WO2011084145A2 - Recombinant butyrylcholinesterases and truncates thereof - Google Patents
Recombinant butyrylcholinesterases and truncates thereof Download PDFInfo
- Publication number
- WO2011084145A2 WO2011084145A2 PCT/US2010/003225 US2010003225W WO2011084145A2 WO 2011084145 A2 WO2011084145 A2 WO 2011084145A2 US 2010003225 W US2010003225 W US 2010003225W WO 2011084145 A2 WO2011084145 A2 WO 2011084145A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nucleic acid
- isolated nucleic
- polypeptide
- bche
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/18—Carboxylic ester hydrolases (3.1.1)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/02—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/35—Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/66—General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligation; Use of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
Definitions
- the present invention provides methods for the production of recombinant butyrylcholinesterases using polynucleotides codon-optimized for expression in mammalian, especially human, cells, including truncates thereof.
- Cholinesterase refers to a family of enzymes involved in nerve impulse transmission. Cholinesterase-inhibiting substances such as organophosphate compounds or carbamate insecticides or drugs prevent the breakdown of acetylcholine, resulting in a buildup of acetylcholine, thereby causing hyperactivity of the nervous system. When humans breathe or are otherwise exposed to these compounds, which has led to the development of these compounds as "nerve gases" or chemical warfare agents.
- butyrylcholinesterases Those enzymes which preferentially hydrolyze other types of esters such as butyrylcholine, and whose enzymatic activity is sensitive to the chemical inhibitor tetraisopropylpyrophosphoramide (also known as iso- OMPA), are called butyrylcholinesterases (BChE, EC 3.1.1.8).
- Butyrylcholinesterase (BChE) also known as plasma, serum, benzoyl, false, or Type II ChE, has more than eleven isoenzyme variants and preferentially uses butyrylcholine and benzoylcholine as in vitro substrates.
- BChE is found in mammalian blood plasma, liver, pancreas, intestinal mucosa, the white matter of the central nervous system, smooth muscle, and heart. BChE is sometimes referred to as serum cholinesterase as opposed to red cell cholinesterase (AChE).
- cholinesterases as pre-treatment drugs has been successfully demonstrated in animals, including non-human primates.
- pretreatment of rhesus monkeys with fetal bovine serum-derived AChE or horse serum-derived BChE protected them against a challenge of two to five times the LD50 of pinacolyl methylphosphonofluoridate (soman), a highly toxic organophophate compound used as a war-gas [Broomfield, et al. J. Pharmacol. Exp. Ther. (1991) 259:633-638; Wolfe, et al. Toxicol Appl Pharmacol (1992) 1 17(2): 189-193].
- the pretreatment prevented behavioral incapacitation after the soman challenge, as measured by the serial probe recognition task or the equilibrium platform performance task.
- Administration of sufficient exogenous human BChE can protect mice, rats, and monkeys from multiple lethal-dose organophosphate intoxication [see for example Raveh, et al. Biochemical Pharmacology (1993) 42:2465-2474; Raveh, et al. Toxicol. Appl. Pharmacol. (1997) 145.43-53, Allon, et al. Toxicol. Sci. (1998) 43:121-128].
- Purified human BChE has been used to treat organophosphate poisoning in humans, with no significant adverse immunological or psychological effects (Cascio, et al. Minerva Anestesiol (1998) 54:337).
- BChE is the major detoxifying enzyme of cocaine [Xie, et al. Molec. Pharmacol. (1999) 55:83-91].
- Cocaine is metabolized by three major routes: hydrolysis by BChE to form ecgonine methyl ester, N- demethylation from norcocaine, and non-enzymatic hydrolysis to form benzoylcholine.
- Studies have shown a direct correlation between low BChE levels and episodes of life-threatening cocaine toxicity.
- a recent study has confirmed that a decrease of cocaine half-life in vitro correlated with the addition of purified human BChE.
- Recombinant enzymes as opposed to those derived from plasma, have a much lower risk of transmission of infectious agents, including viruses such as hepatitis C and HIV.
- the current obstacles in the manufacture of the native BChE molecule as a bioscavenger product which are: 1 ) low yield, 2) complex manufacturing process (milk), 3) short half-life (thus requiring pegylation), 4) highly heterogeneous product (difficult to characterize and obtain FDA approval) and 5) high cost of the product.
- the present invention addresses at least some of these problems by providing inter alia a truncated monomeric form of BChE. While the the monomer form is just as active as the tetrameric form, it has been considered to be less stable (i.e., have a lower "MRT") than the tetramer. This may be because the protein made is not properly glycosylated and/or sialylated. Applicants have identified a cell line and clone to accomplish this result. Furthermore, if the full length BChE is made, the cells produce a mixture of monomer, dimer and tetramer so that the present invention also provides a means of producing preferably the monomeric form.
- the present invention relates to an isolated nucleic acid, which may be DNA, such as a cDNA, or RNA, that encodes a polypeptide having BChE enzyme activity (as determined, for example, using the well known Ellman assay), wherein the nucleic acid has been codon-optimized, such as where the percentage of guanine plus cytosine (G+C) nucleotides in the coding region of the nucleic acid is greater than about 40%, or is greater than 45%, or is greater than 50%, or is greater than 55%, or is at least 60%, or is greater than 60% but not greater than 80%.
- G+C guanine plus cytosine
- the isolated nucleic acid does not contain internal structural elements that reduce expression levels of the subject genetic construct, including an internal TATA-box, an internal ribosomal entry site, or a splice donor or acceptor site.
- the isolated nucleic acid of the invention contains or encodes at least one Kozak sequence, preferably upstream of the start site.
- the isolated nucleic acid of the invention also encodes one or more glycosylation and/or sialylation sites on the synthesized polypeptide. In a preferred embodiment, these are sufficient in number to permit full glycosylation and/or sialylation of the encoded BChE.
- FIGS. 1-1 to 1-4 show codon optimized nucleotide (SEQ ID NO: 1) and corresponding amino acid (SEQ ID NO: 2) sequences of a BChE of the invention.
- Such sequences contain inserted restriction and other sites, such as the human signal or leader sequence made up of amino acids 1 to 21 , where full length BChE begins with the sequence EDD starting at amino acid residue 22.
- Figures 2-1 to 2-2 show nucleotide (SEQ ID NO: 5) and corresponding amino acid (SEQ ID NO: 6) sequences of native human BChE (i.e., without codon optimization), containing a goat casein leader or signal polypeptide (amino acids 1 to 15) for transgenic expression in goat's milk, and where the BChE native polypeptide begins with the sequence EDD starting at amino acid residue 17 (the glutamic acid numbered 1) and inserted arginine as 1 ').
- Figures 3-1 to 3-4 show codon-optimized nucleotide (SEQ ID NO: 3) and amino acid sequence (SEQ ID NO: 4) of a BChE truncate of the invention, containing a human signal or leader sequence made up of amino acids 1 to 21 , where the BChE truncate begins with the sequence EDD starting at amino acid residue 22.
- SEQ ID NO: 3 codon-optimized nucleotide
- SEQ ID NO: 4 amino acid sequence
- butyrylcholinesterase enzyme or "BChE enzyme” means a polypeptide capable of hydrolyzing acetylcholine and butyrylcholine, and whose catalytic activity is inhibited by the chemical inhibitor iso-OMPA.
- Preferred BChE enzymes to be produced by the present invention are mammalian BChE enzymes.
- the term "BChE enzyme” also encompasses pharmaceutically acceptable salts of such a polypeptide.
- recombinant butyrylcholinesterase or "recombinant BChE” means a BChE enzyme produced by a transiently transfected, stably transfected, or transgenic host cell or animal as directed by one of the expression constructs of the invention as well as by direct chemical synthesis.
- recombinant BChE also encompasses pharmaceutically acceptable salts of such a polypeptide.
- vector sequences means any of several nucleic acid sequences established in the art which have utility in the recombinant DNA technologies of the invention to facilitate the cloning and/or propagation of the expression constructs including (but not limited to) plasmids, cosmids, phage vectors, viral vectors, and yeast artificial chromosomes.
- expression construct means a nucleic acid sequence comprising a target nucleic acid sequence or sequences whose expression is desired, operably linked to sequence elements which provide for the proper transcription and translation of the target nucleic acid sequence(s) within the chosen host cells.
- sequence elements may include a promoter, a signal sequence for secretion, a polyadenylation signal, intronic sequences, insulator sequences, and other elements described in the invention.
- the "expression construct” or “construct” may further comprise vector sequences.
- operably linked means that a target nucleic acid sequence and one or more regulatory sequences (e.g., promoter or signal sequences) are physically linked so as to permit expression of the polypeptide encoded by the target nucleic acid sequence within a host cell.
- regulatory sequences e.g., promoter or signal sequences
- promoter means a region of DNA involved in binding of
- RNA polymerase to initiate transcription.
- signal sequence means a nucleic acid sequence which, when incorporated into a nucleic acid sequence encoding a polypeptide, directs secretion of the translated polypeptide (e.g., a BChE enzyme and/or a glycosyltransferase) from cells which express said polypeptide.
- the signal sequence is preferably located at the 5'-end of the nucleic acid sequence encoding the polypeptide, such that the polypeptide sequence encoded by the signal sequence is located at the N-terminus of the translated polypeptide, and is commonly a leader sequence.
- signal peptide means the peptide sequence resulting from translation of a signal sequence.
- host cell means a cell which has been transfected with one or more expression constructs of the invention.
- host cells include mammalian cells in in vitro culture and cells found in vivo in an animal. Preferred in vitro cultured mammalian host cells include Per.C6 cells.
- transfection means the process of introducing one or more of the expression constructs of the invention into a host cell by any of the methods well established in the art, including (but not limited to) microinjection, electroporation, liposome-mediated transfection, calcium phosphate-mediated transfection, or virus-mediated transfection.
- a host cell into which an expression construct of the invention has been introduced by transfection is "transfected".
- transiently transfected cell means a host cell wherein the introduced expression construct is not permanently integrated into the genome of the host cell or its progeny, and therefore may be eliminated from the host cell or its progeny over time.
- stably transfected cell means a host cell wherein the introduced expression construct has integrated into the genome of the host cell and its progeny.
- DNA segment refers to a DNA polymer, in the form of a separate fragment or as a component of a larger DNA construct, which has been derived from DNA isolated at least once in substantially pure form, i.e., free of contaminating endogenous materials and in a quantity or concentration enabling identification, manipulation, and recovery of the segment and its component nucleotide sequences by standard biochemical methods, for example, using a cloning vector.
- segments are provided in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, which are typically present in eukaryotic genes. Sequences of non-translated DNA may be present downstream from the open reading frame, where the same do not interfere with manipulation or expression of the coding regions.
- isolated in the context of the present invention with respect to polypeptides (or polynucleotides) means that the material is removed from its original environment (e.g. , the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living organism is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment.
- the polypeptides and polynucleotides of the present invention are preferably provided in an isolated form, and preferably are purified to homogeneity.
- coding region refers to that portion of a gene which either naturally or normally codes for the expression product of that gene in it ' s natural genomic environment, i.e., the region coding in vivo for the native expression product of the gene.
- the coding region can be from a normal, mutated or altered gene, or can even be from a DNA sequence, or gene, wholly synthesized in the laboratory using methods well known to those of skill in the art of DNA synthesis.
- nucleotide sequence refers to a heteropolymer of deoxyribonucleotides.
- DNA segments encoding the proteins provided by this invention are assembled from cDNA fragments and short oligonucleotide linkers, or from a series of oligonucleotides, to provide a synthetic gene which is capable of being expressed in a recombinant transcriptional unit comprising regulatory elements derived from a microbial or viral operon.
- expression product means that polypeptide or protein that is the natural translation product of the gene and any nucleic acid sequence coding equivalents resulting from genetic code degeneracy and thus coding for the same amino acid(s).
- portion when used in relation to polypeptides, refer to a continuous sequence of residues, such as amino acid residues, which sequence forms a subset of a larger sequence.
- the oligopeptides resulting from such treatment would represent portions, segments or fragments of the starting polypeptide.
- such terms refer to the products produced by treatment of said polynucleotides with any of the common endonucleases.
- fragment when referring to a coding sequence, means a portion of DNA comprising less than the complete coding region whose expression product retains essentially the same biological function or activity as the expression product of the complete coding region.
- ORF open reading frame
- the term “percent identity” or “percent identical,” when referring to a nucleotide or amino acid sequence, means that the sequence is compared to a claimed or described sequence after alignment of the sequence to be compared (the "Compared Sequence") with the described or claimed sequence (the “Reference Sequence”).
- the Percent Identity is then determined according to the following formula:
- Percent Identity 100 [1-(C/R)] wherein C is the number of differences between the Reference Sequence and the Compared Sequence over the length of alignment between these sequences wherein (i) each base or amino acid in the Reference Sequence that does not have a corresponding aligned base or amino acid in the Compared Sequence and (ii) each gap in the Reference Sequence and (iii) each aligned base or amino acid in the Reference Sequence that is different from an aligned base or amino acid in the Compared Sequence, constitutes a difference; and R is the number of bases or amino acids in the Reference Sequence over the length of the alignment with the Compared Sequence with any gap created in the Reference Sequence also being counted as a base or amino acid.
- Butyrylcholinesterase derived from human serum is a globular, tetrameric molecule with a molecular mass of approximately 340 kDa. Nine Asn-linked carbohydrate chains are found on each 574-amino acid subunit (which subunit begins with amino acid 17 in SEQ ID NO: 6).
- the tetrameric form of BChE is stable and has been preferred in the art for therapeutic uses.
- BChE enzymes produced according to the instant invention have the ability to bind and/or hydrolyze organophosphate, such as pesticides, and war gases, succinylcholine, or cocaine.
- the BChE enzyme of the present invention comprises an amino acid sequence that is substantially identical to a sequence found in a mammalian BChE, more preferably, human BChE, and may be produced as a tetramer, a trimer, a dimer, or a monomer.
- the synthesized BChE of the invention has a glycosylation and/or sialylation profile that is substantially similar, if not identical, to that of native human BChE.
- the BChE produced according to the present invention is preferably in monomeric form with high MRT, thus reducing the need for expensive post- synthetic modification to increase MRT, such as pegylation (i.e., attachment of one or more molecules of polyethylene glycol of varying molecular weight and structure).
- pegylation i.e., attachment of one or more molecules of polyethylene glycol of varying molecular weight and structure.
- BChE expressed recombinantly in CHO (Chinese hamster ovary) cells was found not to be mostly in the more stable tetrameric form, but rather consisted of approximately 55% dimers, 10-30% tetramers and 15-40% monomers (Blong, et al. Biochem. J., Vol. 327, pp 747-757 (1997)).
- the DNA sequence encoding the BChE enzyme of the invention preferably does not comprise a proline-rich attachment domain (PRAD), which otherwise recruits recombinant BChE subunits (e.g., monomers, dimers and trimers) to form tetrameric associations.
- PRAD proline-rich attachment domain
- the non-tetrameric forms of BChE are also useful in applications which do not require in vivo administration, such as the clean-up of lands used to store organophosphate compounds, as well as decontamination of military equipment exposed to organophosphates.
- these non- tetrameric forms of BChE may be incorporated into sponges, sprays, cleaning solutions or other materials useful for the topical application of the enzyme to equipment and personnel.
- These forms of the enzyme may also be applied externally to the skin and clothes of human patients who have been exposed to organophosphate compounds.
- the non-tetrameric forms of the enzyme may also find applications as barriers and sealants applied to the seams and closures of military clothing and gas masks used in chemical warfare situations.
- the present invention also provides vectors that include polynucleotides of the present invention, host cells which are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques.
- Host cells are genetically engineered (i.e., transduced or transformed or transfected) with the vectors of this invention which may be, for example, a cloning vector or an expression vector, preferably in the form of a plasmid, a viral particle, a phage, etc.
- the engineered host cells can be cultured in conventional nutrient media modified as required for activating promoters, selecting transformants or amplifying the genes of the present invention.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the polynucleotides of the present invention are preferably employed for producing polypeptides by recombinant techniques.
- a polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide.
- Such vectors include chromosomal, nonchromosomal and synthetic DNA sequences, e.g., derivatives of SV40; bacterial plasmids; phage DNA; baculovirus; yeast plasmids; vectors derived from combinations of plasmids and phage DNA, viral DNA such as vaccinia, adenovirus, fowl pox virus, and pseudorabies.
- any other vector may be used as long as it is replicable and viable in the host cell.
- the appropriate DNA sequence may be inserted into the vector by a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art. Such procedures and others are deemed to be within the scope of those skilled in the art.
- the DNA sequence in the expression vector is operatively linked to an appropriate expression control sequence(s) (such as a promoter and/or enhancer, in either cis or trans location) to direct mRNA synthesis.
- an appropriate expression control sequence(s) such as a promoter and/or enhancer, in either cis or trans location
- promoters there may be mentioned: LTR or SV40 promoter, the phage lambda P L promoter and other promoters known to control expression of genes in eukaryotic, preferably human, cells.
- the expression vector also contains a ribosome binding site for translation initiation and a transcription terminator.
- the vector may also include appropriate sequences for amplifying expression, especially where these are designed to work
- the vector containing the appropriate DNA sequence as herein described, as well as an appropriate promoter or control sequence, may be employed to transform an appropriate host to permit the host to express the protein.
- the present invention also includes recombinant constructs comprising one or more of the sequences as broadly described above.
- the constructs comprise a vector, such as a plasmid or viral vector, into which a sequence of the invention has been inserted, in a forward or reverse orientation.
- the construct further comprises regulatory sequences, including, for example, a promoter, operably linked to the sequence.
- promoter regions can be selected from any desired gene using CAT
- Eukaryotic promoters include CMV immediate early, HSV thymidine kinase, early and late SV40, LTRs from retrovirus, and mouse metallothionein-l. Selection of the appropriate vector and promoter is well within the level of ordinary skill in the art.
- the present invention relates to host cells containing the above-described constructs.
- the host cell is preferably a human cell, since the nucleic acids of the invention have been optimized for such human expression.
- Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation (Davis, L, Dibner, M., Battey, I., Basic Methods in Molecular Biology, (1986)).
- the constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence.
- the polypeptides of the invention can be synthetically produced by conventional peptide synthesizers.
- Enhancers are cis-acting elements of DNA, usually from about 10 to about 300 bp that act on a promoter to increase its transcription.
- recombinant expression vectors will include origins of replication and selectable markers permitting transformation of the host cell and a promoter derived from a highly-expressed gene to direct transcription of a downstream structural sequence.
- promoters can be derived from operons encoding glycolytic enzymes such as 3-phosphoglycerate kinase (PGK), a- factor, acid phosphatase, or heat shock proteins, among others.
- the heterologous structural sequence is assembled in appropriate phase with translation initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein into the periplasmic space or extracellular medium.
- the heterologous sequence can encode a fusion protein including an N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
- the selected promoter is induced by appropriate means (e.g., temperature shift or chemical induction) and cells are cultured for an additional period.
- appropriate means e.g., temperature shift or chemical induction
- Cells are typically harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract retained for further purification.
- Mammalian, especially human, cell expression vectors will comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation site, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking non-transcribed sequences.
- DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
- the polypeptide can be recovered and purified from recombinant cell cultures by methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the mature protein. Finally, high performance liquid chromatography (HPLC) can be employed for final purification steps.
- HPLC high performance liquid chromatography
- the nucleic acid, e.g. DNA, to be expressed may be codon optimized so as to contain a coding region utilizing the codons most commonly employed by that species or that particular type of cell. Codon optimization is a technique which is now well known and used in the design of synthetic genes. Different organisms preferentially utilize one or other of these different codons. By optimizing codons, it is possible to greatly increase expression levels of the particular protein in a selected cell type.
- CAI Codon Adaptation Index
- Such Codon Adaptation Index is determined according to methods known in the art by setting the quality value of the most frequently used codon for a given amino acid in the desired expression system to 100 with the remaining codons scaled accordingly (see Sharp and Li, Nucleic Acids Research, Vol. 15(3), 99.
- the CAI uses a reference set of highly expressed genes from a species to determine relative merit of each codon to calculate a score for a gene from the frequency of use of all codons in said gene. This index is useful for predicting the level of expression of a gene and indicate likely success of heterologous gene expression in a given cell system.
- the nucleic acids for example, a DNA
- the nucleic acids have also been optimized using additional parameters. For example, analysis of the wild-type human BChE gene has been found to contain an average G+C content of about 40% by determining the GC content in a 40 bp window centered about various nucleotide positions. Conversely, the GC content of nucleic acids according to the present invention, such as the codon optimized nucleic acids disclosed herein, have an average GC content of about 60%. For example, in producing nucleic acids of the present invention, very high or low GC content has been avoided, so that any GC content less than 30% or above 80% has been avoided.
- the present invention relates to an isolated nucleic acid, DNA or RNA, that encodes a polypeptide having BChE enzyme activity (for example, using the well known Ellman assay - Ellman, G. L, et al, Biochem. Pharmacol., Vol. 7, pp. 88-95 (1961)), wherein the percentage of guanine plus cytosine (G+C) nucleotides in the coding region of said nucleic acid is greater than 40%, or is greater than 45%, or is greater than 50%, or is greater than 55%, or is at least 60%, or is greater than 60% but is less than 80%. In all cases, codon usage has been adapted to the codon bias of human (Homo sapiens) genes.
- an isolated nucleic acid of the invention include nucleic acids comprising a nucleotide sequence having at least 80% identity, or at least 90% identity, preferably at least 95% identity, more preferably at least 98% identity to the nucleotide sequence of SEQ ID NO: 1 or the complement thereof.
- the nucleic acid of the invention comprises, more preferably consists essentially of, and most preferably consists of, the nucleotide sequence of SEQ ID NO: 1 or the complement thereof. In all cases, such nucleic acids, in addition to SEQ ID NO: 1 itself, meet the other requirements of the invention regarding GC content and/or CAI and like parameters.
- the BChE polypeptide encoded by the nucleic acid of the invention comprises, preferably consists of, amino acids 22-564 of SEQ ID NO: 2.
- the encoded BChE polypeptide contains fewer than the number of amino acids in SEQ ID NO: 2 (i.e., is a truncated, variant or modified form of said sequence, such as the truncate shown as SEQ ID NO: 4 and/or in Figure 3, with or without the signal sequence).
- Such modification may affect the overall 3-dimensional structure or shape of the resulting BChE enzyme. Consequently, the resulting encoded polypeptide does not readily form tetramers or even dimers, but remains in a monomeric state.
- such monomeric BChE polypeptides are achieved by producing a BChE polypeptide that differs from the native BChE of SEQ ID NO: 6, or is a variant of such polypeptide, such as a polypeptide having less than 100% identity to the sequence of SEQ ID NO: 2 or 4 or amino acids 22-564 of said sequences but retaining substantially all of the BChE enzyme activity of said polypeptide, or where one or more amino acids present in such polypeptides are either different or not included in said polypeptide, which is thus a variant or shortened or truncated polypeptide and which forms mostly, or all, or only, monomers.
- such a truncate commonly differs from native, or full length, BChE (such as SEQ ID NO: 6 starting at amino acid 17) in that a specific domain is not present.
- a domain (referred to in the art as the WAT domain) comprises the C-terminal portion of the BChE polypeptide, preferably the C-terminal 20 to 40 amino acids of a native BChE, more preferably the C-terminal 25 to 35 amino acids of native BChE, most preferably the C-terminal 31 amino acids of such BChE.
- any amino acid segment after the tryptophan residue at residue 564 of SEQ ID NO: 2 Fig.
- said BChE polypeptide does not form monomers because all or a portion of said WAT domain has been deleted or because one or more amino acid substitutions have been introduced into said domain to render it non-functional for the purpose of inducing multimer formation of the resulting mature polypeptide.
- BChE truncates of the present invention may or may not include a signal sequence, such as that shown in Figures 1 , 2 or 3.
- a truncate of the mature polypeptide is contemplated by the invention.
- One such example would consist of amino acids 22 - 564 of SEQ ID NO: 4.
- Such a monomer especially one composed of such a truncate, has the advantage of a much better defined amino acid sequence and is capable of being synthesized in amounts up to 10 times, 20 times or even 40 times, or more, the amounts normally synthesized of the tetrameric form of BChE and at greatly reduced cost, thereby making it a much more desirable therapeutic agent from both a clinical and commercial viewpoint.
- the sequence KAGFHRWNNYMMDWKNQFNDYTSKKESCVGL (SEQ ID NO: 7), located at amino acid residues 565-595 of SEQ ID NO: 2, has been found to be involved in formation of multimeric BChE molecules, such as in the dimerization and/or tetramerization of BChE (see, for example, Blong et al., supra, which contains additional structural information concerning such domains). By the deletion of part or all of this domain, most, if not all, of the resulting BChE product is rendered not capable of forming multimers and so remains in monomic form.
- this truncated form of BChE is expressed in Per.C6 cells with the optimal clone selected. This truncated BChE has a long MRT, making it the preferable form as a drug product.
- such truncate is also prepared by direct synthesis and other means, such as using recombinant cells, preferably mammalian cells, more preferably human cells, most preferably Per.C6 (or PerC6) cells, that achieve high levels of glycosylation and/or sialylation of a heterologous protein, or where synthesis, either in vitro or in vivo, is followed by in vitro glycosylation and/or sialylation.
- a BChE truncate of the invention comprises the amino acid sequence of SEQ ID NO: 4 (shown in Figure 3), which comprises a human signal sequence at the N-terminus.
- a BChE truncate of the present invention is thus a BChE molecule with part or all of the WAT domain removed. Without a functioning WAT domain, the molecule does not form multimers, such as tetramers and/or dimers, but forms mostly, if not only, monomers.
- the selection of the truncation site for example, after W at 564 (of SEQ ID NO: 2, for example) facilitates a more uniform C-terminal region.
- Use of Per.C6 cells coupled with the selection of high glycosylation and high sialylation clone(s) ensures long serum half-life and is a preferred embodiment of the invention. In sum, such a truncated BChE construct is simple, results in higher yield, longer serum half-life and a more homogeneous product, meeting all the requirements needed for an effective pharmaceutical agent.
- the BChE truncate of the present invention can be produced by any means known in the art, including by direct chemical synthesis and the sequence of such truncate, where prepared by expression of an encoding DNA, need not be derived from a codon-optimized DNA.
- Standard references are available that contain procedures well known in the art of molecular biology and genetic engineering for producing the nucleic acids and polypeptides of the present invention. Useful references include Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), Wu et al, Methods in Gene Biotechnology (CRC Press, New York, NY, 1997), and Recombinant Gene Expression Protocols, in Methods in Molecular Biology, Vol. 62, (Tuan, ed., Humana Press, Totowa, NJ, 1997), the disclosures of which are hereby incorporated by reference.
- the present invention relates to a vector comprising a nucleic acid of the invention, as well as to a recombinant cell containing such a vector and expressing a BChE polypeptide by expressing a nucleic acid of the invention, preferably where that nucleic acid is present in a vector of the invention.
- the present invention also relates to a method of preparing such a polypeptide having BChE enzyme activity, comprising expressing the polypeptide from a recombinant cell as described herein, preferably where the polypeptide comprises the amino acid sequence of SEQ ID NO: 4 (for example, SEQ ID NO: 2), including where the polypeptide forms only monomers, for example, where such polypeptide does not contain portions of one or more domains that promote formation of such supra-molecular structures, including where the entire domain is absent or sequence altered.
- SEQ ID NO: 4 for example, SEQ ID NO: 2
- monomers were thought to be less active that tetramers but this is likely due to improper glycosylation.
- the present invention provides a codon optimized nucleic acid encoding BChE and appropriate glycosylation sites coupled with a cell line especially useful for expressing the properly glycosylated truncated molecule as a fully active monomer monomer possessing good retention time.
- a nucleic acid of the invention used to transform the cells useful in practicing the invention is a synthetic gene of which the nucleic acid of SEQ ID NO 1 is only a specific yet preferred example.
- Such nucleic acids include modified forms of SEQ ID NO: 1.
- the expression "modified form” refers to other nucleic acid sequences which encode BChE (including fragments or variants thereof) and have BChE enzyme activity but which utilize different codons, provided the requirement for the percentage GC content and other criteria recited in accordance with the invention are met.
- Suitable modified forms include those that comprise at least 80% identity, preferably at least 90% identity, more preferably at least 95% identity and even more preferably at least 98% identity to SEQ ID NO .
- the nucleic acid sequence of SEQ ID NO: 1 and/or SEQ ID NO: 3 have been codon-optimized for expression in human cells, such as Per.C6 cells (a fully characterized human cell line for use with recombinant adenoviral vectors (available from Crucell L.V., Leiden, The Netherlands).
- This cell line has the advantage of producing heterologous proteins in good yield. It has also been found to be free of prions, is easily transfected with exogenous genes and grows well in commercially available media free of animal and/or human derived proteins.
- the different embodiments of the invention have been achieved by further optimizing the nucleic acids of the invention to avoid inclusion of polynucleotide sequence elements that would otherwise reduce expression of the nucleic acid, and subsequent synthesis of BChE.
- sequence elements may be selected from the group comprising; negative elements or repeat sequences, cis-acting motifs such as splice sites, internal TATA-boxes and ribosomal entry sites.
- a TATA box (or TATA) site is well known in the art and generally represents a consensus sequence found in the promoter region of genes that are transcribed by the RNA polymerase II found in mammalian, such as human, cells.
- chi-site which can induce homologous recombination, thereby disrupting the cloned gene.
- RecBCD a heterotrimeric helicase that initiates homologous recombination at double-stranded DNA breaks
- chi DNA sequence denoted “chi” (i.e., 5'-GCTGGTGG-3' (SEQ ID NO: 8)).
- the nucleic acids, or genetic constructs, of the invention for purposes of expression from recombinant cells of the invention, preferably do encode a Kozak site upstream of the start site.
- Protein-coding genes of mammals may also contain introns that ate involved in RNA splicing events that take place after transcription is complete but prior to translation at the ribosome. Sequences of such sites are known in the art and have, where feasible, been avoided in designing the sequences of the nucleic acids of the invention, which are made up mostly of coding sequence and are thus cDNA in nature.
- such a splice site may contain a an almost invariant GT sequence at the 5' end of the intron as part of a larger less conserved region.
- the 3' splice site or splice acceptor site terminates the intron with an almost always present AG sequence. Upstream of this AG site is often found a sequence in pyrimidine content (i.e., C and T nucleotides). Such structural motifs are well known in the art and, where feasible, have been likewise avoided in achieving the nucleic acids, or DNA constructs, of the present invention. Recombinant butyrylcholinesterase forms often exhibit variation in the type of sugar residues found within the different sugars attached to the molecule. Such variation can negatively affect the mean retention time (MRT) of the BChE molecule in vivo.
- MRT mean retention time
- the present invention preferably utilizes the Per.C6 expression system so as to achieve as close a similarity to the native human glycosylation patent for BChE as is possible.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/517,081 US8729245B2 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
| CA2784861A CA2784861A1 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
| AU2010340358A AU2010340358B2 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
| EP10842361.7A EP2516664B1 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
| JP2012545932A JP2013526840A (ja) | 2009-12-21 | 2010-12-21 | 組み換えブチリルコリンエステラーゼおよびその切断型 |
| US14/244,026 US8952143B2 (en) | 2009-12-21 | 2014-04-03 | Recombinant butyrylcholinesterases and truncates thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US28444409P | 2009-12-21 | 2009-12-21 | |
| US61/284,444 | 2009-12-21 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/517,081 A-371-Of-International US8729245B2 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
| US14/244,026 Continuation US8952143B2 (en) | 2009-12-21 | 2014-04-03 | Recombinant butyrylcholinesterases and truncates thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011084145A2 true WO2011084145A2 (en) | 2011-07-14 |
| WO2011084145A3 WO2011084145A3 (en) | 2013-05-30 |
Family
ID=44306009
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/003225 Ceased WO2011084145A2 (en) | 2009-12-21 | 2010-12-21 | Recombinant butyrylcholinesterases and truncates thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US8729245B2 (enExample) |
| EP (1) | EP2516664B1 (enExample) |
| JP (1) | JP2013526840A (enExample) |
| AU (1) | AU2010340358B2 (enExample) |
| CA (1) | CA2784861A1 (enExample) |
| WO (1) | WO2011084145A2 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8729245B2 (en) | 2009-12-21 | 2014-05-20 | Pharmathene, Inc. | Recombinant butyrylcholinesterases and truncates thereof |
| WO2016170113A1 (en) * | 2015-04-24 | 2016-10-27 | Ferring B.V. | Method of production of gonadotrophin |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9688970B2 (en) | 2013-10-01 | 2017-06-27 | Kentucky Bioprocessing, Inc. | Plant-based recombinant butyrylcholinesterase production methods |
| PE20181156A1 (es) * | 2015-11-05 | 2018-07-19 | Bamboo Therapeutics Inc | Genes de ataxia de friedreich modificados y vectores para terapia genica |
| CN108486114A (zh) * | 2018-04-18 | 2018-09-04 | 西南大学 | 实现两个基因等量表达的基因元件及表达载体 |
| EP3964265A1 (en) * | 2020-09-07 | 2022-03-09 | Fundacion Instituto De Investigacion Sanitaria Fundacion Jimenez Diaz | Mesenchymal stem cells co-expressing cxcr4 and il-10 and uses thereof |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5215909A (en) | 1986-06-18 | 1993-06-01 | Yeda Research & Development Co., Ltd. | Human cholinesterase genes |
| US5595903A (en) | 1989-03-21 | 1997-01-21 | Yissum Research Development Co. Of The Hebrew University Of Jerusalem | Genetically engineered human acetylcholinesterase |
| US6001625A (en) | 1995-05-19 | 1999-12-14 | The United States Of America As Represented By The Secretary Of The Army | Site-directed mutagenesis of esterases |
| WO2005066337A2 (en) | 2004-01-09 | 2005-07-21 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Compounds, pharmaceutical compositions and therapeutic methods of preventing and treating diseases and disorders associated with amyloid fibril formation |
| WO2007040568A2 (en) | 2004-12-01 | 2007-04-12 | Arizona Board Of Regents, Acting For And On Behalf Of Arizona State Univeristy | Production and use of human butyrylcholinesterase |
Family Cites Families (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US6727405B1 (en) | 1986-04-09 | 2004-04-27 | Genzyme Corporation | Transgenic animals secreting desired proteins into milk |
| US5366894A (en) | 1986-06-30 | 1994-11-22 | Pharmaceutical Proteins Limited | Peptide production |
| EP0279582A3 (en) | 1987-02-17 | 1989-10-18 | Pharming B.V. | Dna sequences to target proteins to the mammary gland for efficient secretion |
| US5750172A (en) | 1987-06-23 | 1998-05-12 | Pharming B.V. | Transgenic non human mammal milk |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| FR2649991B2 (fr) | 1988-08-05 | 1994-03-04 | Rhone Poulenc Sante | Utilisation de derives stables du plasmide pkd1 pour l'expression et la secretion de proteines heterologues dans les levures du genre kluyveromyces |
| US5227301A (en) | 1989-11-03 | 1993-07-13 | The 501 Institution For The Advancement Of Learning (Mcgill University) | Immortalized bovine mannary epithelial cell line |
| US5633076A (en) | 1989-12-01 | 1997-05-27 | Pharming Bv | Method of producing a transgenic bovine or transgenic bovine embryo |
| US5831141A (en) | 1991-01-11 | 1998-11-03 | United States Of America As Represented By The Department Of Health And Human Services | Expression of a heterologous polypeptide in mammary tissue of transgenic non-human mammals using a long whey acidic protein promoter |
| IL101600A (en) | 1992-04-15 | 2000-02-29 | Yissum Res Dev Co | Synthetic partially phosphorothioated antisense oligodeoxynucleotides and pharmaceutical compositions containing them |
| US6110742A (en) | 1992-04-15 | 2000-08-29 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Synthetic antisense oligodeoxynucleotides targeted to AChE |
| ES2146648T3 (es) | 1993-03-09 | 2000-08-16 | Genzyme Corp | Procedimiento de aislamiento de proteinas de la leche. |
| US5610053A (en) | 1993-04-07 | 1997-03-11 | The United States Of America As Represented By The Department Of Health And Human Services | DNA sequence which acts as a chromatin insulator element to protect expressed genes from cis-acting regulatory sequences in mammalian cells |
| DE4326665C2 (de) | 1993-08-09 | 1995-07-13 | Biotest Pharma Gmbh | Verfahren zur Sterilfiltration von Milch |
| US6025183A (en) | 1994-02-28 | 2000-02-15 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Transgenic animal assay system for anti-cholinesterase substances |
| US5932780A (en) | 1994-02-28 | 1999-08-03 | Yissum Research Development Company Of Hebrew University Of Jerusalem | Transgenic non-human animal assay system for anti-cholinesterase substances |
| US6204431B1 (en) | 1994-03-09 | 2001-03-20 | Abbott Laboratories | Transgenic non-human mammals expressing heterologous glycosyltransferase DNA sequences produce oligosaccharides and glycoproteins in their milk |
| US5807671A (en) | 1995-01-09 | 1998-09-15 | Yissum Research Development Company Of Hebrew University Of Jerusalem | Method of screening for genetic predisposition to anticholinesterase therapy |
| US5780009A (en) | 1995-01-20 | 1998-07-14 | Nexia Biotechnologies, Inc. | Direct gene transfer into the ruminant mammary gland |
| IL115873A0 (en) | 1995-11-03 | 1996-01-31 | Peri Dev Applic 1985 Ltd | Transgenic protein production |
| US6326139B1 (en) | 1996-01-11 | 2001-12-04 | Yissum Research Development Company Of Hebrew University Of Jerusalem | Method of screening for genetic predisposition to anticholinesterase therapy |
| US6268487B1 (en) | 1996-05-13 | 2001-07-31 | Genzyme Transgenics Corporation | Purification of biologically active peptides from milk |
| US20020184655A1 (en) | 1997-12-01 | 2002-12-05 | Henryk Lubon | Methods for the degradation and detoxification of organic material using urine produced by transgenic animals and related transgenic animals and proteins |
| US7157615B2 (en) | 1998-03-17 | 2007-01-02 | Nexia Biotechnologies, Inc. | Production of biofilaments in transgenic animals |
| EP1329513B1 (en) | 1998-08-25 | 2011-12-07 | University of Washington | Rapid quantitative analysis of proteins or protein function in complex mixtures |
| JP2002525047A (ja) | 1998-09-16 | 2002-08-13 | ネクシア バイオテクノロジーズ, インコーポレイテッド | 尿における組換え蛋白質の産生 |
| US6580017B1 (en) | 1998-11-02 | 2003-06-17 | Genzyme Transgenics Corporation | Methods of reconstructed goat embryo transfer |
| AU1621900A (en) | 1998-11-13 | 2000-06-05 | New York University | Transgenic animals as urinary bioreactors for the production of protein in the urine, recombinant dna construct for kidney-specific expression, and method of using same |
| EP1148779B1 (en) | 1999-01-06 | 2007-12-12 | Merrimack Pharmaceuticals, Inc. | Expression of secreted human alpha-fetoprotein in transgenic animals |
| US7297680B2 (en) | 1999-04-15 | 2007-11-20 | Crucell Holland B.V. | Compositions of erythropoietin isoforms comprising Lewis-X structures and high sialic acid content |
| ES2209915T3 (es) | 1999-04-26 | 2004-07-01 | U.S. Army Medical Research And Materiel Command | Esponjas de destoxificacion op de actuacion diferencial. |
| IL131707A0 (en) | 1999-05-31 | 2001-03-19 | Yissum Res Dev Co | Acetylcholinesterase-derived peptides and uses thereof |
| WO2001071014A2 (en) | 2000-03-17 | 2001-09-27 | Boyce Thompson Institute For Plant Research, Inc. | Expression of recombinant human acetylcholinesterase in transgenic plants |
| US6946134B1 (en) | 2000-04-12 | 2005-09-20 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| EP1274720A4 (en) | 2000-04-12 | 2004-08-18 | Human Genome Sciences Inc | FUSION PROTEINS CONTAINING ALBUMIN |
| US7070973B2 (en) | 2000-12-26 | 2006-07-04 | Board Of Regents Of The University Of Nebraska | Butyrylcholinesterase variants and methods of use |
| IL142875A (en) | 2001-04-30 | 2009-08-03 | Avigdor Shafferman | PEG-linked cholinesterases for the detoxification of circulating organophosphorus |
| CA2447236A1 (en) | 2001-05-21 | 2002-11-28 | Nektar Therapeutics | Pulmonary administration of chemically modified insulin |
| CN1880457B (zh) * | 2001-10-11 | 2010-05-26 | 麦克公司 | Ad6重组核酸 |
| AU2002365202A1 (en) | 2001-11-09 | 2003-09-02 | Entremed, Inc. | Synthetic genes for malarial proteins and methods of use |
| WO2003054182A2 (en) | 2001-12-21 | 2003-07-03 | Nexia Biotechnologies, Inc. | Production of butyrylcholinesterases in transgenic mammals |
| WO2004050041A2 (en) | 2002-12-04 | 2004-06-17 | Applied Molecular Evolution, Inc. | Butyrylcholinesterase variants that alter the activity of chemotherapeutic agents |
| EP1670950A2 (en) | 2003-10-10 | 2006-06-21 | Yissum Research Development Company, of The Hebrew University of Jerusalem | Method and kit for assessing anxiety or disposition thereto in a subject |
| EP2053409A1 (en) * | 2003-11-20 | 2009-04-29 | F. Hoffmann-La Roche Ag | Specific markers for metabolic syndrome |
| WO2007011390A2 (en) | 2004-10-09 | 2007-01-25 | Government Of The United States As Represented By The Secretary Of The Army | Large-scale production of human serum butyrylcholinesterase as a bioscavenger |
| WO2006063055A2 (en) | 2004-12-06 | 2006-06-15 | Bolder Biotechnology, Inc. | Enzyme conjugates for use as detoxifying agents |
| IL169377A (en) | 2005-06-23 | 2012-09-24 | Avigdor Shafferman | Uniformly conjugated serine hydrolases |
| ES2534282T3 (es) * | 2006-06-29 | 2015-04-21 | Dsm Ip Assets B.V. | Un método para lograr la expresión polipeptídica mejorada |
| WO2008019036A2 (en) | 2006-08-04 | 2008-02-14 | Pharmathene Inc. | Long half-life recombinant butyrylcholinesterase |
| EP2185591B1 (en) * | 2007-08-20 | 2014-05-14 | Glaxo Group Limited | Production method |
| US7846428B2 (en) * | 2007-10-05 | 2010-12-07 | Merial Limited | Articular cartilage gene therapy with recombinant vector encoding BMP-7 |
| AU2010340358B2 (en) | 2009-12-21 | 2014-07-24 | Pharmathene, Inc. | Recombinant butyrylcholinesterases and truncates thereof |
-
2010
- 2010-12-21 AU AU2010340358A patent/AU2010340358B2/en not_active Ceased
- 2010-12-21 JP JP2012545932A patent/JP2013526840A/ja not_active Ceased
- 2010-12-21 US US13/517,081 patent/US8729245B2/en active Active
- 2010-12-21 WO PCT/US2010/003225 patent/WO2011084145A2/en not_active Ceased
- 2010-12-21 CA CA2784861A patent/CA2784861A1/en not_active Abandoned
- 2010-12-21 EP EP10842361.7A patent/EP2516664B1/en not_active Not-in-force
-
2014
- 2014-04-03 US US14/244,026 patent/US8952143B2/en active Active
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5215909A (en) | 1986-06-18 | 1993-06-01 | Yeda Research & Development Co., Ltd. | Human cholinesterase genes |
| US5595903A (en) | 1989-03-21 | 1997-01-21 | Yissum Research Development Co. Of The Hebrew University Of Jerusalem | Genetically engineered human acetylcholinesterase |
| US6001625A (en) | 1995-05-19 | 1999-12-14 | The United States Of America As Represented By The Secretary Of The Army | Site-directed mutagenesis of esterases |
| WO2005066337A2 (en) | 2004-01-09 | 2005-07-21 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Compounds, pharmaceutical compositions and therapeutic methods of preventing and treating diseases and disorders associated with amyloid fibril formation |
| WO2007040568A2 (en) | 2004-12-01 | 2007-04-12 | Arizona Board Of Regents, Acting For And On Behalf Of Arizona State Univeristy | Production and use of human butyrylcholinesterase |
Non-Patent Citations (18)
| Title |
|---|
| "Methods in Molecular Biology", vol. 62, 1997, HUMANA PRESS, article "Recombinant Gene Expression Protocols" |
| ALLON ET AL., TOXICOL. SCI., vol. 43, 1998, pages 121 - 128 |
| BLONG ET AL., BIOCHEM. J., vol. 327, 1997, pages 747 - 757 |
| BON ET AL., J. BIOL. CHEM., vol. 272, no. 5, 1997, pages 3016 - 3021 |
| BROOMFIELD ET AL., J. PHARMACOL. EXP. THER., vol. 259, 1991, pages 633 - 638 |
| CASCIO ET AL., MINERVA ANESTESIOL, vol. 54, 1998, pages 337 |
| DAVIS, L.; DIBNER, M.; BATTEY, I., BASIC METHODS IN MOLECULAR BIOLOGY, 1986 |
| ELLMAN, G. L. ET AL., BIOCHEM. PHARMACOL., vol. 7, 1961, pages 88 - 95 |
| KREJCI ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 22840 - 22847 |
| MCTIERNAN ET AL., PROC. NATL. ACAD. SCI USA, vol. 84, 1987, pages 6682 - 6686 |
| PRODY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 3555 - 3559 |
| RAVEH ET AL., BIOCHEMICAL PHARMACOLOGY, vol. 42, 1993, pages 2465 - 2474 |
| RAVEH ET AL., TOXICOL. APPL. PHARMACOL., vol. 145, 1997, pages 43 - 53 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR |
| SHARP; LI, NUCLEIC ACIDS RESEARCH, vol. 15, no. 3, 1987, pages 99. 1281 - 1295 |
| WOLFE ET AL., TOXICOL APPL PHARMACOL, vol. 117, no. 2, 1992, pages 189 - 193 |
| WU ET AL.: "Methods in Gene Biotechnology", 1997, CRC PRESS |
| XIE ET AL., MOLEC. PHARMACOL., vol. 55, 1999, pages 83 - 91 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8729245B2 (en) | 2009-12-21 | 2014-05-20 | Pharmathene, Inc. | Recombinant butyrylcholinesterases and truncates thereof |
| US8952143B2 (en) | 2009-12-21 | 2015-02-10 | Pharmathene, Inc. | Recombinant butyrylcholinesterases and truncates thereof |
| WO2016170113A1 (en) * | 2015-04-24 | 2016-10-27 | Ferring B.V. | Method of production of gonadotrophin |
| US10464984B2 (en) | 2015-04-24 | 2019-11-05 | Ferring B.V. | Optimized nucleic acid sequences coding for the alpha-chain of human chorionic gonadotropin |
| EA034022B1 (ru) * | 2015-04-24 | 2019-12-19 | Ферринг Б.В. | Способ получения гонадотропина |
Also Published As
| Publication number | Publication date |
|---|---|
| US8952143B2 (en) | 2015-02-10 |
| EP2516664A1 (en) | 2012-10-31 |
| US8729245B2 (en) | 2014-05-20 |
| EP2516664B1 (en) | 2015-07-22 |
| JP2013526840A (ja) | 2013-06-27 |
| WO2011084145A3 (en) | 2013-05-30 |
| US20140220658A1 (en) | 2014-08-07 |
| AU2010340358A1 (en) | 2012-07-19 |
| US20120252094A1 (en) | 2012-10-04 |
| EP2516664A4 (en) | 2013-11-13 |
| AU2010340358B2 (en) | 2014-07-24 |
| CA2784861A1 (en) | 2011-07-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| McBlane et al. | Cleavage at a V (D) J recombination signal requires only RAG1 and RAG2 proteins and occurs in two steps | |
| US8952143B2 (en) | Recombinant butyrylcholinesterases and truncates thereof | |
| EP2539445B1 (en) | Use of endonucleases for inserting transgenes into safe harbor loci | |
| KR102733409B1 (ko) | Rna-가이드 유전자 편집 및 유전자 조절 | |
| KR20210125560A (ko) | 유전성 질환의 치료를 위한 것을 포함하는, 아데노신 데아미나제 염기 편집기를 사용한 질환-관련 유전자의 스플라이스 수용체 부위 파괴 | |
| KR20210127206A (ko) | 유전성 질환의 치료를 위한 것을 포함하는, 아데노신 데아미나제 염기 편집기를 사용하여 질환-관련 유전자를 편집하는 방법 | |
| EP4428232A1 (en) | Isolated cas13 protein and use thereof | |
| KR20160050069A (ko) | Cas9 변이체 및 그의 용도 | |
| JP2022097653A (ja) | ヒトα-ガラクトシダーゼバリアント | |
| EP2910632B1 (en) | Highly functional enzyme having modified substrate specificity of human beta-hexosaminidase b and exhibiting protease resistance | |
| JPS6084299A (ja) | ヒト神経成長因子の遺伝子組換えによる調製法 | |
| KR20170120126A (ko) | 숙주 세포 단백질 변형 | |
| US20090217400A1 (en) | Enzymes, cells and methods for site specific recombination at asymmetric sites | |
| US20240307558A1 (en) | Gene therapy DNA vector based on gene therapy DNA vector VTvaf17 carrying the therapeutic gene selected from the group of KRT5, KRT14, LAMB3, and COL7A1 genes for increasing the expression level of these therapeutic genes, method of its production and use, Escherichia coli strain SCS110-AF/VTvaf17-KRT5, or Escherichia coli strain SCS110-AF/VTvaf17-KRT14, or Escherichia coli strain SCS110-AF/VTvaf17-LAMB3, or Escherichia coli strain SCS110-AF/VTvaf17-COL7A1 carrying the gene therapy DNA vector, m | |
| US5248604A (en) | Enzymatically active recombinant human acetylcholinesterase and hosts and vectors for expression thereof | |
| US8318155B2 (en) | Nucleic acid cleaving agent | |
| JP5013375B2 (ja) | メッセンジャーrna干渉酵素が促進する生細胞における単一タンパク質産生 | |
| EP3473709B1 (en) | Dna vector containing a gene encoding an equine butyrylcholinesterase, for transformation and integration into leishmania tarentolae chromosome. | |
| WO1993001830A1 (en) | Expression of enzymatically active recombinant human acetylcholinesterase and uses thereof | |
| US20090311743A1 (en) | Process for the Production, in Prokaryotes, of Active, Stable Transposases of Mariner Mobile Genetic Elements | |
| RU2732795C1 (ru) | Рекомбинантный слитый белок | |
| US20230323335A1 (en) | Miniaturized cytidine deaminase-containing complex for modifying double-stranded dna | |
| US20250195690A1 (en) | Gene therapy DNA vector based on gene therapy DNA vector GDTT1.8NAS12 carrying HFE therapeutic gene for enhanced expression of the therapeutic gene, method of its production and use, Escherichia coli strain JM110-NAS/GDTT1.8NAS12-HFE carrying the gene therapy DNA vector, method of its production, method of the gene therapy DNA vector production on an industrial scale | |
| CN120665840A (zh) | Cas9蛋白突变体及其应用 | |
| CN114507290A (zh) | 一种来源于截短型人SirT2蛋白的融合蛋白、其制备方法及应用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10842361 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2784861 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13517081 Country of ref document: US Ref document number: 220508 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012545932 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010340358 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010842361 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2010340358 Country of ref document: AU Date of ref document: 20101221 Kind code of ref document: A |