from the group consisting of asparagine, glycine, alanine, threonine, or serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • Ri is selected from the group consisting of H and Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Ce alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 3 is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (Q-C4 alkyl)SH, (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring; and R 7 is selected from the group consisting of H and OH, with the proviso that X and Z are not both dipeptides and Z is not H when X is OH.
  • the A chain comprises a sequence of Z- GIVEQCCXiSICSLYQLENYCXs (SEQ ID NO: 17) and the B chain sequence comprises the sequence X 9 VNQX 4 LCGX 5 X 6 LVEALYLVCGERGFFYTPKT (SEQ ID NO: 12) or X 9 VNQX 4 LCGX 5 X 6 LVEALYLVCGERGFFYTKPT (SEQ ID NO: 13).
  • an insulin prodrug analog comprising an A chain sequence of GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and a B chain sequence comprising the sequence
  • X 2 is an amino acid of the general structure
  • U is an amino acid or a hydroxyl acid and O is an N-alkylated amino acid
  • X is asparagine, glycine, alanine, threonine, or serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X 5 is selected from the group consisting of alanine, glycine and serine
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid
  • X9 is selected from the group consisting of phenylalanine and desamino- phenylalanine.
  • U-0 represent a dipeptide of the general structure
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cs alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 + ) NH 2 , (Co-C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , CH 2 (C 5 -C 9 heteroaryl), or Ri and R 2 together with the atoms to which they are attached form a C 3 -C 6 cycloalkyl;
  • R is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (C - C 4 alkyl)SH, (C C 4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • X 7 is tyrosine, Xg is phenylalanine and X9 is phenylalanine, and in an additional further embodiment X 4 is histidine, X5 is serine and X 6 is histidine.
  • U-0 represent a dipeptide of the general structure
  • R ⁇ R 2> Ri and R 8 are independently selected from the group consisting of H,
  • R 3 is selected from the group consisting of C C ⁇ alkyl, (C C ⁇ alkyl)OH, (C1-C18 alkyl)NH 2 , (Ci-Cie alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-Cg alkyl or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-C ⁇ alkyl, C 2 -Ci 8 alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin prodrug analog comprising an A chain sequence of Z-GIVEQCCTSICSLYQLENX 2 CX 3 -R 13 (SEQ ID NO: 18) and a B chain sequence comprising a sequence of X 4 LCGSHLVEALYLVCGERGFF-R 14 (SEQ ID NO: 19) wherein
  • Z is H or an amide linked dipeptide comprising the general structure:
  • X 2 is an amino acid of the general structure O
  • X is selected from the group consisting of OH and NHR 10 ; wherein Rio is a dipeptide comprising the general structure:
  • X 3 is serine, asparagine or glycine
  • X 4 is selected from the group consisting of histidine and threonine
  • Ri is selected from the group consisting of H and Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 + ) NH 2 , (Co-C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , CH 2 (C 5 -C 9 heteroaryl), or Ri and R 2 together with the atoms to which they are attached form a C 3 -C 6 cycloalkyl;
  • R is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (Ci- C 4 alkyl)SH, (C 3 -C6)cycloalkyl or R 4 and R together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • Ri 3 and Ri 4 are independently COOH or CONH 2 ; with the proviso that when Z is H, X is not OH and when X is OH, Z is not H.
  • Ri is COOH and Ri 4 is CONH 2 .
  • X 2 is an amino acid of the general structure of Formula III:
  • Z is H, X 3 is serine, X 4 is histidine, R 13 is COOH and R 14 is CONH 2 .
  • Ri is selected from the group consisting of H and Ci-C 4 alkyl
  • R 2 is selected from the group consisting of H, CrC 6 alkyl, C 2 -C8 alkenyl, (Cr C 4 alkyl)OH, (C1-C4 alkyl)NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , and CH 2 (Cs-C9 heteroaryl) or R 2 and R 6 together with the atoms to which they are attached form a 5 member heterocyclic ring;
  • R 3 is Ci-C 6 alkyl
  • R 4 is selected from the group consisting of H and C C 4 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • R is CH
  • Rj is H and R5 is NH 2
  • R5 is NH 2 and R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • the B chain of the insulin prodrug analog comprises the sequence
  • FVNQHLCGSHLVEALYLVCGERGFFYTKPT-R 14 (SEQ ID NO: 9) or
  • FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR-R 14 (SEQ ID NO: 10), wherein R 14 is COOH or CONH 2 , and in one embodiment R 14 is CONH 2 .
  • an insulin prodrug analog comprising a polypeptide of the sequence Z-GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3), wherein
  • Z is a dipeptide comprising the general structure:
  • i is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , and
  • X 3 is asparagine, glycine, alanine, threonine, or serine;
  • Ri is selected from the group consisting of H and Ci-Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (C 1 -C4 alkyl)OH, (C 1 -C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4 alkyl)CONH 2 , (C 1 -C4 alkyl)COOH, (C 1 -C4 alkyl)NH 2 , (C 1 -C4 alkyl)NHC(NH 2 + ) NH 2 , (Co-C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , CH 2 (C 5 -C 9 heteroaryl), or Ri and R 2 together with the atoms to which they are attached form a C 3 -C6
  • R 3 is selected from the group consisting of Ci-Cg alkyl, (C 1 -C 4 alkyl)OH, (C - C 4 alkyl)SH, (C 1 -C4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • Xi is threonine and X 3 is asparagine or glycine and in a further embodiment R 3 is C -C alkyl and R 4 is selected from the group consisting of H, C 1 -C 4 alkyl, (C 3 - C 6 )cycloalkyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH and (C 0 -C 4 alkyl)(C 6 aryl)R 7 , or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring, with the proviso that when R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring, both R and R 2 are both other than H.
  • an insulin prodrug analog comprising a polypeptide of the sequence (SEQ ID NO: 3), wherein
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is asparagine, glycine, alanine, threonine, or serine;
  • Ri is selected from the group consisting of H and C Cg alkyl
  • R 2 and R 4 are independently selected from the group consisting of H, Ci-Cg alkyl, C 2 -C 8 alkenyl, (Ci-C 4 alkyl)OH, (Ci-C 4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (Ci-C 4 alkyl)CONH 2 , (Ci-C 4 alkyl)COOH, (Ci-C 4 alkyl)NH 2 , (Ci-C 4 alkyl)NHC(NH 2 + ) NH 2 ,
  • R is selected from the group consisting of
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring; and R 7 is selected from the group consisting of H and OH.
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring; and R 7 is selected from the group consisting of H and OH.
  • the A chain of GIVEQCCXiSICSLYQLENXaCXs (SEQ ID NO: 3) as defined immediately above is linked, either by disulfide bonds or as a single chain
  • polypeptide to a B chain comprising the sequence X 14 - X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) wherein
  • X 4 is selected from the group consisting of histidine and threonine
  • X 5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is tyrosine
  • Xg is phenylalanine.
  • R ⁇ R 2> and R 4 are independently selected from the group consisting of H, C - Ci8 alkyl, C 2 -C 18 alkenyl, (Ci-Cie alkyl)OH, (Ci-Cie alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (Ci-C 4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of C C ⁇ alkyl, (C -Cn alkyl)OH, (Ci-Cie alkyl)NH 2 , (Ci-Cie alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , and (C1-C4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-C8 alkyl or R 6 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Ci 8 alkenyl, (C 0 -C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • R 3 is CrC 6 alkyl and R 4 is selected from the group consisting of H and C 1 -C 4 alkyl, or alternatively, R and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • X 1 is threonine and X 3 is asparagine or glycine.
  • R is selected from the group consisting of H and C C 6 alkyl
  • R 2 is selected from the group consisting of H, CrC 6 alkyl, (CrC 4
  • R 3 is Ci-C 6 alkyl
  • R 4 is selected from the group consisting of H, C C 4 alkyl, (C 3 - C 6 )cycloalkyl, and (Co-C 4 alkylXCe-Qo aryl)R 7 , or R and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • a single-chain insulin prodrug analog wherein the carboxy terminus of the human insulin B chain, or a functional analog thereof, is covalently linked to the N-terminus of the human insulin A chain, or functional analog thereof, and further wherein a dipeptide prodrug moiety having the general structu
  • the single-chain insulin analog comprises a compound of the formula: B-P-A, wherein: B represents the B-chain of human insulin or one of the functional or prodrug analogs of a B chain as disclosed herein, A represents the A chain of human insulin or one of the functional or prodrug analogs of an A chain as disclosed herein, and P represents a linker, including a peptide linker, that covalently joins the A chain to the B chain.
  • the linker is a peptide linker of about 5 to about 18, or about 10 to about 14, or about 4 to about 8, or about 6 amino acids.
  • the B chain is linked to the A chain via peptide linker of 4-12 or 4-8 amino acids.
  • the peptide linker of the single chain analog is selected from the group consisting of GYGSSSRRAPQT; SEQ ID NO: 23, GYGSSSRR (SEQ ID NO: 66), GYGSSSOR (SEQ ID NO: 69), GYGSSSX 7 X 8 (SEQ ID NO: 71), or
  • the linking moiety of the single chain analogs can also serve as a site for the attachment of the dipeptide element, and in one embodiment the linking moiety is a peptide linker that comprises an amino acid having a side chain group suitable for attaching the dipeptide element of the present invention via an amide linkage.
  • the single-chain insulin prodrug analog of the formula B- P-A comprises an A chain having the sequence GIVEQCCX 1 SICSLYQLENX 2 CX 3 (SEQ ID NO: 3) and a B chain sequence that includes the sequence of J-X 14 - X 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 (SEQ ID NO: 14) wherein J is H or a dipeptide comprising the general structure:
  • X 14 is either a bond or a 1 to 4 amino acid sequence selected from the group consisting of a FVNQ (SEQ ID NO: 11), VNQ, NQ and Q .
  • i is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NHR 10 and OCH 3 ; wherein R 10 is H or a dipeptide comprising the general structure:
  • X 3 is asparagine, glycine, alanine, threonine, or serine.
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid
  • X 7 is an amino acid of the general structure
  • X 12 is selected from the group consisting of OH, OCH and NHRn, wherein Rn is H or a dipeptide comprising the general structure:
  • Xg is an amino acid of the general structure
  • R is selected from the group consisting of H and Ci-C % alkyl
  • R 2 and R 4 are independently selected from the group consisting of H,
  • Ci-Ce alkyl C 2 -C 8 alkenyl, (C1-C4 alkyl)OH, (C1-C4 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R is selected from the group consisting of alkyl, (C 1 -C 4 alkyl)OH, (C C 4 alkyl)SH, (C C 4 alkyl)NH 2 , (C 3 -C 6 )cycloalkyl or R 4 and R 3 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, or R 6 and R 2 together with the atoms to which they are attached form a 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH, with the proviso that one and only one of Z, J, R 10 , Rn or R 12 is a dipeptide comprising the general structure:
  • R4 , and X and X 12 are each OH and X 13 is H, with the proviso that when R 4 and R 3 together with the atoms to which they are attached form a 5 member heterocyclic ring, both R and R 2 are other than H.
  • X 12 comprises the dipeptide of Formula I
  • J and X 13 are each H and X is OH.
  • X 13 is comprises the dipeptide of Formula I, X and X 12 are each OH and J is H.
  • X comprises the dipeptide of Formula I, J and X 13 are each H and X 12 is OH.
  • the B chain comprises the sequence J-X 9 VNQX 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 YTPKT (SEQ ID NO: 15) or J-X 9 VNQX 4 LCGX 5 X 6 LVEALX 7 LVCGERGFX 8 YTKPT (SEQ ID NO: 16), wherein J, X 4 , X5, X 6 , X 7 , X 8 and X 9 are defined as immediately above.
  • R 3 is C -C alkyl and R 4 is selected from the group consisting of H, C C 4 alkyl, or R 3 and R 4 together with the atoms to which they are attached form a 5 member heterocyclic ring.
  • X 4 is histidine
  • X5 is serine
  • X 6 is histidine.
  • the single chain insulin analog comprises a compound of the formula: B-P-A, wherein:
  • B represents a B chain sequence comprising a sequence of
  • A represents an A chain sequence comprising a sequence of
  • GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO: 3) or a functional analog thereof and "P" represents a linker including for example an 8-12 amino acid linker, wherein i is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X 3 is asparagine or glycine
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid.
  • the single-chain insulin analog comprises a compound of the formula: A-P-B, wherein: A represents a human insulin A chain, or a functional analog thereof, B represents a human insulin B chain, or a functional analog thereof, and P represents a linker, including a peptide linker, that covalently joins the amino- terminus of the B chain to the carboxy- terminus of the A chain.
  • the peptide linker comprises 4 to 8 amino acids.
  • the peptide linker is 5 to 18 amino acids in length and comprises a sequence selected from the group consisting of: Gly-Gly- Gly-Pro-Gly-Lys-Arg (SEQ ID NO: 22), Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro- Gln-Thr (SEQ ID NO: 23), Arg-Arg-Gly-Pro-Gly-Gly-Gly (SEQ ID NO: 32), Gly- Gly-Gly-Gly-Gly-Lys-Arg (SEQ ID NO: 24), Arg-Arg-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 25), Gly-Gly-Ala-Pro-Gly-Asp-Val-Lys-Arg (SEQ ID NO: 26), Arg-Arg-Ala- Pro-Gly-Asp-Val-Gly-Gly (SEQ ID NO: 27), Gly-Gly-Ty
  • the peptide linker is 7 to 12 amino acids in length and comprises the sequence Gly-Gly-Gly-Pro-Gly-Lys-Arg (SEQ ID NO: 22) or Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr (SEQ ID NO: 23).
  • the peptide linker comprises a sequence selected from the group consisting of AGRGSGK (SEQ ID NO: 35), AGLGSGK (SEQ ID NO: 36), AGMGSGK (SEQ ID NO: 37), ASWGSGK (SEQ ID NO: 38 ), TGLGSGQ (SEQ ID NO: 39), TGLGRG (SEQ ID NO: 40), TGLGSG (SEQ ID NO: 41), HGLYSGK (SEQ ID NO: 42), KGLGSGQ (SEQ ID NO: 43), VGLMSG (SEQ ID NO: 44), VGLSSGQ (SEQ ID NO: 45), VGLYSGK (SEQ ID NO: 46), VGLSSG (SEQ ID NO: 47), VGMSSGK (SEQ ID NO: 48), VWSSSGK (SEQ ID NO: 49), VGSSSGK (SEQ ID NO: 50), VGMSSGK (SEQ I D NO: 51), TGLGSGR (SEQ ID NO: 52), TGLGKGQ (SEQ ID NO:
  • the insulin peptides disclosed herein may be part of a dimer, trimer or higher order multimer comprising at least two, three, or more peptides bound via a linker, wherein at least one or both peptides comprises a dipeptide prodrug element linked to the insulin peptide.
  • the dimer may be a homodimer or heterodimer, comprising peptides selected from the group consisting of native insulin, native IGF-1, native IGF-II and insulin analog peptides as disclosed herein.
  • the linker is selected from the group consisting of a bifunctional thiol crosslinker and a bi- functional amine crosslinker.
  • the linker is PEG, e.g., a 5 kDa PEG, 20 kDa PEG.
  • the linker is a disulfide bond.
  • each monomer of the dimer may comprise a Cys residue (e.g., a terminal or internally positioned Cys) and the sulfur atom of each Cys residue participates in the formation of the disulfide bond.
  • Each monomer of the dimer represents a heterodimer of an A and B chain.
  • the A and B chain are either linked via disulfide bonds or are prepared as single chain peptides.
  • the monomers are connected via terminal amino acids (e.g., N-terminal or C-terminal), via internal amino acids, or via a terminal amino acid of at least one monomer and an internal amino acid of at least one other monomer. In specific aspects, the monomers are not connected via an N-terminal amino acid.
  • the monomers of the multimer are attached together in a "tail-to-tail" orientation in which the C-terminal amino acids of each monomer are attached together.
  • a conjugate moiety may be covalently linked to any of the insulin peptides described herein, including a dimer, trimer or higher order multimer.
  • the prodrugs disclosed herein can be further modified to improve the peptide's solubility in aqueous solutions at physiological pH, while enhancing the effective duration of the peptide by preventing renal clearance of the peptide. Peptides are easily cleared because of their relatively small molecular size when compared to plasma proteins. Increasing the molecular weight of a peptide above 40 kDa exceeds the renal threshold and significantly extends duration in the plasma.
  • the peptide prodrugs are further modified to comprise a covalently linked hydrophilic moiety.
  • the hydrophilic moiety is a plasma protein polyethylene oxide chain or the Fc portion of an immunoglobin. Therefore, in one embodiment the presently disclosed prodrugs are further modified to comprise one or more hydrophilic groups covalently linked to the side chains of amino acids.
  • the insulin prodrugs disclosed herein are further modified by linking a hydrophilic moiety to either the N-terminal amino acid of the B chain or to the side chain of a lysine amino acid located at the carboxy terminus of the B chain, including for example, at position 28 of SEQ ID NO: 9/SEQ ID NO: 13 or at position 29 of SEQ ID NO: 8/SEQ ID NO: 12.
  • a single-chain insulin prodrug analog is provided wherein one of the amino acids of the peptide linker is modified by linking a hydrophilic moiety to the side chain of the peptide linker.
  • the modified amino acid is cysteine, lysine or acetyl phenylalanine.
  • the peptide linker is selected from the group consisting of TGLGSGQ (SEQ ID NO: 39), VGLSSGQ (SEQ ID NO: 45), VGLSSGK (SEQ ID NO: 47), TGLGSGR (SEQ ID NO: 52), TGLGKGQ (SEQ ID NO: 53), KGLSSGQ (SEQ ID NO: 54), VKLSSGQ (SEQ ID NO: 55), VGLKSGQ (SEQ ID NO: 56), TGLGKGQ (SEQ ID NO: 57) and VGLSKGQ (SEQ ID NO: 58) and the hydrophilic moiety (e.g., polyethylene glycol) is linked to the lysine side chain of the peptide linker.
  • the hydrophilic moiety e.g., polyethylene glycol
  • the insulin prodrug analogs disclosed herein are further modified by the addition of a modified amino acid to the carboxy terminus of the B chain of the insulin prodrug, wherein the C-terminally added amino acid is modified to comprise a hydrophilic moiety linked to the amino acid.
  • the amino acid added to the C-terminus is a modified cysteine, lysine or acetyl phenylalanine.
  • the hydrophilic moiety is selected from the group consisting of a plasma protein, polyethylene oxide chain and an Fc portion of an immunoglobin.
  • the hydrophilic group is a polyethylene oxide chain, and in one embodiment two or more polyethylene oxide chains are covalently attached to two or more amino acid side chains of the insulin prodrug analog.
  • the hydrophilic moiety is covalently attached to an amino acid side chain of an insulin prodrug analog disclosed herein at a position selected from the group consisting of A9, A14, A15, B22, B28, B29 and the C-terminus or N-terminus of the B chain.
  • the polyethylene oxide chains can be attached at the N-terminal amino acid of the B chain or to the side chain of a lysine amino acid located at the carboxy terminus of the B chain, or by the addition of a single amino acid at the C-terminus of the peptide wherein the added amino acid has a polyethylene oxide chain linked to its side chain.
  • the polyethylene oxide chain or other hydrophilic moiety is linked to the side chain of one of the two amino acids comprising the dipeptide prodrug element.
  • the dipeptide prodrug element comprises a lysine (in the D or L configuration) with a polyethylene oxide chain attached to the side chain amine of the lysine. Linkage of hydrophilic moieties
  • solubility of the insulin analogs disclosed herein are enhanced by the covalent linkage of a hydrophilic moiety to the peptide.
  • Hydrophilic moieties can be attached to the insulin analogs under any suitable conditions used to react a protein with an activated polymer molecule. Any means known in the art can be used, including via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemo selective conjugation/ligation methods through a reactive group on the PEG moiety (e.g., an aldehyde, amino, ester, thiol, a- haloacetyl, maleimido or hydrazino group) to a reactive group on the target compound (e.g., an aldehyde, amino, ester, thiol, a-haloacetyl, maleimido or hydrazino group).
  • a reactive group on the PEG moiety e.g., an aldehyde, amino, ester, thiol, a-haloacetyl, maleimido or hydrazino group
  • Activating groups which can be used to link the water soluble polymer to one or more proteins include without limitation sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane and 5-pyridyl. If attached to the peptide by reductive alkylation, the polymer selected should have a single reactive aldehyde so that the degree of polymerization is controlled. See, for example, Kinstler et al., Adv. Drug. Delivery Rev. 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev. 54: 459- 476 (2002); and Zalipsky et al., Adv. Drug Delivery Rev. 16: 157-182 (1995).
  • Suitable hydrophilic moieties include polyethylene glycol (PEG),
  • polypropylene glycol polyoxyethylated polyols (e.g., POG), polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG),
  • POG polyoxyethylated polyols
  • POG polyoxyethylated glycerol
  • polyoxyalkylenes polyethylene glycol propionaldehyde, copolymers of ethylene glycol/propylene glycol, monomethoxy-polyethylene glycol, mono-(Cl-ClO) alkoxy- or aryloxy-polyethylene glycol, carboxymethylcellulose, polyacetals, polyvinyl alcohol (PVA), polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, poly (.beta. -amino acids) (either
  • polysaccharide polymers Ficoll or dextran and mixtures thereof.
  • the hydrophilic moiety e.g., polyethylene glycol chain in accordance with one embodiment has a molecular weight selected from the range of about 500 to about 40,000 Daltons.
  • the hydrophilic moiety, e.g. PEG has a molecular weight selected from the range of about 500 to about 5,000 Daltons, or about 1,000 to about 5,000 Daltons.
  • the hydrophilic moiety, e.g., PEG has a molecular weight of about 10,000 to about 20,000 Daltons.
  • the hydrophilic moiety, e.g., PEG has a molecular weight of about 20,000 to about 40,000 Daltons.
  • dextrans are used as the hydrophilic moiety.
  • Dextrans are polysaccharide polymers of glucose subunits, predominantly linked by al-6 linkages.
  • Dextran is available in many molecular weight ranges, e.g., about 1 kDa to about 100 kDa, or from about 5, 10, 15 or 20 kDa to about 20, 30, 40, 50, 60, 70, 80 or 90 kDa.
  • Linear or branched polymers are contemplated. Resulting preparations of conjugates may be essentially monodisperse or polydisperse, and may have about 0.5, 0.7, 1, 1.2, 1.5 or 2 polymer moieties per peptide.
  • the insulin prodrug analogs disclosed herein are further modified by amino acid substitutions, wherein the substituting amino acid comprises a side chain suitable for crosslinking with hydrophilic moieties, including for example, polyethylene glycol.
  • the amino acid at the position of the insulin prodrug analog where the hydrophilic moiety is to be linked is substituted (or added at the C-terminus) with a natural or synthetic amino acid to introduce, or allow for ease in attaching, the hydrophilic moiety.
  • a native amino acid at position selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, Bl, B2, B3, B4, B5, B13, B 14, B17, B21, B22, B26, B27, B28, B29 and B30 is substituted with a lysine, cysteine or acetyl phenylalanine residue (or a lysine, cysteine or acetyl phenylalanine residue is added to the C-terminus) to allow for the covalent attachment of a polyethylene glycol chain.
  • the insulin prodrug analog has a single cysteine residue added to the carboxy terminus of the B chain, or the insulin prodrug analog is substituted with at least one cysteine residue, wherein the side chain of the cysteine residue is further modified with a thiol reactive reagent, including for example, maleimido, vinyl sulfone, 2-pyridylthio, haloalkyl, and haloacyl.
  • thiol reactive reagents may contain carboxy, keto, hydroxyl, and ether groups as well as other hydrophilic moieties such as polyethylene glycol units.
  • the insulin prodrug analog has a single lysine residue added to the carboxy terminus of the B chain, or the insulin prodrug analog is substituted with lysine, and the side chain of the substituting lysine residue is further modified using amine reactive reagents such as active esters (succinimido, anhydride, etc) of carboxylic acids or aldehydes of hydrophilic moieties such as polyethylene glycol.
  • active esters succinimido, anhydride, etc
  • the polyethylene glycol chain may be in the form of a straight chain or it may be branched.
  • the polyethylene glycol chain has an average molecular weight selected from the range of about 20,000 to about 60,000 Daltons.
  • Multiple polyethylene glycol chains can be linked to the insulin prodrug analog to provide an insulin prodrug analog with optimal solubility and blood clearance properties.
  • the insulin prodrug analog is linked to a single polyethylene glycol chain that has an average molecular weight selected from the range of about 20,000 to about 60,000 Daltons.
  • the insulin prodrug analog is linked to two polyethylene glycol chains wherein the combined average molecular weight of the two chains is selected from the range of about 40,000 to about 80,000 Daltons.
  • a single polyethylene glycol chain having an average molecular weight of 20,000 or 60,000 Daltons is linked to the insulin prodrug analog.
  • a single polyethylene glycol chain is linked to the insulin prodrug analog and has an average molecular weight selected from the range of about 40,000 to about 50,000 Daltons.
  • two polyethylene glycol chains are linked to the insulin prodrug analog wherein the first and second polyethylene glycol chains each have an average molecular weight of 20,000 Daltons.
  • two polyethylene glycol chains are linked to the insulin prodrug analog wherein the first and second polyethylene glycol chains each have an average molecular weight of 40,000 Daltons.
  • an insulin prodrug analog comprising two or more polyethylene glycol chains covalently bound to the peptide is provided, wherein the total molecular weight of the polyethylene glycol chains is about 40,000 to about
  • the pegylated insulin prodrug analog comprises a polyethylene glycol chain linked to one or more amino acids selected from the N- terminus of the B chain and/or position 28 of SEQ ID NO: 9 or at position 29 of SEQ ID NO: 8, wherein the combined molecular weight of the PEG chain(s) is about 40,000 to about 80,000 Daltons.
  • an insulin peptide, or prodrug/depot derivative thereof is fused to an accessory peptide which is capable of forming an extended conformation similar to chemical PEG (e.g., a recombinant PEG (rPEG) molecule), such as those described in International Patent Application Publication No. WO2009/023270 and U.S. Patent Application Publication No. US2008/0286808.
  • the rPEG molecule is not polyethylene glycol.
  • the rPEG molecule in some aspects is a polypeptide comprising one or more of glycine, serine, glutamic acid, aspartic acid, alanine, or proline.
  • the rPEG is a homopolymer, e.g., poly-glycine, poly-serine, poly-glutamic acid, poly-aspartic acid, poly-alanine, or poly-proline.
  • the rPEG comprises two types of amino acids repeated, e.g., poly(Gly-Ser), poly(Gly-Glu), poly(Gly-Ala), poly(Gly-Asp), poly(Gly-Pro), poly(Ser-Glu), etc.
  • the rPEG comprises three different types of amino acids, e.g., poly(Gly-Ser-Glu).
  • the rPEG increases the half- life of the insulin peptide.
  • the rPEG comprises a net positive or net negative charge.
  • the rPEG in some aspects lacks secondary structure.
  • the rPEG is greater than or equal to 10 amino acids in length, and in one embodiment is about 40 to about 50 amino acids in length.
  • the accessory peptide in some aspects is fused to the N- or C- terminus of the peptide of the invention through a peptide bond or a proteinase cleavage site, or is inserted into the loops of the peptide of the invention.
  • the rPEG in some aspects comprises an affinity tag or is linked to a PEG that is greater than 5 kDa.
  • the rPEG confers the peptide of the invention with an increased hydrodynamic radius, serum half-life, protease resistance, or solubility and in some aspects confers the peptide with decreased immunogenicity.
  • an insulin prodrug analog wherein a plasma protein has been covalently linked to an amino acid side chain of the peptide to improve the solubility, stability and/or pharmacokinetics of the insulin prodrug analog.
  • a plasma protein has been covalently linked to an amino acid side chain of the peptide to improve the solubility, stability and/or pharmacokinetics of the insulin prodrug analog.
  • serum albumin can be covalently bound to the insulin prodrug analogs presented herein.
  • the plasma protein is covalently bound to the N-terminus of the B chain and/or to an amino acid
  • an insulin prodrug analog wherein a linear amino acid sequence representing the Fc portion of an immunoglobin molecule has been covalently linked to an amino acid side chain of an insulin prodrug analog disclosed herein to improve the solubility, stability and/or pharmacokinetics of the insulin prodrug analog.
  • the amino acid sequence representing the Fc portion of an immunoglobin molecule can be covalently bound to the N-terminus of the B chain or the C-terminus of the A or B chain, or the C-terminus of an A or B chain that has been terminally extended.
  • the amino acid sequence representing the Fc portion of an immunoglobin molecule can be covalently bound to the C-terminus of the B chain, including for example linkage to an amino acid corresponding to position 28 of SEQ ID NO: 9 or at position 29 of SEQ ID NO: 8.
  • the Fc portion is typically one isolated from IgG, but the Fc peptide fragment from any immunoglobin should function equivalently.
  • the insulin prodrug analog is modified to comprise an alkyl or acyl group by direct alkylation or acylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the insulin prodrug analog.
  • the insulin prodrug analog is directly acylated through the side chain amine, hydroxyl, or thiol of an amino acid.
  • acylation is at one or more positions selected from A9, A14, A15, B22, B28 or B29.
  • the acylated insulin prodrug analog can comprise an A chain amino acid sequence of SEQ ID NO: 3 and a B chain of SEQ ID NO: 5, or a modified amino acid sequence of SEQ ID NO: 3 and/or SEQ ID NO: 5 with at least one of the amino acids at positions A9, A14, A15, B22, B28 or B29 modified to any amino acid comprising a side chain amine, hydroxyl, or thiol.
  • the direct acylation of the insulin prodrug analog occurs through the side chain amine, hydroxyl, or thiol of the amino acid at position B28 or B29.
  • the insulin prodrug analog comprises an acyl group of a carboxylic acid with 1-24 carbon atoms bound to the epsilon-amino group of a Lys present at position B28 or B29.
  • a single-chain insulin prodrug analog is provided wherein one of the amino acids of the peptide linker is modified to comprise an acyl group by direct acylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the peptide linker.
  • the peptide linker of the single-chain insulin analog is selected from the group consisting of AGRGSG K (SEQ ID NO: 35), AGLGSGK (SEQ ID NO: 36), AGMGSGK (SEQ ID NO: 37), ASWGSGK (SEQ ID NO: 38), TGLGSGQ (SEQ ID NO: 39), TG LGRG K (SEQ ID NO: 40), TGLGSGK (SEQ ID NO: 41), HGLYSGK (SEQ ID NO: 42), KGLGSGQ (SEQ ID NO: 43), VGLMSGK (SEQ ID NO: 44), VGLSSGQ (SEQ ID NO: 45), VGLYSGK (SEQ ID NO: 46), VGLSSG (SEQ ID NO: 47), VGMSSGK (SEQ ID NO: 48 ), VWSSSGK (SEQ ID NO: 49), VGSSSG (SEQ ID NO: 50), VGMSSGK (SEQ ID NO: 51), TGLGSGR (SEQ ID NO: 52),
  • the acylating group comprises a 1-5, 10-12 or 12-24 carbon chain.
  • the insulin prodrug analogs as disclosed herein are further modified to link an additional compound to the prodrug dipeptide moiety of the analog.
  • the side chain of an amino acid comprising the dipeptide prodrug element is pegylated, acylated or alkylated.
  • the dipeptide is acylated with a group comprising a 1-5, 10-12 or 12-24 carbon chain.
  • the dipeptide is pegylated with a 40-80 KDa polyethylene glycol chain.
  • the dipeptide prodrug element is pegylated and the insulin peptide linked to the dipeptide is acylated, including, for example, acylation at the C- terminal lysine of the B chain.
  • a hydrophilic moiety or a sequestering macromolecule is covalently linked to the R 2 side chain of the dipeptide comprising the general structure:
  • R 2 is selected from the group consisting of (Ci-C 4 alkyl)OH, (Ci-C 4 alkyl)SH, and (Ci-C 4 alkyl)NH 2 .
  • R 2 is (C3-C4 alkyl)NH 2 .
  • Sequestering macromolecules are known to those skilled in the art and include dextrans and large molecular weight polyethylene glycol (i.e., greater than or equal to 80 KDa) By linking the sequestering
  • the prodrug will remain sequestered, while the active insulin peptide is slowly released based on the kinetics of the cleavage of the dipeptide amide bond.
  • the present disclosure also encompasses other conjugates in which insulin prodrug analogs of the invention are linked, optionally via covalent bonding, and optionally via a linker, to a conjugate.
  • Linkage can be accomplished by covalent chemical bonds, physical forces such electrostatic, hydrogen, ionic, van der Waals, or hydrophobic or hydrophilic interactions.
  • a variety of non-covalent coupling systems may be used, including biotin-avidin, ligand/receptor, enzyme/substrate, nucleic acid/nucleic acid binding protein, lipid/lipid binding protein, cellular adhesion molecule partners; or any binding partners or fragments thereof which have affinity for each other.
  • conjugates include but are not limited to a heterologous peptide or polypeptide (including for example, a plasma protein), a targeting agent, an immunoglobulin or portion thereof (e.g. variable region, CDR, or Fc region), a diagnostic label such as a radioisotope, fluorophore or enzymatic label, a polymer including water soluble polymers, or other therapeutic or diagnostic agents.
  • a conjugate is provided comprising an insulin prodrug analog of the present disclosure and a plasma protein, wherein the plasma protein is selected from the group consisting of albumin, transferin and fibrinogen.
  • the plasma protein moiety of the conjugate is albumin or transferin.
  • the linker comprises a chain of atoms from 1 to about 60, or 1 to 30 atoms or longer, 2 to 5 atoms, 2 to 10 atoms, 5 to 10 atoms, or 10 to 20 atoms long.
  • the chain atoms are all carbon atoms.
  • the chain atoms in the backbone of the linker are selected from the group consisting of C, O, N, and S. Chain atoms and linkers may be selected according to their expected solubility (hydrophilicity) so as to provide a more soluble conjugate.
  • the linker provides a functional group that is subject to cleavage by an enzyme or other catalyst or hydrolytic conditions found in the target tissue or organ or cell.
  • the length of the linker is long enough to reduce the potential for steric hindrance.
  • the linker is a covalent bond or a peptidyl bond and the conjugate is a polypeptide
  • the entire conjugate can be a fusion protein.
  • peptidyl linkers may be any length. Exemplary linkers are from about 1 to 50 amino acids in length, 5 to 50, 3 to 5, 5 to 10, 5 to 15, or 10 to 30 amino acids in length.
  • Such fusion proteins may alternatively be produced by recombinant genetic engineering methods known to one of ordinary skill in the art.
  • the present disclosure also encompasses other conjugates in which the insulin analogs disclosed herein are linked, optionally via covalent bonding and optionally via a linker, to a conjugate moiety.
  • Linkage can be accomplished by covalent chemical bonds, physical forces such electrostatic, hydrogen, ionic, van der Waals, or hydrophobic or hydrophilic interactions.
  • a variety of non-covalent coupling systems may be used, including biotin-avidin, ligand/receptor, enzyme/substrate, nucleic acid/nucleic acid binding protein, lipid/lipid binding protein, cellular adhesion molecule partners; or any binding partners or fragments thereof which have affinity for each other.
  • the peptide can be linked to conjugate moieties via direct covalent linkage by reacting targeted amino acid residues of the peptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues of these targeted amino acids.
  • Reactive groups on the peptide or conjugate include, e.g., an aldehyde, amino, ester, thiol, a-haloacetyl, maleimido or hydrazino group.
  • Derivatizing agents include, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride or other agents known in the art.
  • the conjugate moieties can be linked to the peptide indirectly through intermediate carriers, such as polysaccharide or polypeptide carriers.
  • polysaccharide carriers include aminodextran.
  • suitable polypeptide carriers include polylysine, polyglutamic acid, polyaspartic acid, co-polymers thereof, and mixed polymers of these amino acids and others, e.g., serines, to confer desirable solubility properties on the resultant loaded carrier.
  • Cysteinyl residues most commonly are reacted with a-haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl derivatives. Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone, alpha-bromo- -(5- imidozoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2- pyridyl disulfide, methyl 2-pyridyl disulfide, p-chloromercuribenzoate, 2- chloromercuri-4-nitrophenol, or chloro-7-nitrobenzo-2-oxa- 1 ,3-diazole.
  • a-haloacetates and corresponding amines
  • corresponding amines such as chloroacetic acid or chloroacetamide
  • Histidyl residues are derivatized by reaction with diethylpyrocarbonate at pH 5.5-7.0 because this agent is relatively specific for the histidyl side chain.
  • Para- bromophenacyl bromide also is useful; the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
  • Lysinyl and amino-terminal residues are reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues.
  • Other suitable reagents for derivatizing alpha-amino-containing residues include imidoesters such as methyl picolinimidate, pyridoxal phosphate, pyridoxal, chloroborohydride, trinitrobenzenesulfonic acid, O- methylisourea, 2,4-pentanedione, and transaminase-catalyzed reaction with glyoxylate.
  • Arginyl residues are modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization of arginine residues requires that the reaction be performed in alkaline conditions because of the high pK a of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine epsilon- amino group.
  • tyrosyl residues may be made, with particular interest in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane.
  • aromatic diazonium compounds or tetranitromethane Most commonly, N-acetylimidizole and tetranitromethane are used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively.
  • R and R' are different alkyl groups, such as l-cyclohexyl-3-(2-morpholinyl-4-ethyl) carbodiimide or l-ethyl-3-(4- azonia-4,4-dimethylpentyl) carbodiimide.
  • aspartyl and glutamyl residues are converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
  • Sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or
  • conjugate moieties that can be linked to any of the insulin analogs described herein include but are not limited to a heterologous peptide or polypeptide (including for example, a plasma protein), a targeting agent, an immunoglobulin or portion thereof (e.g. variable region, CDR, or Fc region), a diagnostic label such as a radioisotope, fluorophore or enzymatic label, a polymer including water soluble polymers, or other therapeutic or diagnostic agents.
  • a conjugate comprising an insulin analog disclosed herein and a plasma protein, wherein the plasma protein is selected form the group consisting of albumin, transferin, fibrinogen and globulins.
  • the linker comprises a chain of atoms from 1 to about 60, or 1 to 30 atoms or longer, 2 to 5 atoms, 2 to 10 atoms, 5 to 10 atoms, or 10 to 20 atoms long.
  • the chain atoms are all carbon atoms.
  • the chain atoms in the backbone of the linker are selected from the group consisting of C, O, N, and S. Chain atoms and linkers may be selected according to their expected solubility (hydrophilicity) so as to provide a more soluble conjugate.
  • the linker provides a functional group that is subject to cleavage by an enzyme or other catalyst or hydro lytic conditions found in the target tissue or organ or cell.
  • the length of the linker is long enough to reduce the potential for steric hindrance.
  • the linker is a covalent bond or a peptidyl bond and the conjugate is a polypeptide
  • the entire conjugate can be a fusion protein.
  • peptidyl linkers may be any length. Exemplary linkers are from about 1 to 50 amino acids in length, 5 to 50, 3 to 5, 5 to 10, 5 to 15, or 10 to 30 amino acids in length.
  • Such fusion proteins may alternatively be produced by recombinant genetic engineering methods known to one of ordinary skill in the art.
  • the insulin analogs are conjugated, e.g., fused to an immunoglobulin or portion thereof (e.g. variable region, CDR, or Fc region).
  • immunoglobulins e.g. variable region, CDR, or Fc region.
  • immunoglobulins include IgG, IgA, IgE, IgD or IgM.
  • the Fc region is a C-terminal region of an Ig heavy chain, which is responsible for binding to Fc receptors that carry out activities such as recycling (which results in prolonged half-life), antibody dependent cell-mediated cytotoxicity (ADCC), and complement dependent cytotoxicity (CDC).
  • the human IgG heavy chain Fc region stretches from Cys226 to the C-terminus of the heavy chain.
  • the "hinge region” generally extends from Glu216 to Pro230 of human IgGl (hinge regions of other IgG isotypes may be aligned with the IgGl sequence by aligning the cysteines involved in cysteine bonding).
  • the Fc region of an IgG includes two constant domains, CH2 and CH3.
  • the CH2 domain of a human IgG Fc region usually extends from amino acids 231 to amino acid 341.
  • the CH3 domain of a human IgG Fc region usually extends from amino acids 342 to 447.
  • the Fc region may comprise one or more native or modified constant regions from an
  • immunoglobulin heavy chain other than CHI, for example, the CH2 and CH3 regions of IgG and IgA, or the CH3 and CH4 regions of IgE.
  • Suitable conjugate moieties include portions of immunoglobulin sequence that include the FcRn binding site.
  • FcRn a salvage receptor, is responsible for recycling immunoglobulins and returning them to circulation in blood.
  • the region of the Fc portion of IgG that binds to the FcRn receptor has been described based on X-ray crystallography (Burmeister et al. 1994, Nature 372:379).
  • the major contact area of the Fc with the FcRn is near the junction of the CH2 and CH3 domains.
  • Fc-FcRn contacts are all within a single Ig heavy chain.
  • the major contact sites include amino acid residues 248, 250-257, 272, 285, 288, 290-291, 308-311, and 314 of the CH2 domain and amino acid residues 385-387, 428, and 433-436 of the CH3 domain.
  • FcyR are responsible for ADCC and CDC.
  • positions within the Fc region that make a direct contact with FcyR are amino acids 234-239 (lower hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C'/E loop), and amino acids 327-332 (F/G) loop (Sondermann et al., Nature 406: 267-273, 2000).
  • the lower hinge region of IgE has also been implicated in the FcRI binding (Henry, et al., Biochemistry 36, 15568-15578, 1997).
  • Such variant Fc regions comprise at least one amino acid modification in the CH3 domain of the Fc region (residues 342-447) and/or at least one amino acid modification in the CH2 domain of the Fc region (residues 231-341).
  • Mutations believed to impart an increased affinity for FcRn include T256A, T307A, E380A, and N434A (Shields et al. 2001, J. Biol. Chem. 276:6591).
  • Other mutations may reduce binding of the Fc region to FcyRI, FcyRIIA, FcyRIIB, and/or FcyRIIIA without significantly reducing affinity for FcRn.
  • substitution of the Asn at position 297 of the Fc region with Ala or another amino acid removes a highly conserved N-glycosylation site and may result in reduced immunogenicity with concomitant prolonged half-life of the Fc region, as well as reduced binding to FcyRs (Routledge et al. 1995, Transplantation 60:847; Friend et al. 1999, Transplantation 68: 1632; Shields et al. 1995, J. Biol. Chem. 276:6591).
  • Amino acid modifications at positions 233-236 of IgGl have been made that reduce binding to FcyRs (Ward and Ghetie 1995, Therapeutic Immunology 2:77 and Armour et al. 1999, Eur. J. Immunol. 29:2613).
  • Some exemplary amino acid substitutions are described in US Patents 7,355,008 and 7,381,408, each incorporated by reference herein in its entirety.
  • the insulin analogs disclosed herein are modified to comprise an acyl group or alkyl group.
  • Acylation or alkylation can increase the half-life of the insulin analogs in circulation.
  • Acylation or alkylation can advantageously delay the onset of action and/or extend the duration of action at the insulin and/or IGF-1 receptors and/or improve resistance to proteases such as DPP-IV and/or improve solubility.
  • Insulin analogs may be acylated or alkylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position.
  • the invention provides an insulin analog modified to comprise an acyl group or alkyl group covalently linked to the amino acid at a position corresponding to A10, B28, B29 of native insulin, or at the C-terminus or N- terminus of the A or B chain.
  • the Insulin analog may further comprise a spacer between the Insulin analog amino acid and the acyl group or alkyl group.
  • the acyl group is a fatty acid or bile acid, or salt thereof, e.g.
  • the spacer is any moiety with suitable reactive groups for attaching acyl or alkyl groups.
  • the spacer comprises an amino acid, a dipeptide, or a tripeptide, or a hydrophilic bifunctional spacer.
  • the spacer is selected from the group consisting of: Trp, Glu, Asp, Cys and a spacer comprising
  • acylated or alkylated insulin peptides may also further comprise a hydrophilic moiety, optionally a polyethylene glycol.
  • Any of the foregoing insulin analogs may comprise two acyl groups or two alkyl groups, or a combination thereof.
  • Acylation can be carried out at any positions within the insulin analog, provided that insulin analog insulin agonist activity is retained.
  • the acyl group can be covalently linked directly to an amino acid of the insulin analog, or indirectly to an amino acid of the insulin analog via a spacer, wherein the spacer is positioned between the amino acid of the insulin peptide and the acyl group.
  • the insulin analog is modified to comprise an acyl group by direct acylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the insulin peptide.
  • the insulin analog is directly acylated through the side chain amine, hydroxyl, or thiol of an amino acid.
  • acylation is at a position corresponding to A10, B28, B29 of native insulin, or at the C-terminus or N-terminus of the A or B chain.
  • the acylated insulin analog can comprise the amino acid sequence of SEQ ID NO: 9 and SEQ ID NO: 10, or a modified amino acid sequence thereof comprising one or more of the amino acid modifications described herein, with at least one of the amino acids at a position corresponding to A10, B28, B29 of native insulin, or at the C-terminus or N-terminus of the A or B chain modified to any amino acid comprising a side chain amine, hydroxyl, or thiol.
  • the direct acylation of the insulin peptide occurs through the side chain amine, hydroxyl, or thiol of the amino acid at a position corresponding to A10, B28, B29 of native insulin.
  • one of the amino acid side chains of the dipeptide element is acylated.
  • the amino acid to be acylated is an amino acid of Formula
  • the amino acid of Formula IV is the amino acid wherein n is 4 (Lys) or n is 3 (Orn).
  • the amino acid comprising a side chain hydroxyl is an amino acid of Formula V:
  • the amino acid of Formula V is the amino acid wherein n is 1 (Ser).
  • the amino acid comprising a side chain thiol is an amino acid of Formula VI:
  • the amino acid of Formula VI is the amino acid wherein n is 1 (Cys).
  • the insulin analog is modified to comprise an acyl group by acylation of an amine, hydroxyl, or thiol of a spacer, which spacer is attached to a side chain of an amino acid at position A 10, B28 or B29 (according to the amino acid numbering of wild type insulin).
  • the amino acid to which the spacer is attached can be any amino acid comprising a moiety which permits linkage to the spacer.
  • an amino acid comprising a side chain NH2, -OH, or -COOH e.g., Lys, Orn, Ser, Asp, or Glu
  • the spacer is an amino acid comprising a side chain amine, hydroxyl, or thiol, or a dipeptide or tripeptide comprising an amino acid comprising a side chain amine, hydroxyl, or thiol.
  • the acylation can occur through the alpha amine of the amino acid or a side chain amine.
  • the spacer amino acid can be any amino acid.
  • the spacer amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val, Leu, He, Trp, Met, Phe, Tyr.
  • the spacer amino acid can be an acidic residue, e.g., Asp and Glu.
  • the spacer amino acid is an amino acid comprising a side chain amine, e.g., an amino acid of Formula I (e.g., Lys or Orn).
  • an amino acid of Formula I e.g., Lys or Orn
  • both the alpha amine and the side chain amine of the spacer amino acid to be acylated, such that the insulin peptide is diacylated.
  • the present disclosure further contemplates diacylated insulin analogs.
  • the amino acid or one of the amino acids of the dipeptide or tripeptide can be an amino acid of Formula II.
  • the amino acid is Ser.
  • the amino acid or one of the amino acids of the dipeptide or tripeptide can be an amino acid of Formula III.
  • the amino acid is Cys.
  • the spacer comprises a hydrophilic bifunctional spacer.
  • the spacer comprises an amino poly(alkyloxy)carboxylate.
  • the spacer can comprise, for example, NH 2 (CH 2 CH 2 0) n (CH 2 ) m COOH, wherein m is any integer from 1 to 6 and n is any integer from 2 to 12, such as, e.g., 8- amino-3,6-dioxaoctanoic acid, which is commercially available from Peptides International, Inc. (Louisville, KY).
  • the acyl group of the acylated insulin peptide can be of any size, e.g., any length carbon chain, and can be linear or branched.
  • the acyl group is a C4 to C30 fatty acid.
  • the acyl group can be any of a C4 fatty acid, C6 fatty acid, C8 fatty acid, CIO fatty acid, C12 fatty acid, C14 fatty acid, C16 fatty acid, C18 fatty acid, C20 fatty acid, C22 fatty acid, C24 fatty acid, C26 fatty acid, C28 fatty acid, or a C30 fatty acid.
  • the acyl group can be any of a C4 fatty acid, C6 fatty acid, C8 fatty acid, CIO fatty acid, C12 fatty acid, C14 fatty acid, C16 fatty acid, C18 fatty acid, C20 fatty acid, C22 fatty acid, C24 fatty acid, C26 fatty acid, C28 fatty acid, or a
  • the acyl group is a C8 to C20 fatty acid, e.g., a C14 fatty acid or a C16 fatty acid.
  • the acyl group is a bile acid.
  • the bile acid can be any suitable bile acid, including, but not limited to, cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • the insulin analog comprises a cholesterol acid, which is linked to a Lys residue of the insulin analog through an alkylated des-amino Cys spacer, i.e., an alkylated 3-mercaptopropionic acid spacer.
  • the alkylated des- amino Cys spacer can be, for example, a des-amino-Cys spacer comprising a dodecaethylene glycol moiety.
  • the insulin analog comprises the structure:
  • the acylated insulin analogs described herein can be further modified to comprise a hydrophilic moiety.
  • the hydrophilic moiety can comprise a polyethylene glycol (PEG) chain.
  • PEG polyethylene glycol
  • the incorporation of a hydrophilic moiety can be accomplished through any suitable means, such as any of the methods described herein.
  • the acylated insulin peptide can comprise a spacer, wherein the spacer is both acylated and modified to comprise the hydrophilic moiety.
  • suitable spacers include a spacer comprising one or more amino acids selected from the group consisting of Cys, Lys, Orn, homo-Cys, and Ac-Phe.
  • the insulin analog is modified to comprise an alkyl group which is attached to the insulin analog via an ester, ether, thioether, amide, or alkyl amine linkage for purposes of prolonging half-life in circulation and/or delaying the onset of and/or extending the duration of action and/or improving resistance to proteases such as DPP-IV.
  • the alkyl group of the alkylated insulin peptide can be of any size, e.g., any length carbon chain, and can be linear or branched.
  • the alkyl group is a CI to C30 alkyl.
  • the alkyl group can be any of a CI alkyl, C2 alkyl, C3 alkyl, C4 alkyl, C6 alkyl, C8 alkyl, CIO alkyl, C12 alkyl, C14 alkyl, C16 alkyl, C18 alkyl, C20 alkyl, C22 alkyl, C24 alkyl, C26 alkyl, C28 alkyl, or a C30 alkyl.
  • the alkyl group is a C8 to C20 alkyl, e.g., a C14 alkyl or a C16 alkyl.
  • the alkyl group comprises a steroid moiety of a bile acid, e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • a bile acid e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • the dipeptide prodrug element can be further modified to comprise a hydrophilic moiety.
  • the hydrophilic moiety is a polyethylene glycol chain.
  • a polyethylene glycol chain of 40k or higher is covalently bound to the side chain of the A or B amino acid of the dipeptide prodrug element.
  • the dipeptide prodrug element is additionally or alternatively acylated or alkylated with a fatty acid or bile acid, or salt thereof, e.g.
  • the 'A' amino acid of the dipeptide prodrug element can include, for example, d-lysine covalently bound to an acyl or alkyl group through its side chain amino group, or d-cysteine covalently bound to a PEG molecule through its side chain sulfhydryl group.
  • the dipeptide prodrug element can be directly bound to the hydrophilic moiety, acyl group, or alkyl group, or bound to the hydrophilic moiety, acyl group, or alkyl group through a spacer, as described herein.
  • the dipeptide prodrug element can be linked to a depot protein such as dextran or a large PEG molecule (greater or equal to 80,000 daltons) that serves to sequester the prodrug at an injection site until cleavage of the dipeptide releases the active insulin peptide (Q).
  • the rate of cleavage of the dipeptide prodrug element A-B from the bioactive peptide depends on the structure (including N-alkylation, number of substituents, length or bulkiness), and stereochemistry of the amino acids of the dipeptide prodrug element.
  • the rate of cleavage of the dipeptide prodrug element A- B from the (e.g., insulin peptide (Q)) also depends on the steric hindrance, nucleophilicity, and stability of the leaving group of Q during diketopiperazine formation.
  • PCT/US2009/68745 filed December 18, 2009 or its sequence listing, and sub- categories of (1) dipeptide prodrug elements, (2) A amino acids, and/or (3) B amino acids disclosed in Int'l Application No. PCT/US2009/68745, filed December 18, 2009, to the extent they fall completely within and/or overlap with a portion of any of the sub-categories described herein, and only to the extent necessary to confer novelty on claimed subject matter.
  • a auto-cleaving dipeptide element is covalently linked to the insulin peptide (Q) through an amide bond between A-B and an aliphatic amino group of Q.
  • the aliphatic amino group A-B is linked to can be the alpha amino group on the N-terminal amino acid of the A chain or the B chain.
  • the aliphatic amino group A-B is linked to can be an aliphatic amino group on a side chain of Q.
  • A-B is linked to the side chain amine of a lysine, including for example at position B29 of the b chain sequence F VNQHLCGS HLVE ALYLVCGERGFFYTPKT (SEQ ID NO: 8) or at position B28 of the B chain sequence
  • GIVEQCCXiSICSLYQLENXaCXs (SEQ ID NO: 3) and the B chain comprises the sequence of X 14 -X 4 LCGX 5 X 6 LVEALX 7 LVCG ERGFXg (SEQ ID NO: 14),
  • X 14 is a bond, or a 1 to 4 amino acid sequence selected from the group consisting of a FVNQ (SEQ ID NO: 11), VNQ, NQ and Q;
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 and
  • X 3 is selected from the group consisting of asparagine, ornithine, glycine, alanine, threonine, and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is tyrosine
  • Xg is histidine, asparagine or tyrosine, wherein A-B is linked to Q through an amide bond between A-B and an aliphatic amino group of Q.
  • Q is an insulin peptide comprising an A chain and a B chain wherein Q is an insulin peptide comprising an A chain and a B chain wherein the A chain comprises the sequence GIVEQCCXiSICSLYQLENX 2 CX 3 (SEQ ID NO:
  • the B chain comprises the sequence of X 14 -X 4 LCGX 5 X 6 LVEALX 7 LVCG ERGFXg (SEQ ID NO: 14),
  • X 14 is a bond, or a 1 to 4 amino acid sequence selected from the group consisting of a FVNQ (SEQ ID NO: 11), VNQ, NQ and Q;
  • Xi is selected from the group consisting of threonine and histidine;
  • X 2 is an amino acid of the general structure
  • X is selected from the group consisting of OH, NH 2 , NHR 10 and OCH 3 , wherein Rio is a dipeptide of the general structure A-B;
  • X 3 is selected from the group consisting of asparagine, ornithine, glycine, alanine, threonine, and serine;
  • X 4 is selected from the group consisting of histidine and threonine
  • X5 is selected from the group consisting of alanine, glycine and serine;
  • X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 7 is an amino acid of the general structure
  • X 12 is selected from the group consisting of OH, NH 2 , NHRn and OCH 3 , wherein Rn is a dipeptide of the general structure A-B;
  • X 8 is histidine, asparagine or an amino acid of the general structure
  • X 13 is selected from the group consisting of H, OH, NH 2 , NHR 12 and OCH 3 , wherein R 12 is a dipeptide of the general structure A-B, wherein A- B is linked to Q through an amide bond between A-B and an aromatic amino group on an amino acid side chain of Q.
  • the half-life of the prodrug is dependent on the presence and length of the N-alkyl substituent on the B amino acid.
  • a prodrug that has a shorter N-alkyl substituent on the B amino acid e.g. Gly(N-methyl)
  • the half-life of the prodrug is dependent on the presence or absence of an alkyl side chain, and the degree of substitution at the beta position of the alkyl side chain, of the B amino acid of the dipeptide prodrug element.
  • a prodrug that has an N-alkylated B amino acid that is disubstituted at the beta position e.g., N-alkylated isoleucine
  • will undergo slower cleavage of A-B, and have a longer half-life, than a prodrug that has an N-alkylated B amino acid that is monosubstituted at the beta position e.g., N-alkylated leucine.
  • a prodrug that has an N-alkylated B amino acid that is monosubstituted at the beta position will undergo slower cleavage of A-B, and have a longer half-life, than a prodrug that has an N-alkylated B amino acid that is unsubstituted at the beta position (e.g., N-alkylated alanine).
  • a prodrug with an N-alkylated B amino acid that has an unsubstituted beta position (e.g., N-alkylated alanine) will undergo slower cleavage of A-B, and have a longer half-life, than a prodrug that has glycine or N-alkylated glycine as the B amino acid.
  • the half-life of the prodrug is dependent on the bulkiness of the side chain of the B amino acid.
  • a prodrug that has a bulkier side chain on the B amino acid e.g., N-alkylated phenylalanine
  • Cleavage rates of dipeptides can be further differentiated by the amine of the drug (e.g., insulin) to which they are attached.
  • dipeptide linked to an N-terminal amine will cleave at a faster rate relative to when the dipeptide is linked to the side chain amine of a lysine residue.
  • composition of the B amino acid of the dipeptide prodrug element can be classified into the below sub-categories IA, IB, and IC.
  • the dipeptide prodrug elements in sub-category IA undergo cleavage the fastest and the dipeptide prodrug elements in sub-category IC undergo cleavage the slowest.
  • Sub-Category IA Amino Acid B of the Dipeptide Prodrug Element is N- Alkylated Glycine
  • the prodrug comprises the structure:
  • Q is a bioactive peptide (e.g., an insulin peptide);
  • A-B comprises the structure:
  • Ri and R 2 are independently selected from the group consisting of H, C C ⁇ alkyl, C 2 -C 18 alkenyl, (Ci-Cie alkyl)OH, (Ci-Cie alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C 1 -C4 alkyl)COOH, (C 1 -C4 alkyl)NH 2 , (C 1 -C4 alkyl)NHC(NH 2 + )NH 2 , (C0-C4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 - C10 aryl)R 7 , (C1-C4 alkyl)(C 3 -C 9 heteroaryl), and C1-C12 alkyl(Wi)Ci-Ci 2
  • R 3 is Ci-Cie alkyl
  • R 5 is NHR 6 ;
  • R 6 is H or Ci-C 4 alkyl, or R5 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring; and,
  • R 7 is selected from the group consisting of H and OH.
  • the B amino acid is selected from the group consisting of glycine(N-methyl), glycine(N-ethyl), glycine(N-propyl), glycine(N-butyl), glycine (N-pentyl), glycine(N-hexyl), glycine(N-heptyl), and glycine(N-octyl).
  • the B amino acid can be glycine(N-methyl) or glycine(N-hexyl).
  • R 3 is CrC 4 alkyl. In some embodiments when one of Ri or R 2 is other than hydrogen, R 3 is Ci-C 4 alkyl.
  • Sub-Category IB Amino Acid B of the Dipeptide Prodrug Element is
  • the prodrug comprises the structure:
  • Q is a bioactive peptide (e.g., an insulin peptide);
  • A-B comprises the structure:
  • Ri and R 2 are independently selected from the group consisting of H, C 1 -C 18 alkyl, C 2 -Ci 8 alkenyl, (Ci-Ci 8 alkyl)OH, (Ci-Ci 8 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C C 4 alkyl)CONH 2 , (C 1 -C4 alkyl)COOH, (C 1 -C4 alkyl)NH 2 , (C 1 -C4
  • R 3 is C1-C18 alkyl
  • R 4 is selected from the group consisting of CH 3 , CH 2 (C 1 -C 1 o alkyl), CH 2 (C 2 - Cio alkenyl), CH 2 (C 0 -Ci 0 alkyl)OH, CH 2 (C 0 -Ci 0 alkyl)SH, CH 2 (C 0 -C 3 alkyl)SCH 3 , CH 2 (Co-C 3 alkyl)CONH 2 , CH 2 (C 0 -C 3 alkyl)COOH, CH 2 (C 0 -C 3 alkyl)NH 2 , CH 2 (C 0 - C 3 alkyl)NHC(NH 2 + )NH 2 , CH 2 (C 0 -C 3 alkyl)(C 3 -C 6 cycloalkyl), CH 2 (C 0 -C 3 alkyl)(C 2 -C 5 heterocyclic), CH 2 (C 0 -C 3 alkyl)
  • R 8 is H
  • R5 is NHR 6 , or R5 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 6 is H or CrC 4 alkyl
  • R 7 is selected from the group consisting of H and OH.
  • R 4 is selected from the group consisting of CH
  • Nonlimiting examples of the B amino acid in these embodiments include alanineiN-Ci-Cioalkyl), leucineiN-CrCioalkyl), methionineiN-CrCioalkyl), asparagineiN-Ci-Cioalkyl), glutamic acidiN-C Cioalkyl), aspartic acid(N-Cr C 10 alkyl), glutamineiN-CrCioalkyl), histidineiN-CrCioalkyl), lysineiN-Cr Cioalkyl), arginineiN-Ci-Cioalkyl), serineiN-Ci-Cioalkyl), and cysteineiN-Cr Cioalkyl).
  • the B amino acid is selected from the group consisting of alanineiN-Ci-Cealkyl), leucineiN-Q-Cealkyl), methionineiN-CrCealkyl), asparagineiN-Ci-Cealkyl), glutamic acidiN-Ci-Cealkyl), aspartic acid(N-Ci- C 6 alkyl), glutamineCN-CrCealkyl), histidineiN-CrCealkyl), lysineiN-CrCealkyl), arginineiN-Ci-Cealkyl), serineiN-C Cealkyl), and cysteineiN-C Cealkyl).
  • the B amino acid can include alanine(N-methyl), leucine(N- methyl), methionine(N-methyl), asparagine(N-methyl), glutamic acid(N-methyl), aspartic acid(N-methyl), glutamine(N-methyl), histidine(N-methyl), lysine(N- methyl), arginine(N-methyl), serine(N-methyl), and cysteine(N-methyl).
  • R 4 is selected from the group consisting of CH 2 (Co-C3 alkyl)(C 3 -C 6 cycloalkyl), CH 2 (C 0 -C 3 alkyl)(C 2 -C 5 heterocyclic), CH 2 (C 0 -C 3 alkyl)(C 6 -Cio aryl)R 7 , CH 2 (Ci-C 3 alkyl)(C 3 -C 9 heteroaryl), and CH 2 (C 0 -C 12 alkylXW C Cn alkyl, wherein Wi is a heteroatom selected from the group consisting of N, S and O, and wherein R 7 is selected from the group consisting of H and OH.
  • Nonlimiting examples of the B amino acid in these embodiments include phenylalanineiN-Ci-Cioalkyl), tyrosineiN-CrCioalkyl), and tryptophan(N-Ci- Cioalkyl).
  • the B amino acid is selected from the group consisting of phenylalanineiN-Ci-Cealkyl), tyrosineiN-Ci-Cealkyl), and
  • the B amino acid can include
  • the B amino acid is proline.
  • proline is excluded from Sub-Category IB.
  • Sub-Category IC Amino Acid B of the Dipeptide Prodrug Element
  • the prodrug comprises the structure:
  • A-B-Q wherein Q is a bioactive peptide (e.g., an insulin peptide); wherein A-B comprises the structure:
  • Ri and R 2 are independently selected from the group consisting of H, Ci-Ci 8 alkyl, C 2 -C 18 alkenyl, (Ci-Cie alkyl)OH, (Ci-Cie alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C C 4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 3 is Ci-Cie alkyl
  • R 4 is independently selected from the group consisting of CH(Ci-C8 alkyl) 2 , CH (C 2 -C 8 alkenyl) 2 , CH(Ci-C 8 alkyl)(OH), CH(Ci-C 8 alkyl)((Ci-C 8 alkyl)SH), CH(d-C 3 alkyDCCd-Cg alkyl)(NH 2) ); R 8 is H;
  • R 5 is NHR 6j or R 5 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 6 is H or Ci-C 4 alkyl
  • R 7 is selected from the group consisting of H and OH.
  • R 4 is CH(Ci-C 8 alkyl) 2 or CH(Ci-C 8 alkyl)OH.
  • Nonlimiting examples of the B amino acid include isoleucine(N-Ci-Cioalkyl), valineiN-Ci-Cioalkyl), and threonineiN-Ci-Cioalkyl).
  • the B amino acid is selected from the group consisting of isoleucine(N-Ci-C 6 alkyl), valine(N-Ci-C 6 alkyl), and threonine(N-Ci-C 6 alkyl).
  • the B amino acid can include isoleucine(N-methyl), valine(N-methyl), and threonine(N-methyl).
  • the half-life of the prodrug is dependent on the number of substituents at the alpha position of the A amino acid.
  • a prodrug comprising an A amino acid that is an a-monosubstituted amino acid e.g., Ala
  • a prodrug comprising an A amino acid that is an ⁇ , ⁇ -disubstituted amino acid e.g., Aib
  • the half-life of the prodrug is dependent on the degree of alkylation on the alpha amino group of the A amino acid. Generally, the greater the degree of alkylation, the slower the rate of cleavage and the longer the half-life of the prodrug. For example, a dipeptide prodrug element having N-alkylated Ala will cleave at a slower rate, and have a longer half-life, than Ala.
  • composition of the A amino acid of the dipeptide prodrug element can be classified into the below sub-categories IIA and IIB.
  • dipeptide prodrug elements in sub-category IIA cleave faster than dipeptide prodrug elements in subcategory IIB.
  • Sub-Category IIA Amino Acid A of the Dipeptide Prodrug Element is
  • the A amino acid of the dipeptide prodrug element is disubstituted at the alpha position.
  • ⁇ and R 2 of the structures described in sub-categories IA, IB, and IC are independently selected from the group consisting of Ci-Cio alkyl, C 2 -C 10 alkenyl, (Ci-Cio alkyl)OH, (Ci-Cio alkyl)SH, (C 2 - C 3 alkyl)SCH 3 , (Ci-C 4 alkyl)CONH 2 , (Ci-C 4 alkyl)COOH, (Ci-C 4 alkyl)NH 2 , (Ci-C 4 alkyl)NHC(NH 2 + )NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)
  • the A amino acid can include aminoisobutyric acid (Aib).
  • Sub-Category IIB Amino Acid A of the Dipeptide Prodrug Element is Unsubstituted or Monosubstituted at the Alpha Position
  • the A amino acid of the dipeptide prodrug element is unsubstituted or monosubstituted at the alpha position.
  • R of the structures described in sub-categories IA, IB, and IC is H
  • R 2 of the structures described in sub-categories IA, IB, and IC is selected from the group consisting of H, C Cio alkyl, C 2 -C 10 alkenyl, (Ci-Cio alkyl)OH, (Ci-Cio alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C1-C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4
  • R 7 is selected from the group consisting of H and OH, wherein Wi is a heteroatom selected from the group consisting of N, S and O, or Ri and R 2 together with the atoms to which they are attached form a C 3 -C 12 cycloalkyl, or R 2 and R5 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring.
  • the A amino acid of the dipeptide prodrug element has 'd' stereochemistry.
  • Nonlimiting examples of the A amino acid in these embodiments include lysine, cysteine, and alanine.
  • d-lysine, d-cysteine, and d- alanine may enhance half-life through reducing proteolytic degradation of the prodrug peptide.
  • the A amino acid is N-alkylated with a group that has 1 to 4 carbon atoms such as Ala(N-C 1 -C 4 alkyl), Lys(N-Ci-C 4 alkyl), and Cys(N-Ci- C 4 alkyl).
  • the A amino acid can be Ala(N-methyl), Lys(N-methyl), and Cys(N-methyl). N-alkylation of the A amino acid decreases the rate of cleavage of the dipeptide prodrug element from Q and provides a longer half-life.
  • the half-life of the prodrug depends on the steric hindrance, nucleophilicity, and stability of the leaving group on Q during
  • the type of leaving group on Q can be determined by the type of the linkage between A-B and an amino group of Q, as described in sub-categories IIIA and IIIB below. Generally, dipeptide prodrug elements in sub-category IIIB cleave faster from Q and have a shorter half-life than dipeptide prodrug elements in subcategory IIIA.
  • Sub-Category IIIA A-B Linked to an Aliphatic Amino Group of Q
  • A-B is linked to Q through an amide bond between A- B and an aliphatic amino group of Q to result in a prodrug with a chemical cleavage half-life (t ⁇ ) of A-B from Q of at least about 1 hour to about 1 week in PBS, under physiological conditions, as previously described herein.
  • A-B is linked to Q through an amide bond between A- B and the alpha amino group of the N-terminal amino acid of Q.
  • a dipeptide prodrug element having a B amino acid from any of sub-categories IA, IB, and IC and an A amino acid from any of sub-categories IIA and IIB can be linked to the N-terminal amino acid of Q to result in a prodrug with a chemical cleavage half- life (ti/2) of A-B from Q of at least about 1 hour to about 1 week in PBS, under physiological conditions.
  • A-B is linked to Q through an amide bond between A- B and an aliphatic amino group on a side chain of an amino acid of Q.
  • a dipeptide prodrug element having a B amino acid from any of sub-categories IA, IB, and IC and an A amino acid from any of sub-categories IIA and IIB can be linked to an aliphatic amino group of a side chain of an amino acid of Q to result in a prodrug with a chemical cleavage half-life (t 1/2 ) of A-B from Q of at least about 1 hour to about 1 week in PBS, under physiological conditions.
  • A-B when A-B is linked to Q through an amide bond between A-B and an aliphatic amino group of Q, either A should be an ⁇ , ⁇ - disubstituted amino acid (Sub-category IIA) or B should be N-alkylated (any of Subcategories IA, IB or IC) , or both.
  • A is an a-monosubstituted amino acid (e.g., Ala)
  • B is not N-alkylated, and A-B is attached to Q through an aliphatic amino group of Q, then there will not be significant cleavage of A-B.
  • the N-alkyl substitutent of the B amino acid has a length of at least five carbon atoms (for example, N-Cs-Cgalkyl).
  • A-B is linked to Q through an amide bond between A-B and an aliphatic amino group of Q
  • A is an amino acid that is unsubstituted at the alpha position (e.g. glycine) and B is an amino acid from Subcategory IA (N-alkylated glycine
  • the N-alkyl substitutent of the B amino acid has a length of at least five carbon atoms (for example, N-Cs-Cgalkyl).
  • the B amino acid is not proline.
  • Sub-Category IIIB A-B Linked to an Aromatic Amino Group of Q
  • A-B is linked to Q through an amide bond between A- B and an aromatic amino group of a side chain of an amino acid of Q to result in a prodrug with a chemical cleavage half-life (ti /2 ) of A-B from Q of at least about 1 hour to about 1 week in PBS, under physiological conditions, as previously described herein.
  • a dipeptide prodrug element having a B amino acid from any of sub-categories IA, IB, and IC and an A amino acid from any of sub-categories IIA and IIB can be linked to an aromatic amino group of a side chain of an amino acid of Q to result in a prodrug with a chemical cleavage half-life (t 1/2 ) of A-B from Q of at least about 1 hour to about 1 week in PBS, under physiological conditions.
  • t 1/2 chemical cleavage half-life
  • Any of the B amino acids defined by Category I can be combined with any of the A amino acids defined by Category II to form a dipeptide prodrug element.
  • This dipeptide prodrug element can be linked to any of the positions described in Category III.
  • the half life of the prodrug can be tuned through the selection of:
  • the dipeptide prodrug elements described above can be further modified to comprise a hydrophilic moiety, an acyl group, or an alkyl group, as previously described herein.
  • the dipeptide prodrug element includes lysine that is conjugated to an acyl group or an alkyl group through its side chain amino group.
  • the dipeptide prodrug element includes cysteine that is conjugated to a hydrophilic moiety (e.g., 40 kD PEG) through the side chain sulfhydryl group.
  • the hydrophilic moiety, acyl group, or alkyl group can be conjugated directly to the dipeptide prodrug element or through a spacer.
  • the hydrophilic group, the alkyl group and/or the acyl group are conjugated to the A amino acid of the dipeptide prodrug element.
  • the following dipeptide prodrug elements include an acyl group: dLys-Gly(N-Hexyl), dLys-Gly(N-Methyl), and dLys-Phe(N-Methyl).
  • the following dipeptide prodrug elements include an alkyl group: dLys-Gly(N-Hexyl), dLys-Gly(N-Methyl), and dLys-Phe(N-Methyl).
  • the dipeptide prodrug element of the invention can include combinations of any of the B amino acids from Category I with any of the A amino acids from Category II.
  • Nonlimiting examples of amino acids suitable for the A amino acid and for the B amino acid of the dipeptide prodrug element are listed in the below Table.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Diabetes (AREA)
  • General Health & Medical Sciences (AREA)
  • Endocrinology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2011/041603 2010-06-24 2011-06-23 Amide-based insulin prodrugs Ceased WO2011163462A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
JP2013516766A JP5912112B2 (ja) 2010-06-24 2011-06-23 アミド系インスリンプロドラッグ
CA2803164A CA2803164C (en) 2010-06-24 2011-06-23 Amide-based insulin prodrugs
CN201180040875.9A CN103119057B (zh) 2010-06-24 2011-06-23 基于酰胺的胰岛素前药
EP20110798912 EP2585102B1 (en) 2010-06-24 2011-06-23 Amide-based insulin prodrugs
US13/702,197 US8946147B2 (en) 2010-06-24 2011-06-23 Amide-based insulin prodrugs
AU2011270832A AU2011270832B2 (en) 2010-06-24 2011-06-23 Amide-based insulin prodrugs

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US35819210P 2010-06-24 2010-06-24
US61/358,192 2010-06-24

Publications (2)

Publication Number Publication Date
WO2011163462A2 true WO2011163462A2 (en) 2011-12-29
WO2011163462A3 WO2011163462A3 (en) 2012-04-05

Family

ID=45372102

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/041603 Ceased WO2011163462A2 (en) 2010-06-24 2011-06-23 Amide-based insulin prodrugs

Country Status (7)

Country Link
US (1) US8946147B2 (https=)
EP (1) EP2585102B1 (https=)
JP (1) JP5912112B2 (https=)
CN (1) CN103119057B (https=)
AU (1) AU2011270832B2 (https=)
CA (1) CA2803164C (https=)
WO (1) WO2011163462A2 (https=)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011159895A2 (en) 2010-06-16 2011-12-22 Indiana University Research And Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor
US8946147B2 (en) 2010-06-24 2015-02-03 Indiana University Research And Technology Corporation Amide-based insulin prodrugs
US9089539B2 (en) 2008-01-30 2015-07-28 Indiana University Research And Technology Corporation Ester-based insulin prodrugs
US9573987B2 (en) 2011-12-20 2017-02-21 Indiana University Research And Technology Corporation CTP-based insulin analogs for treatment of diabetes
US9593156B2 (en) 2012-09-26 2017-03-14 Indiana University Research And Technology Corporation Insulin analog dimers
US10232020B2 (en) 2014-09-24 2019-03-19 Indiana University Research And Technology Corporation Incretin-insulin conjugates
US10385107B2 (en) 2014-09-24 2019-08-20 Indiana Univeresity Researc and Technology Corporation Lipidated amide-based insulin prodrugs
US10413593B2 (en) 2014-10-24 2019-09-17 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US10696726B2 (en) 2013-03-14 2020-06-30 Indiana University Research And Technology Corporation Insulin-incretin conjugates
US10919949B2 (en) 2017-08-17 2021-02-16 Novo Nordisk A/S Acylated insulin analogues and uses thereof
US11098102B2 (en) 2018-12-11 2021-08-24 Sanofi Insulin conjugates

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12263192B2 (en) 2019-02-26 2025-04-01 Pantheryx, Inc. Compositions for management of disorders of the gastrointestinal tract

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
WO1996034882A1 (en) 1995-05-05 1996-11-07 Eli Lilly And Company Single chain insulin with high bioactivity
US6630348B1 (en) 2000-10-02 2003-10-07 Univ Yonsei Seoul Single-chain insulin analog and a polynucleotide sequence encoding the analog
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US7355008B2 (en) 2003-01-09 2008-04-08 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
US7381408B2 (en) 2003-05-06 2008-06-03 Syntonix Pharmaceuticals, Inc. Methods for chemically synthesizing immunoglobulin chimeric proteins
US20080286808A1 (en) 2005-09-27 2008-11-20 Volker Schellenberger Methods for production of unstructured recombinant polymers and uses thereof
WO2009023270A2 (en) 2007-08-15 2009-02-19 Amunix, Inc. Compositions and methods for modifying properties of biologically active polypeptides
WO2009099763A1 (en) 2008-01-30 2009-08-13 Indiana University Research And Technology Corporation Ester-based peptide prodrugs

Family Cites Families (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3740385A (en) 1970-05-07 1973-06-19 M Ondetti N-terminal derivatives of secretin
US4275152A (en) 1977-02-03 1981-06-23 Eastman Kodak Company Hydrolysis of protein-bound cholesterol esters
DK119785D0 (da) 1985-03-15 1985-03-15 Nordisk Gentofte Insulinpraeparat
PT83613B (en) 1985-10-28 1988-11-21 Lilly Co Eli Process for the selective chemical removal of a protein amino-terminal residue
US4741897A (en) 1986-07-08 1988-05-03 Baxter Travenol Thyroxine analogs and reagents for thyroid hormone assays
US4876242A (en) 1987-09-21 1989-10-24 Merck & Co., Inc. Human insulin-like growth factor analoges with reduced binding to serum carrier proteins and their production in yeast
GB8728561D0 (en) 1987-12-07 1988-01-13 Glaxo Group Ltd Chemical compounds
US5514646A (en) 1989-02-09 1996-05-07 Chance; Ronald E. Insulin analogs modified at position 29 of the B chain
US6225449B1 (en) 1991-10-04 2001-05-01 Washington University Hormone analogs with multiple CTP extensions
AU631868B2 (en) 1989-04-20 1992-12-10 Mount Sinai School Of Medicine Of The City University Of New York, The Hepatospecific insulin analogues
US5545618A (en) 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
ATE164852T1 (de) 1990-01-24 1998-04-15 Douglas I Buckley Glp-1-analoga verwendbar in der diabetesbehandlung
US5268453A (en) 1991-08-08 1993-12-07 Scios Inc. Tissue-selective insulin analogs
WO1994020636A1 (en) 1993-03-09 1994-09-15 Abbott Laboratories Genetically engineered enzymes and their conjugates for diagnostic assays
US5359030A (en) 1993-05-10 1994-10-25 Protein Delivery, Inc. Conjugation-stabilized polypeptide compositions, therapeutic delivery and diagnostic formulations comprising same, and method of making and using the same
US6476290B1 (en) 1995-04-19 2002-11-05 Dalhousie University Transgenic tilapia comprising a humanized insulin gene
US6180767B1 (en) 1996-01-11 2001-01-30 Thomas Jefferson University Peptide nucleic acid conjugates
WO1998011126A1 (en) 1996-09-09 1998-03-19 Zealand Pharmaceuticals A/S Peptide prodrugs containing an alpha-hydroxyacid linker
UA65549C2 (uk) 1996-11-05 2004-04-15 Елі Ліллі Енд Компані Спосіб регулювання ожиріння шляхом периферійного введення аналогів та похідних glp-1 (варіанти) та фармацевтична композиція
US6197926B1 (en) 1998-02-23 2001-03-06 Neurocrine Biosciences Methods for treatment of diabetes using peptide analogues of insulin
JP4394279B2 (ja) 1998-03-09 2010-01-06 ジーランド ファーマ アクティーゼルスカブ 酵素加水分解に対する傾向が減少した薬理学的に活性なペプチド複合体
DE19828113A1 (de) 1998-06-24 2000-01-05 Probiodrug Ges Fuer Arzneim Prodrugs von Inhibitoren der Dipeptidyl Peptidase IV
US6875741B2 (en) 1998-09-02 2005-04-05 Renuka Pillutla Insulin and IGF-1 receptor agonists and antagonists
US20030236190A1 (en) 1998-09-02 2003-12-25 Renuka Pillutla Isulin and IGF-1 receptor agonists and antagonists
DE19908041A1 (de) 1999-02-24 2000-08-31 Hoecker Hartwig Kovalent verbrückte Insulindimere
PT1171465E (pt) 1999-03-29 2004-12-31 Uutech Ltd Analogos de petido inibidor gastrico e sua utilizacao para o tratamento de diabetes
US6746853B1 (en) 1999-05-19 2004-06-08 Xencor, Inc. Proteins with insulin-like activity useful in the treatment of diabetes
AUPQ661800A0 (en) 2000-03-31 2000-05-04 Metabolic Pharmaceuticals Limited Insulin-potentiating compounds
WO2002010195A2 (en) 2000-08-02 2002-02-07 Theratechnologies Inc. Modified peptides with increased potency
AU2001284697A1 (en) 2000-08-04 2002-02-18 Dmi Biosciences, Inc. Method of synthesizing diketopiperazines
US7052686B2 (en) 2000-09-29 2006-05-30 Schering Corporation Pegylated interleukin-10
KR101229995B1 (ko) 2000-12-11 2013-02-06 씨제이 주식회사 생체내 에리스로포이에틴 활성이 증진된 융합단백질
EP1243276A1 (en) 2001-03-23 2002-09-25 Franciscus Marinus Hendrikus De Groot Elongated and multiple spacers containing activatible prodrugs
CA2452044A1 (en) 2001-08-28 2003-03-13 Eli Lilly And Company Pre-mixes of glp-1 and basal insulin
PL374949A1 (en) * 2001-12-20 2005-11-14 Eli Lilly And Company Insulin molecule having protracted time action
EP2316468A1 (en) * 2002-02-22 2011-05-04 Shire LLC Delivery system and methods for protecting and administering dextroamphetamine
FR2842209B1 (fr) 2002-07-09 2007-11-23 Nouvelle protease aspartique dite saspase et son utilisation dans le domaine cosmetique et therapeutique
US20050059605A1 (en) 2003-01-31 2005-03-17 Krishna Peri Chemically modified metabolites of regulatory peptides and methods of producing and using same
WO2004078777A2 (en) 2003-03-04 2004-09-16 Biorexis Pharmaceutical Corporation Dipeptidyl-peptidase protected proteins
EP1605897B1 (en) 2003-03-19 2012-07-25 Eli Lilly And Company Polyethelene glycol link glp-1 compounds
CA2521784C (en) 2003-04-08 2012-03-27 Yeda Research And Development Co. Ltd. Reversible pegylated drugs
GB0310593D0 (en) 2003-05-08 2003-06-11 Leuven K U Res & Dev Peptidic prodrugs
AR046330A1 (es) 2003-09-09 2005-12-07 Japan Tobacco Inc Inhibidor de dipeptidilpeptidasa iv
KR101241862B1 (ko) 2003-09-19 2013-03-13 노보 노르디스크 에이/에스 신규 glp-1 유도체
CN100444898C (zh) 2003-09-19 2008-12-24 诺沃挪第克公司 治疗肽的清蛋白结合型衍生物
US20050187147A1 (en) 2003-09-22 2005-08-25 Newman Michael J. Compositions and methods for increasing drug efficiency
EP1997828B1 (en) 2003-11-05 2017-10-04 Dana-Farber Cancer Institute, Inc. Stabilized alpha helical peptides from BCL-2 and uses thereof
CN1902226A (zh) 2003-12-03 2007-01-24 诺和诺德公司 单链胰岛素
CN101035756A (zh) 2004-06-17 2007-09-12 南卡罗来纳州医科大学研究发展基金会 非天然氨基酸
CA2582552A1 (en) 2004-10-21 2006-05-04 Igf Oncology, Llc Toxins and radionuclides coupled to igf-1 receptor ligands for treatment of cancer
US8263545B2 (en) 2005-02-11 2012-09-11 Amylin Pharmaceuticals, Inc. GIP analog and hybrid polypeptides with selectable properties
EP1863840A1 (en) 2005-03-18 2007-12-12 Novo Nordisk A/S Pegylated single-chain insulin
US7521211B2 (en) 2005-04-05 2009-04-21 Regeneron Pharmaceuticals, Inc IGF-1 and IGF-2 chimeric polypeptides and therapeutic uses thereof
US20090209453A1 (en) 2005-04-13 2009-08-20 University Of Medicine And Dentistry Of New Jersey Glycoprotein Hormone Analogs
EP1929030A2 (en) 2005-09-08 2008-06-11 Shire LLC Prodrugs of t3 and t4 with enhanced bioavailability
US8304386B2 (en) 2006-02-03 2012-11-06 Prolor Biotech, Inc. Long-acting growth hormone and methods of producing same
US20090069216A1 (en) 2006-02-21 2009-03-12 Novo Nordisk A/S Single-Chain Insulin Analogues and Pharmaceutical Formulations Thereof
JP5312054B2 (ja) 2006-03-15 2013-10-09 ノボ・ノルデイスク・エー/エス アミリンとインスリンの混合物
WO2007109354A2 (en) 2006-03-21 2007-09-27 Amylin Pharmaceuticals, Inc. Peptide-peptidase inhibitor conjugates and methods of using same
JP5256199B2 (ja) 2006-08-07 2013-08-07 テヴァ バイオファーマシューティカルズ ユーエスエー,インコーポレーティッド アルブミン−インスリン融合タンパク質
AU2007284365A1 (en) 2006-08-17 2008-02-21 Amylin Pharmaceuticals, Inc. DPP-IV resistant GIP hybrid polypeptides with selectable properties
CL2007002502A1 (es) 2006-08-31 2008-05-30 Hoffmann La Roche Variantes del factor de crecimiento similar a insulina-1 humano (igf-1) pegilados en lisina; metodo de produccion; proteina de fusion que la comprende; y su uso para tratar la enfermedad de alzheimer.
CN106008699A (zh) 2006-09-08 2016-10-12 Ambrx公司 经修饰的人类血浆多肽或Fc骨架和其用途
DE102006052755A1 (de) 2006-11-08 2008-05-15 N-Zyme Biotec Gmbh Michaelsysteme als Transglutaminaseinhibitoren
US20090098130A1 (en) 2007-01-05 2009-04-16 Bradshaw Curt W Glucagon-like protein-1 receptor (glp-1r) agonist compounds
AU2008216265B2 (en) 2007-02-15 2014-04-03 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
EP2036923A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Improved derivates of amylin
EP2036539A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Stable formulations of amylin and its analogues
MX2010005317A (es) 2007-11-20 2010-06-02 Ambrx Inc Polipeptidos de insulina modificados y sus usos.
MX2010008024A (es) 2008-02-01 2010-12-21 Ascendis Pharma As Profarmaco que comprende un enlazador que se puede separar por si mismo.
WO2010011313A2 (en) 2008-07-23 2010-01-28 President And Fellows Of Harvard College Ligation of stapled polypeptides
CN102325539A (zh) 2008-12-19 2012-01-18 印第安纳大学研究及科技有限公司 基于酰胺的胰高血糖素超家族肽前药
CN102300580A (zh) 2008-12-19 2011-12-28 印第安纳大学研究及科技有限公司 二肽连接的药剂
WO2010080606A1 (en) 2008-12-19 2010-07-15 Indiana University Research And Technology Corporation Insulin analogs
WO2010080609A1 (en) * 2008-12-19 2010-07-15 Indiana University Research And Technology Corporation Amide-based insulin prodrugs
US8569231B2 (en) 2009-03-20 2013-10-29 Smartcells, Inc. Soluble non-depot insulin conjugates and uses thereof
AU2010277559B2 (en) 2009-07-31 2016-08-11 Sanofi-Aventis Deutschland Gmbh Prodrugs comprising an insulin linker conjugate
EP2582719B1 (en) 2010-06-16 2016-08-10 Indiana University Research and Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor
WO2011163460A1 (en) 2010-06-24 2011-12-29 Indiana University Research And Technology Corporation Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor
JP5912112B2 (ja) 2010-06-24 2016-04-27 インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation アミド系インスリンプロドラッグ
RU2580317C2 (ru) 2010-06-24 2016-04-10 Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн Пептидные пролекарства, принадлежащие к суперсемейству амид-содержащих глюкагонов

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
WO1996034882A1 (en) 1995-05-05 1996-11-07 Eli Lilly And Company Single chain insulin with high bioactivity
US6630348B1 (en) 2000-10-02 2003-10-07 Univ Yonsei Seoul Single-chain insulin analog and a polynucleotide sequence encoding the analog
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US7083970B2 (en) 2001-04-19 2006-08-01 The Scripps Research Institute Methods and compositions for the production of orthogonal tRNA-aminoacyl tRNA synthetase pairs
US7355008B2 (en) 2003-01-09 2008-04-08 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
US7381408B2 (en) 2003-05-06 2008-06-03 Syntonix Pharmaceuticals, Inc. Methods for chemically synthesizing immunoglobulin chimeric proteins
US20080286808A1 (en) 2005-09-27 2008-11-20 Volker Schellenberger Methods for production of unstructured recombinant polymers and uses thereof
WO2009023270A2 (en) 2007-08-15 2009-02-19 Amunix, Inc. Compositions and methods for modifying properties of biologically active polypeptides
WO2009099763A1 (en) 2008-01-30 2009-08-13 Indiana University Research And Technology Corporation Ester-based peptide prodrugs

Non-Patent Citations (27)

* Cited by examiner, † Cited by third party
Title
"Chemical Modifications of Proteins: History and Applications", BIOCONJUGATE CHEM., vol. 1, 1990, pages 2 - 12
APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306
ARMOUR ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613
BOLLI ET AL., DIABETOLOGIA, vol. 42, 1999, pages 1151 - 1167
BURMEISTER ET AL., NATURE, vol. 372, 1994, pages 379
FRIEND ET AL., TRANSPLANTATION, vol. 68, 1999, pages 1632
HASHIMOTO ET AL.: "Synthesis of Palmitoyl Derivatives of Insulin and their Biological Activity", PHARMACUETICAL RES., vol. 6, no. 2, 1989, pages 171 - 176
HENRY ET AL., BIOCHEMISTRY, vol. 36, 1997, pages 15568 - 15578
HIROSHI ET AL.: "Effect of N-methylation of selected peptide bonds on the biological activity of insulin", INTERNATIONAL J. OF PEPTIDE AND PROTEIN RESEARCH, vol. 30, no. 4, 1987, pages 460 - 473
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF PUBLIC HEALTH
KINSTLER ET AL., ADV. DRUG. DELIVERY REV., vol. 54, 2002, pages 477 - 485
LEWIS ET AL., J IMMUNOL., vol. 175, 2005, pages 6694 - 701
MAYER ET AL., PEPTIDE SCIENCE, vol. 88, no. 5, pages 687 - 713
MILLER, BIOCHEM BIOPHYS RES COMMUN, vol. 218, 1996, pages 377 - 382
PREVIERO ET AL., BIOCHIM BIOPHYS ACTA, vol. 263, 1972, pages 7 - 13
ROBERTS ET AL., ADV. DRUG DELIVERY REV., vol. 54, 2002, pages 459 - 476
ROUTLEDGE ET AL., TRANSPLANTATION, vol. 60, 1995, pages 847
SAN; SILVIUS, J PEPT RES, vol. 66, 2005, pages 169 - 180
SAYERS ET AL., J BIOL CHEM., vol. 279, no. 34, 2004, pages 35320 - 5
See also references of EP2585102A4
SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 1995, pages 6591
SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591
SHIMOHIGASHI; STAMMER, INT J PEPT PROTEIN RES, vol. 19, 1982, pages 54 - 62
SONDERMANN ET AL., NATURE, vol. 406, 2000, pages 267 - 273
T. E. CREIGHTON: "Proteins: Structure and Molecular Properties", 1983, W.H. FREEMAN & CO., pages: 79 - 86
WARD; GHETIE, THERAPEUTIC IMMUNOLOGY, vol. 2, 1995, pages 77
ZALIPSKY ET AL., ADV. DRUG DELIVERY REV., vol. 16, 1995, pages 157 - 182

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9089539B2 (en) 2008-01-30 2015-07-28 Indiana University Research And Technology Corporation Ester-based insulin prodrugs
US10233225B2 (en) 2010-06-16 2019-03-19 Indiana University Research And Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor
WO2011159895A2 (en) 2010-06-16 2011-12-22 Indiana University Research And Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor
US8940860B2 (en) 2010-06-16 2015-01-27 Indiana University Research And Technology Corporation Single-chain insulin agonists exhibiting high activity at the insulin receptor
EP2582719A4 (en) * 2010-06-16 2013-12-04 Univ Indiana Res & Tech Corp Single chain insulin agonists exhibiting high activity at the insulin receptor
US9458220B2 (en) 2010-06-16 2016-10-04 Indiana University Research And Technology Corporation Single-chain insulin agonists exhibiting high activity at the insulin receptor
US8946147B2 (en) 2010-06-24 2015-02-03 Indiana University Research And Technology Corporation Amide-based insulin prodrugs
US9573987B2 (en) 2011-12-20 2017-02-21 Indiana University Research And Technology Corporation CTP-based insulin analogs for treatment of diabetes
US9593156B2 (en) 2012-09-26 2017-03-14 Indiana University Research And Technology Corporation Insulin analog dimers
US10696726B2 (en) 2013-03-14 2020-06-30 Indiana University Research And Technology Corporation Insulin-incretin conjugates
US10385107B2 (en) 2014-09-24 2019-08-20 Indiana Univeresity Researc and Technology Corporation Lipidated amide-based insulin prodrugs
US10232020B2 (en) 2014-09-24 2019-03-19 Indiana University Research And Technology Corporation Incretin-insulin conjugates
US10413593B2 (en) 2014-10-24 2019-09-17 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US10919949B2 (en) 2017-08-17 2021-02-16 Novo Nordisk A/S Acylated insulin analogues and uses thereof
US11098102B2 (en) 2018-12-11 2021-08-24 Sanofi Insulin conjugates
US12195510B2 (en) 2018-12-11 2025-01-14 Sanofi Insulin conjugates

Also Published As

Publication number Publication date
JP5912112B2 (ja) 2016-04-27
AU2011270832B2 (en) 2016-05-12
JP2013531660A (ja) 2013-08-08
EP2585102A4 (en) 2013-12-18
US20130123171A1 (en) 2013-05-16
WO2011163462A3 (en) 2012-04-05
CN103119057A (zh) 2013-05-22
US8946147B2 (en) 2015-02-03
EP2585102B1 (en) 2015-05-06
CN103119057B (zh) 2016-06-15
CA2803164C (en) 2018-08-21
AU2011270832A1 (en) 2013-01-10
CA2803164A1 (en) 2011-12-29
EP2585102A2 (en) 2013-05-01

Similar Documents

Publication Publication Date Title
AU2009335715B2 (en) Amide-based insulin prodrugs
US8946147B2 (en) Amide-based insulin prodrugs
CA2802485C (en) Single chain insulin agonists exhibiting high activity at the insulin receptor
US10385107B2 (en) Lipidated amide-based insulin prodrugs
EP2970511B1 (en) Insulin-incretin conjugates
US20110245164A1 (en) Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor
WO2011163460A1 (en) Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor
WO2017210077A1 (en) Single chain insulin prodrugs

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180040875.9

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11798912

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 13702197

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2803164

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2013516766

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2011270832

Country of ref document: AU

Date of ref document: 20110623

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011798912

Country of ref document: EP