WO2011044563A2 - Il-17 family cytokine compositions and uses - Google Patents
Il-17 family cytokine compositions and uses Download PDFInfo
- Publication number
- WO2011044563A2 WO2011044563A2 PCT/US2010/052194 US2010052194W WO2011044563A2 WO 2011044563 A2 WO2011044563 A2 WO 2011044563A2 US 2010052194 W US2010052194 W US 2010052194W WO 2011044563 A2 WO2011044563 A2 WO 2011044563A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- protein
- subunit
- numbering
- cytokine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
Definitions
- the field of the invention is protein biochemistry and immunology. More particularly, the field relates to modified immunomodulatory polypeptides.
- the immune system protects individuals from infectious agents (e.g. viruses, bacteria, and multi-cellular organisms), as well as from cancer and neoplasms.
- infectious agents e.g. viruses, bacteria, and multi-cellular organisms
- the immune system includes many lymphoid and myeloid cell types such as neutrophils, monocytes, macrophages, dendritic cells (DCs), eosinophils, T cells, and B cells. These cells are capable of producing signaling proteins known as cytokines.
- Cytokines are soluble, small proteins that mediate a variety of biological effects, including the induction of immune cell proliferation, development, differentiation, and/or migration, as well as the regulation of the growth and differentiation of many cell types (see, for example, Arai et al, Annu. Rev. Biochem. 5P:783 (1990);
- Cytokine-induced immune functions can also include an inflammatory response, characterized by a systemic or local accumulation of immune cells. Although they do have host-protective effects, these immune responses can produce pathological consequences when the response involves excessive and/or chronic inflammation, as in autoimmune disorders (such as multiple sclerosis) and cancer/neoplastic diseases (Oppenheim and Feldmann (eds.) Cytokine Reference, Academic Press, San Diego, CA (2001); von Andrian and Mackay New Engl. J. Med. 343: 1020 (2000); Davidson and Diamond, New Engl. J. Med. 345:340 (2001); Lu et al, Mol. Cancer Res.
- Proteins that constitute the cytokine group include interleukins, interferons, colony stimulating factors, tumor necrosis factors, and other regulatory molecules.
- human interleukin-17 is involved in inducing and mediating proinflammatory responses.
- IL-17 is commonly associated with allergic responses.
- IL-17 induces the production of many other cytokines (such as IL-6, G-CSF, GM- CSF, IL- ⁇ , TGF- ⁇ , TNF-a), chemokines (including IL-8, GRO-a and MCP-1) and prostaglandins (e.g. PGE 2 ) from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages).
- Thl7 cells An abundance of evidence in recent years implicates Thl7 cells as central players in the pathogenesis of numerous autoimmune and inflammatory conditions.
- cytokines and their receptors illustrate the clinical potential of, and need for, other cytokines, cytokine receptors, cytokine agonists, and cytokine antagonists.
- demonstrated in vivo activities of the proinflammatory cytokine family illustrate the enormous clinical potential of, and need for antagonists of pro-inflammatory molecules such as IL- 17 and IL-23.
- compositions and methods directed to cytokine reengineering are provided.
- this disclosure features an isolated antibody (including full length antibodies, antibody fragments and domains) that specifically binds to an IL-17 cytokine polypeptide, e.g., by binding to one or more of: about amino acids 21-41, 42- 78, 82-103, or 104-133 of IL-17F; about amino acids 21-39, 40-76, 80-101, or 102- 131 of IL-17A; about amino acids 44-65, 78-117, 121-143, or 153-179 of IL-17C; about amino acids 32-53, 66-105, 110-131, or 134-163 of IL-17D; about amino acids 27-49, 50-87, 93-114, and/or 120-148 of IL-17E; or about amino acids 32-53, 66-105, 110-131, or 135-158 of IL-17B according to the numbering in Fig. 4D.
- the antibody binds to an epitope in Region 1 of the IL-17 cytokine, where Region 1 corresponds to about amino acids 21 to 41 of IL-17F, about amino acids 21-39 of IL-17A, about amino acids 44-65 of IL-17C, about amino acids 32-53 of IL-17D, about amino acids 27-49 of IL-17E, or about amino acids 32-53 of IL-17B according to the numbering in Fig. 4D.
- the antibody binds to an epitope in Region 2 of the IL-17 cytokine, where Region 2 corresponds to about amino acids 42-78 of IL-17F, about amino acids 40-76 of IL-17A, about amino acids 78-117 of IL-17C, about amino acids 66-105 of IL-17D, about amino acids 50-87 of IL-17E, or about amino acids 66- 105 of IL-17B according to the numbering in Fig. 4D.
- the antibody binds to an epitope in Region 3 of the IL-17 cytokine, where Region 3 corresponds to about amino acids 82-103 of IL-17F, about amino acids 80-101 of IL-17A, about amino acids 121-143 of IL-17C, about amino acids 110-131 of IL-17D, about amino acids 93-114 of IL-17E, or about amino acids 110-131 of IL-17B according to the numbering in Fig. 4D.
- the antibody binds to an epitope in Region 4 of the IL-17 cytokine, where Region 4 corresponds to about amino acids 104-133 of IL-17F, about amino acids 102-131 of IL-17A, about amino acids 153-179 of IL-17C, about amino acids 134-163 of IL-17D, about amino acids 120-148 of IL-17E, or about amino acids 135-158 of IL-17B according to the numbering in Fig. 4D.
- this disclosure features an isolated antibody (including full length antibodies, antibody fragments and domains) that specifically binds to amino acids 22-36, amino acids 83-96, amino acids 118-147, amino acids 152-179, or amino acids 256-271 of IL- 17RA (SEQ ID NO : 14) .
- this disclosure features an isolated antibody (including full length antibodies, antibody fragments and domains) that specifically binds to amino acids 25-39, amino acids 86-100, amino acids 126-155, amino acids 160-187, or amino acids 254-269 of IL-17RB (SEQ ID NO: 15) and/or amino acids 32-44 (e.g., 38-44), 82-98 (e.g., 88-98), and 252-269 (e.g., 256-263) of SEQ ID NO:15.
- this disclosure features an isolated antibody (including full length antibodies, antibody fragments and domains) that specifically binds to amino acids 15-30, amino acids 70-84, amino acids 96-124, amino acids 129-156, or amino acids 227-237 of IL-17RC (SEQ ID NO:16) and/or amino acids 24-35, 78-91, and 248-257 of SEQ ID NO: 16.
- This disclosure also features:
- an isolated Interleukin-17F (IL-17F) polypeptide wherein one or more of amino acids selected from the group consisting of about 21 to 41, 42-78, 82- 103, and 104-133 of SEQ ID NO: 12 are mutated to any other amino acid or are deleted, and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO: 12; • an isolated Interleukin- 17A (IL- 17A) polypeptide wherein one or more of amino acids selected from the group consisting of about 21-39, 40-76, 80- 101, and 102-131 of SEQ ID NO:2 are mutated to any other amino acid or are deleted and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO:2;
- IL-17B Interleukin- 17B
- IL-17B Interleukin- 17B polypeptide wherein one or more of amino acids selected from the group consisting of 32-53, 66-105, 110-131, and 135-158 of SEQ ID NO:4 are mutated to any other amino acid or are deleted and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO:4;
- IL-17C Interleukin- 17C
- IL-17C Interleukin- 17C
- one or more of amino acids selected from the group consisting of about 44-65, 78-117, 121- 143, and 153-179 of SEQ ID NO:6 are mutated to any other amino acid or are deleted and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO:6;
- IL-17D Interleukin- 17D
- IL-17D Interleukin- 17D
- one or more of amino acids selected from the group consisting of 32-53, 66-105, 110-131, and 134-163 of SEQ ID NO: 8 are mutated to any other amino acid or are deleted and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO:8;
- IL-17E Interleukin- 17E
- IL-17E Interleukin- 17E
- one or more of amino acids selected from the group consisting of 27-49, 50-87, 93-114, and 120-148 of SEQ ID NO: 10 are mutated to any other amino acid or are deleted and for example wherein the polypeptide includes a sequence at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to SEQ ID NO: 10.
- polypeptide can include additional features, including N- and C- terminal sequences, such as tags and immunoglobulin constant domains.
- this disclosure features a composition including a first and second IL-17 polypeptide, wherein at least one of the first and second polypeptide is a modified IL-17 polypeptide (e.g., a mutated IL-17 polypeptide).
- the composition includes a first modified IL-17 polypeptide (e.g., mutated) operably linked to a second IL-17 polypeptide.
- the second IL-17 polypeptide is also a modified (e.g., mutated) IL-17 polypeptide.
- the second IL-17 polypeptide is identical to a naturally occurring IL-17 polypeptide (e.g., a mature, human IL-17, e.g., IL-17A, IL-17B, IL-17C, IL-17D, IL- 17E, and IL-17F).
- a naturally occurring IL-17 polypeptide e.g., a mature, human IL-17, e.g., IL-17A, IL-17B, IL-17C, IL-17D, IL- 17E, and IL-17F.
- the first and second polypeptides can interact to form a structure
- the first polypeptide can be located N-terminal to the second polypeptide, or vice versa.
- the polypeptide chain can also include other elements; e.g., it can be a fusion protein.
- One or both the polypeptides can be modified, e.g., mutated relative to a reference IL-17 polypeptide (such as a human IL-17, e.g., IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F).
- the first and second polypeptide are components of the same polypeptide chain.
- the first and second polypeptides are operably linked by a coiled-coil domain or a leucine zipper.
- the first polypeptide includes a modified IL-17A polypeptide (e.g., a mutated human IL-17A which is, e.g., at least 85, 90, 95, or 98% identical to SEQ ID NO:2 or 20), and the second polypeptide includes a modified IL- 17 polypeptide selected from the group consisting of IL-17A, IL-17B, IL-17C, IL- 17D, IL-17E, and IL-17F (e.g., a mutated human IL-17 cytokine which is, e.g., at least 85, 90, 95, or 98% identical to the natural mature forms of such cytokines, e.g., as disclosed herein) or a polypeptide 100% identical to a natural mature form (e.g., SEQ ID NO:2, 4, 6, 8, 10, 12, or 20).
- exemplary compositions include polypeptides corresponding to A/A homodimer, or an A/F heterodimer.
- the first polypeptide includes a modified IL-17F polypeptide (e.g., a mutated human IL-17F which is, e.g., at least 85, 90, 95, or 98%> identical to SEQ ID NO: 12), and the second polypeptide includes a modified IL-17 polypeptide selected from the group consisting of IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F (e.g., a mutated human IL-17 cytokine which is, e.g., at least 85, 90, 95, or 98%o identical to the natural mature forms of such cytokines, e.g., as disclosed herein) or a polypeptide 100% identical to a natural mature form (e.g., SEQ ID NO:2, 4, 6, 8, 10, 12, or 20).
- a modified IL-17F polypeptide e.g., a mutated human IL-17F which is, e.g., at least 85,
- compositions include polypeptides corresponding to F/F homodimer, or an A/F heterodimer.
- the first polypeptide includes a modified IL-17 cytokine polypeptide (e.g., a mutated human IL-17B, IL-17C, IL-17D, or IL-17E which is, e.g., at least 85, 90, 95% identical to SEQ ID NO:4, 6, 8, or 10), and the second IL-17 cytokine polypeptide (e.g., a mutated human IL-17B, IL-17C, IL-17D, or IL-17E which is, e.g., at least 85, 90, 95% identical to SEQ ID NO:4, 6, 8, or 10), and the second IL-17 cytokine polypeptide (e.g., a mutated human IL-17B, IL-17C, IL-17D, or IL-17E which is, e.g., at least 85, 90, 95% identical to SEQ ID NO
- polypeptide includes a modified IL-17 polypeptide selected from the group consisting of IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F (e.g., a mutated human IL- 17 cytokine which is, e.g., at least 85, 90, 95%> identical to the natural mature forms of such cytokines, e.g., as disclosed herein).
- exemplary compositions include polypeptides corresponding to B/B, C/C, D/D, E/E homodimer, and various heterodimers.
- the disclosure features a composition that includes an isolated polypeptide including an IL-17 binding determinant of IL-17RA, wherein the polypeptide is not identical to the extracellular domain of IL-17RA.
- the IL-17 binding determinant is selected from the group consisting of amino acids 22-36, 83-96, 118-147, 152-179, and 256-271 of IL-17RA (SEQ ID NO: 14).
- the binding determinant can be a peptide, e.g., a peptide that includes or consists of amino acids 22-36, 83-96, 118-147, 152-179, and 256-271 of IL-17RA.
- the binding determinant can be, e.g., an IL-17F, IL-17A, or IL-17C binding determinant.
- the polypeptide is capable of binding IL-17F and/or IL-17A.
- Binding of the polypeptide to IL-17A can include contacts with one or more amino acids selected from the group consisting of about 21-39, 40-76, 80-101, and 102-131 of the IL-17A.
- Binding of the polypeptide to IL-17C can include contacts with one or more amino acids selected from the group consisting of about 44-65, 78-117, 121-143, and 153- 179 of the IL-17C.
- the polypeptide is capable of forming a cysteine knot motif or a four-helix bundle motif.
- the polypeptide is operably bound to an IL-17RA polypeptide, e.g., an extracellular region of an IL-17RA polypeptide, and an IL-17RC polypeptide, e.g., an extracellular region of an IL-17RC polypeptide.
- the disclosure features a composition that includes an isolated polypeptide including an IL-17 binding determinant of IL-17RC, wherein the polypeptide is not identical to the extracellular domain of IL-17RC.
- the polypeptide can be operably bound to a binding partner selected from an IL-17RA polypeptide, e.g., an extracellular region of an IL-17RA polypeptide, and an IL-17RC polypeptide e.g., an extracellular region of an IL-17RC polypeptide.
- the polypeptide can bind to an IL-17 cytokine, e.g., to IL-17A and contact one or more amino acids selected from the group consisting of about 21-39, 40-76, 80-101, and 102-131 of the IL-17A, or IL- 17C and contact one or more of amino acids selected from the group consisting of about 44-65, 78-117, 121-143, and 153-179 of the IL-17C.
- the disclosure features an IL-17R binding protein that includes a first and second IL-17 subunit and wherein the subunits form a dimer comprising a first face that is able to interact with a first IL-17 receptor subunit and a second face that has reduced or no ability to interact with a second IL-17 receptor subunit relative to a corresponding natural IL-17 protein.
- the first and second subunits differ from one another.
- Each subunit can be at least 85, 87, 90, 92, 94, 95, 96, 97, or 98% identical to a mature IL-17 cytokine, e.g., a human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20) or a murine IL-17 cytokine, e.g., the same reference cytokine for both subunits or different reference cytokines (e.g., an IL- 17A and IL-17F).
- a mature IL-17 cytokine e.g., a human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20) or a murine IL-17 cytokine, e.g., the same reference cytokine for both subunits or different reference cytokines (e.g., an IL- 17A and IL-17F).
- each subunit is at least 85, 87, 90, 92, 94, 95, 96, 97, or 98% identical to a mature IL-17 cytokine in region corresponding to 1-127 of SEQ ID NO: 127 or 1-126 of SEQ ID NO:20.
- each subunit has one, two, three, four, five, six, seven or more substitutions or deletions relative to a mature human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20), preferably fewer than twelve, ten, nine, eight, seven, six, or five.
- one subunit has between one and five, seven, or eight mutations relative to a mature human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20) and the other subunit has a C-terminal deletion of at least one, two, three, four or five amino acids and optionally between one and five substitutions relative to a mature human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20).
- the second face of the dimer comprises at least one, two, or three mutations, e.g., at least one, two, or three substitutions.
- the second face of the dimer has one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve mutations (e.g., substitutions).
- the mutations can be located in one or more sites.
- the first face can be such that it does not contain any mutations relative to a mature IL-17 cytokine, e.g., a mature human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20).
- the second face of the dimer comprises at least one, two, or three mutations in Site 1, e.g., at least one, two, or three substitutions.
- the second face of the dimer has between one and three, four, five, or six mutations (e.g., substitutions) in Site 1.
- the second face of the dimer comprises at least one, two, or three mutations in Site 2, e.g., at least one, two, or three substitutions.
- the second face of the dimer has between one and three, four, five, or six mutations (e.g., substitutions) in Site 2.
- the second face of the dimer comprises at least one, two, or three mutations in Site 3, e.g., at least one, two, or three substitutions.
- the second face of the dimer has between one and three, four, five, or six mutations (e.g., substitutions) in Site 3.
- the first and second subunits can be covalently attached, e.g., they can be components of the same polypeptide chain. For example, they can be joined by a flexible linker.
- the binding protein has less than 1% of the cytokine activity of IL-17A/A.
- it does not substantially agonize IL-17 receptors, e.g., based on an assay described herein.
- the binding protein has an affinity for IL-17RA or IL- 17RC that is no more than 100-, 50-, 20, 10-fold weaker than IL-17A/A, IL-17F/F, or IL-17A/F.
- the binding protein cannot bind to both IL-17RA and IL-17RC to form a complex containing the binding protein and both IL-17RA and IL-17RC.
- the binding protein can have other features and properties described herein.
- a binding protein described herein can include two IL-17 subunits wherein each subunit is at least 85, 87, 90, 92, 94, 95, 96, 97, or 98% identical to a mature IL- 17 cytokine, e.g., a human IL-17 cytokine (SEQ ID NO:2, 4, 6, 8, 10, 12, or 20) and collectively the subunits includes at least two, three, four, five, or more of the following substitutions or deletions relative to such mature IL-17 polypeptide:
- N89A or N89V a substitution at the position corresponding to N89 (according to numbering in SEQ ID NO: 12) (e.g., N89A or N89V),
- the binding protein can have at least one or more of the following combinations (e.g., pairings) of mutations with respect to the positions indicated above: (R47, S65), (R47, W68), (R47, R102), (S65, W68), (S65, R102), (R47, N89), (R47, Q95), (N89, R102), (N89, deletion of 128-132), (R47, N89, R102), (N89, Q95), (W68, R102), (N89, W68), (R47, S65, N89), (R47, W68, N89), (R47, N89, R102), (R47, W68, N89, deletion of 128-132), (R47, S65, N89, deletion of 128- 132), (S65, N89, deletion of 128-132), (R47, S65, deletion of 128-132), and (N89, Q95, deletion of 128-132).
- the binding protein can have other features and properties described herein.
- nucleic acids that include sequences encoding the
- the nucleic acid can further include vector sequences, and transcriptional and translational control sequences. Also featured are host cells containing such nucleic acids, and methods that include expressing such nucleic acids, e.g., in a cell. The methods can further include recovering the protein, e.g., by purification from the cells or cell media.
- FIG. 1 is a schematic illustration of the structure of the IL-17RA-IL-17F complex.
- Ribbon diagram of IL-17RA in bound to IL-17F (chain A and chain B), N- linked glycans are shown in ball-and-stick representation.
- IL-17RA is composed of two fibronectin type III domains (Dl and D2) joined by a short helical linker. The right-hand panel shows the complex rotated by 60° around the y-axis.
- FIG. 2 is a schematic illustration demonstrating IL-17F binding to IL-17RA is mediated by three distinct interfaces.
- A Site 2, the IL- 17RA Dl C-C loop inserts between the N-terminal coil region and strands 1 and 2 of the IL-17F chain B. The N- terminal coil undergoes a conformational change between the unbound and bound conformations.
- B Site 2, surface representation of the knob-in-holes IL-17F binding pocket complementarity.
- C Site 1, the IL-17RA Dl N-terminal binding site.
- Site 3 the IL-17RA D2 binding site. Contact residues are shown as stick models. Dotted lines represent hydrogen bonds and salt-bridges.
- FIG. 3 is an assembly and model of the heterodimeric IL-17 signaling complex.
- A IL-17 receptor-cytokine affinity was measured by surface plasmon resonance (SPR).
- SPR surface plasmon resonance
- IL-17RA, IL- 17RB and IL-17RC were immobilized on the SPR chip surface, and the binding affinity of IL- 17A, IL-17F or IL-17E was measured. Where indicated, the affinity of a second receptor binding to the pre-assembled receptor-cytokine complex on the chip was then measured.
- SPR surface plasmon resonance
- representative SPR sensorgrams are shown as colored lines and the curve-fit as a black line. Time in seconds (s) is plotted against response (RU, resonance units). The injected concentrations are to the right of the sensorgrams.
- FIG. 4 is a schematic illustration demonstrating the binding interface and conserved IL- 17 residues.
- FIG. 5 is a comparison of the IL-17RA-IL-17F receptor complex compared to homodimeric cysteine-knot growth factor receptor complexes.
- A IL-17RA-IL-17F
- B P75NTR-NGF
- C TrkA-NGF are shown as ribbon models.
- the term "effective amount” as used herein refers to the amount necessary to elicit a desired biological response.
- the effective amount of a drug may vary depending on such factors as the desired biological endpoint, the drug to be delivered, the composition of any additional active or inactive ingredients, etc.
- expression is used herein to mean the process by which a polypeptide is produced from DNA. The process involves the transcription of the gene into mRNA and the translation of this mRNA into a polypeptide. Depending on the context in which it is used, “expression” may refer to the production of RNA, protein, or both.
- RNA for example, a messenger RNA (mRNA) or a micro RNA (miRNA)
- isolated refers to a molecule that is substantially pure.
- An isolated protein can be substantially pure, e.g., 60%, 65%, 70%, 75%, 80%>, 85%o, 90%o, 95%o or 99% free of other, different protein molecules.
- modulate and modulation generally refer to the downregulation (i.e., inhibition or suppression), of specifically targeted genes (including their RNA and/or protein products), signaling pathways, cells, and/or a targeted phenotype, or the upregulation (i.e., induction or increase) of the targeted genes.
- modulate and modulation can refer to downregulation of IL- 17 receptor signaling.
- Patient or “subject” means a mammal, e.g. a human, who has or is at risk for developing a disease or condition such as an inflammatory disease, or has or is diagnosed as having an inflammatory disease, or could otherwise benefit from the compositions and methods described herein.
- the term “reduce” as used herein refers to any inhibition, reduction, decrease, suppression, downregulation, or prevention in expression or gene product activity.
- the level of expression or activity can be, for example, 100% or less than 100%), for example, less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, less than 25%, less than 20%), less than 15%, less than 10%, or less than 5% of the uninhibited expression or activity.
- treating or “treatment” or “alleviation” or “amelioration” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- IL-17 receptor refers to proteins that bind to an IL-17 cytokine such as IL-17RA, IL-17RB, IL-17RC, IL-17RD, and IL-17RE receptors, particularly human isoforms of these receptors and extracellular domains of these receptors.
- sequence identity is calculated as follows.
- sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment).
- the optimal alignment is determined as the best score using the
- Needleman and Wunsch algorithm as implemented in the Needle algorithm of the EMBOSS package using a Blossum 62 scoring matrix with a gap penalty of 10, and a gap extend penalty of 1.
- T helper (T H ) cells have been typically considered to fall into one of two effector cell lineages; T H 1 and T H 2 cells modulating cellular and humoral T cell immunity, respectively, based on their cytokine expression profiles (1). More recent work described Thl7 cells, a third lineage of effector T H cells distinct from, and in fact antagonized by products of the Thl and Th2 lineages (2,3).
- Th cells Named after their signature cytokine interleukin 17 (IL- 17), this subset of Th cells appear to have evolved as an arm of the adaptive immune system specialized for enhanced host protection against extracellular bacteria and some fungi, as these microbes may not be effectively controlled by Thl or Th2 responses (4, 5).
- hematopoietic and non-hematopoietic cells have highlighted the complicated relationships that exist between adaptive and innate immune cells. While the full scope of Thl 7 cell effector functions is still emerging, the strong inflammatory response promoted by Thl 7 cells has been associated with the pathogenesis of a number of autoimmune and inflammatory disorders previously attributed to Thl or Th2 cells including rheumatoid arthritis, multiple sclerosis and psoriasis (4).
- members of the IL-17 family include IL-17B, IL-17C, IL-17D, IL-17E (also termed IL-25), and IL-17F. All members of the IL-17 family have a similar protein structure including four highly conserved cysteine residues.
- IL- 17A and F are most closely related followed by IL-17B (29%), IL-17D (25%), IL- 17C (23%), and IL-17E being most distantly related to IL-17A (17%).
- cytokines are all well conserved in mammals, with as much as 62-88% of amino acids conserved between the human and mouse homologs. There is no sequence similarity to other cytokines.
- IL-17A-IL-17F the six structurally related IL-17 cytokines (IL-17A-IL-17F) are predicted to form a homodimeric fold (or heterodimeric fold in the case of IL-17A-F) homologous to that of the cysteine -knot growth factors such as nerve growth factor (NGF) (7, 8).
- NGF nerve growth factor
- Thl7 cell-derived IL-17A and IL-17F share the greatest homology within the family and require both IL-17RA and IL-17RC for signaling (9, 10). While it has been shown that fibroblasts, epithelial and endothelial cells coexpress both IL-17RA and IL-17RC, T cells do not demonstrably express IL-17RC, and only express IL-17RA (1 1). It was thought that lymphocytes are not responsive to IL-17; however, Flavell and coworkers reported that T cells indeed can directly respond to IL-17 (12).
- the IL-17 family of cytokines in part through their actions as effector cytokines of the Thl7 lineage, provides innovative approaches to the manipulation of immune and inflammatory responses.
- antagonists of IL-17A, IL-17B, IL- 17C, IL-17D, IL-17E, IL-17F, and their receptors either singly or together, such as antagonists described herein, are useful in therapeutic treatment of inflammatory diseases such as multiple sclerosis, inflammatory bowel disease (IBD), rheumatoid arthritis, psoriasis, and cancer.
- antagonists of IL-17 family member activity such as antagonists described herein, are useful in therapeutic treatment of other inflammatory diseases.
- IL-17A An exemplary human IL-17A cytokine sequence is as follows and is described by UniProt identifier Q 16552 (see web resources at uniprot.org and The UniProt Consortium, Nucleic Acids Res. D142-D148 (2010)): MTPGKTSLVS LLLLLSLEAI VKAGITIPRN PGCPNSEDKN FPRTVMVNLNIHNRNTNTNP KRSSDYYNRS TSPWNLHRNE DPERYPSVIW EAKCRHLGCINADGNVDYHM NSVPIQQEIL VLRREPPHCP NSFRLEKILV SVGCTCVTPIVHHVA (SEQ ID NO: l) Another exemplary sequence includes amino acids 24-155 of the sequence above, forms lacking the IL-17A signal sequence, or the sequence shown in Fig.
- the sequence can also include a glycine preceding the first residue of SEQ ID NO:2.
- Each IL-17A sequence described herein with reference to SEQ ID NO:2 can also include this glycine that precedes the isoleucine that is the first listed amino acid in SEQ ID NO:2.
- Other residues can also be used.
- Other exemplary IL-17A sequences include murine (Q62386), rat (Q61453) and bovine sequences (Q687Y7). Mutations and modifications described herein can be made in IL-17A sequences from any species, e.g., as described herein.
- IL-17B An exemplary human IL-17B cytokine sequence is as follows and is described by Uniprot identifier Q9UHF5:
- Another exemplary sequence includes amino acids 21-180 of the sequence above, forms lacking the IL-17B signal sequence, or the sequence shown in Fig. 4D:
- IL-17C An exemplary IL-17C cytokine sequence is as follows and is described by Uniprot identifier Q9P0M4:
- Another exemplary sequence includes amino acids 19-197 of the sequence above, forms lacking the IL-17C signal sequence, or the sequence shown in Fig. 4D:
- IL-17D An exemplary IL-17D cytokine sequence is as follows and is described by Uniprot Identifier Q8TAD2:
- Another exemplary sequence includes amino acids 16-202 of the sequence above, forms lacking the IL-17D signal sequence, or the sequence shown in Fig.
- IL-17E An exemplary IL-17E cytokine sequence (also termed IL-25) is as follows and is described by Uniprot Identifier Q9H293:
- Another exemplary sequence includes amino acids 33-177 of the sequence above, forms lacking the IL-17E signal sequence, or the sequence shown in Fig. 4D: THTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPL NSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLY HNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG (SEQ ID NO: 10).
- IL-17F An exemplary IL-17F cytokine sequence is as follows and is described by Uniprot Identifier Q96PD4:
- IL-17A The sequences of several other mammalian IL-17 cytokines are also known. See, e.g., Uniprot entries: Q62386 (murine IL-17A), Q61453 (rat IL-17A), Q687Y7 (bovine IL-17A), Q7TNI7 (murine IL-17F), Q5BJ95 (rat IL-17F), Q9QXT6 (murine IL-17B), Q9EQI6 (hamster IL-17B), Q8K4C5 (murine IL-17C), Q8K4C4 (murine IL- 17D), and Q9VHH8 (murine IL-17E).
- IL-17RA An exemplary human IL-17RA receptor sequence is as follows and is described by UniProt identifier Q96F46:
- an IL-17RA polypeptide in which the signal sequence is removed (e.g., processed) or in which amino acids 1-31 or 1-32 are deleted, and optionally other deletions, insertions and substitutions.
- An exemplary IL-17RA polypeptide is as follows:
- Another exemplary IL-17RA polypeptide includes the extracellular domain of IL-17RA, e.g., about amino acids 33-320 of SEQ ID NO: 13.
- Other exemplary IL- 17RA sequences include murine (Q60943), rat (NP 001101353.2, GenBank) and bovine sequences (XP 603383.5, GenBank).
- IL-17RB An exemplary human IL-17RB receptor sequence is as follows and has a Q9NRM6 UniProt identifier:
- IL-17RB polypeptide in which the signal sequence is removed (e.g., processed) or in which amino acids 1-17 are deleted, and optionally other deletions, insertions and substitutions.
- Another exemplary IL-17RB polypeptide includes the extracellular domain of IL-17RB, e.g., about amino acids 18-292 of Q9NRM6.
- IL-17RC An exemplary human IL-17RC receptor sequence is as follows and has a Q8NAC3 UniProt identifier:
- IL-17RC polypeptide in which the signal sequence is removed (e.g., processed) or in which amino acids 1-20 are deleted, and optionally other deletions, insertions and substitutions.
- Another exemplary IL-17RC is also provided.
- polypeptide includes the extracellular domain of IL-17RC, e.g., about amino acids 21- 538 of SEQ ID NO: 14.
- Other exemplary IL-17RC sequences include murine
- IL-17RD An exemplary human IL-17RD receptor sequence is described by Uniprot identifier Q8NFM7. See also Xiong et al, J. Biol. Chem. 278:50273-50282 (2003). Also provided is an IL-17RD polypeptide in which the signal sequence is removed (e.g., processed) or in which amino acids 1-16 are deleted, and optionally other deletions, insertions and substitutions. Another exemplary IL-17RD
- polypeptide includes the extracellular domain of IL-17RD, e.g., about amino acids 17- 299 of Q8NFM7.
- IL-17RE An exemplary human IL-17RE receptor sequence is described by UniProt identifier Q8NFR9. Also provided is an IL-17RE polypeptide in which the signal sequence is removed (e.g., processed) or in which amino acids 1-23 are deleted, and optionally other deletions, insertions and substitutions. Another exemplary IL- 17RE polypeptide includes the extracellular domain of IL-17RE, e.g., about amino acids 24-454 of Q8NFR9.
- the present invention provides novel antagonists of IL-17 receptor signaling, e.g., antagonists of one or more of IL-17RA, IL-17RB, IL-17RC, IL-17RD, and IL- 17RE signaling, and the use of such antagonists in the treatment of inflammatory diseases and autoimmune diseases.
- the present invention further provides novel antagonists of IL-17 cytokine signaling, e.g., IL-17A, IL-17B, IL-17C, IL-17D, IL- 17E, and IL-17F signaling, and their uses in the treatment of inflammatory disease and autoimmune disease.
- the antagonists of the present invention can be used to block, inhibit, reduce, antagonize or neutralize the activity of IL-17A, IL-17F, or IL-17A/F or any combination therein in the treatment of inflammation and inflammatory diseases such as multiple sclerosis, cancer (particularly as characterized by the expression of IL-17 and/or IL-23), psoriasis, psoriatic arthritis, rheumatoid arthritis, autoimmune ocular diseases, endotoxemia, IBS, and inflammatory bowel disease (IBD), colitis, asthma, COPD, cystic fibrosis, allograft rejection, immune mediated renal diseases, hepatobiliary diseases, atherosclerosis, promotion of tumor growth, or degenerative joint disease, atherosclerosis, and other inflammatory conditions disclosed herein.
- inflammation and inflammatory diseases such as multiple sclerosis, cancer (particularly as characterized by the expression of IL-17 and/or IL-23), psoriasis, psoriatic arthritis,
- the present invention provides isolated polypeptides that bind to the contact surfaces of IL-17 ligands and/or receptors, thereby preventing their productive interaction. More specifically, the present invention provides polypeptides that bind to IL-17 ligands and/or receptors and inhibit the production of an inflammatory mediator in a cell expressing IL-17 receptors.
- IL-17RA-IL-17RE The five IL-17 receptors (IL-17RA-IL-17RE) are not homologous to any known receptors, and exhibit considerable sequence divergence. All appear to contain extracellular domains composed of fibronectin type-Ill (Fnlll) domains, and cytoplasmic SEF/IL-17R (SEFIR) domains that show loose homology to Toll/IL-IR (TLR) domains (13,14).
- Fnlll fibronectin type-Ill
- SEFIR cytoplasmic SEF/IL-17R
- TLR Toll/IL-IR
- the IL-17 receptors mediate signaling events that are distinct from those triggered by the more widely known receptors for type I four helix cytokines (15, 16). Like TLR stimulation, IL-17 receptor stimulation results in activation of NF- ⁇ and mitogen-activated protein kinases (MAPK).
- MAPK mitogen-activated protein kinases
- IL-17 receptor signaling does not utilize the same set of membrane proximal adaptor molecules as TLR signaling; IL-17R requires the adaptor Actl which also contains a SEFIR domain (17-19). These unique signaling properties of IL-17 receptors enable T H -17 cells to act as a bridge between innate and adaptive immune cells.
- FRET fluorescence resonance energy transfer
- Preferred embodiments of the invention include binding peptides, proteins, and any fragments or permutations thereof that bind to an IL-17R or an IL-17 cytokine referred to interchangeably as "IL-17R antagonists", “IL-17 antagonists”, “IL-17R neutralizing entities”, “IL-17R designer cytokine antagonists”, and “IL-17 designer cytokine antagonists.”
- IL-17R antagonists IL-17 antagonists
- IL-17R neutralizing entities IL-17R designer cytokine antagonists
- IL-17 designer cytokine antagonists IL-17 designer cytokine antagonists
- IL-17 designer cytokine antagonists IL-17 designer cytokine antagonists
- binding peptides or proteins are capable of specifically binding to a human IL-17R and are referred to as "IL-17R binding proteins.”
- these binding peptides or proteins are capable of modulating biological activities associated with IL-17, e.g., antagonizing IL-17 activation of an IL-17 receptor, and thus are
- the invention concerns an isolated polynucleotide that encodes a polypeptide of the present invention, wherein said polypeptide is capable of binding to IL-17R, e.g., IL-17RA, IL-17RB, IL-17RC, IL-17RD, or IL- 17RE, and reducing its signaling capability.
- IL-17R e.g., IL-17RA, IL-17RB, IL-17RC, IL-17RD, or IL- 17RE
- the present invention also provides fusion proteins, comprising an antagonist of the present invention and an immunoglobulin moiety, e.g., an immunoglobulin domain or region.
- the immunoglobulin moiety may be an immunoglobulin heavy chain constant region, such as a human F c fragment.
- the present invention further includes isolated nucleic acid molecules that encode such fusion proteins.
- the present invention also provides protein conjugates comprising an antagonist of the present invention conjugated to a polymer of polyethylene glycol.
- the present invention further includes pharmaceutical compositions, comprising a pharmaceutically acceptable carrier and an IL-17R antagonist described herein.
- the invention concerns a method for the treatment of an inflammatory disease characterized by elevated expression of IL-17 and/or IL-23 and/or IFN- ⁇ in a mammalian subject, comprising administering to the subject an effective amount of an antagonist of IL-17 signaling.
- the invention concerns a method for inhibiting the production of an inflammatory mediator in a mammalian cell by treating the cell or its media with an antagonist of IL-17R.
- the invention concerns a method for the treatment of an inflammatory disease characterized by elevated expression of IL-17 and/or IL-23 and/or IFN- ⁇ in a mammalian subject, comprising administering to the subject an effective amount of an antagonist of IL-17 signaling.
- Typical methods of the invention include methods to treat pathological conditions or diseases in mammals associated with or resulting from increased or enhanced IL-17 and/or IL-23 and/or IFN- ⁇ expression and/or activity.
- the antagonists of the present invention may be administered which preferably reduce the respective receptor activation.
- the methods contemplate the use of an antagonist of IL-17R that reduces signaling by blocking IL-17R complex formation.
- Antagonists of the present invention are also useful to prepare medicines and medicaments for the treatment of immune-related and inflammatory diseases, including for example, systemic lupus erythematosis, arthritis, rheumatoid arthritis, osteoarthritis, psoriasis, demyelinating diseases of the central and peripheral nervous systems such as multiple sclerosis, idiopathic demyelinating polyneuropathy or Guillain-Barre syndrome, inflammatory bowel disease, colitis, ulcerative colitis, Crohn's disease, gluten-sensitive enteropathy, autoimmune ocular diseases, cancer, neoplastic diseases, atherosclerosis, and angiogenesis.
- systemic lupus erythematosis arthritis
- rheumatoid arthritis osteoarthritis
- psoriasis demyelinating diseases of the central and peripheral nervous systems
- demyelinating diseases of the central and peripheral nervous systems such as multiple sclerosis, idiopathic demyelinating polyn
- such medicines and medicaments comprise a
- the admixture is sterile.
- the invention concerns a method for inhibiting IL- 17 production and/or maintenance by treating the T cells with an IL-17R antagonist.
- the invention provides a method of decreasing the activity of T-lymphocytes in a mammal comprising administering to said mammal an IL-17R antagonist, such as an IL-17R binding protein that comprises a sequence homologous to an IL-17 cytokine sequence, wherein the activity of T-lymphocytes in the mammal is decreased.
- an IL-17R antagonist such as an IL-17R binding protein that comprises a sequence homologous to an IL-17 cytokine sequence
- the invention provides a method of decreasing the proliferation of T-lymphocytes in a mammal comprising administering to said mammal an IL-17R antagonist, such as an IL-17R binding protein that comprises a sequence homologous to an IL-17 cytokine sequence, wherein the proliferation of T- lymphocytes in the mammal is decreased.
- an IL-17R antagonist such as an IL-17R binding protein that comprises a sequence homologous to an IL-17 cytokine sequence
- Processes for producing the same are also herein described, wherein those processes comprise culturing a host cell comprising a vector which contains the appropriate encoding nucleic acid molecule under conditions suitable for expression of said antibody and recovering said antibody from the cell culture.
- An IL-17 cytokine can include at least three sites that contact an IL-17R on one of its receptor binding faces.
- the IL-17 generally includes two subunits (here designated Chain A and B), each contributing amino acids to a particular receptor binding face.
- Chain A and B subunits
- the use of the terms “Chain A” and “Chain B” is merely for reference.
- “Chain A” may be placed C-terminal to "Chain B” and alternatively it may be place N-terminal to "Chain B.”
- the IL-17 interface that binds IL-17RA includes three sites (Site 1, Site 2, and Site3) which include the following contact residues as shown in Table 1 (according to the numbering of IL-17F and SEQ ID NO: 12):
- this disclosure features an IL-17R binding protein that comprises an IL-17 cytokine including two subunits wherein one receptor binding face of the dimer formed by the two subunits includes one or more substitutions, e.g., at least two or three substitutions, e.g., non-conservative substitutions or a
- the cytokine has at least one, two, three, four, five, six, or seven substitutions (or deletions) at the positions identified in Table 1 above, e.g. between two to ten, two- seven, or three to ten, or three to six.
- one cytokine subunit differs from the other subunit at at least one, two, three, four, five, six, or seven substitutions (or deletions).
- the two receptor binding faces can include different amino acids, e.g., at least one, two, three, four, five, six, or seven differences, e.g., at positions corresponding to those in Table 1.
- One or both the subunits can have one or more conservative and/or one or more non-conservative substitutions.
- at least one subunit or both subunits are at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to a mature human IL-17, e.g., SEQ ID NO:2, 4, 6, 8, 10, 12, or 20.
- neither subunits is 100% identical to a mature human IL-17, e.g., they differ by at least one, two, or three amino acids from the human IL-17 from which they were derived.
- one subunit differs a mature human IL-17, whereas the other subunit is identical to a mature human IL-17.
- the subunit or both subunits are at least 90, 92, 94, 95, 96, 97, or 98% identical, but not 100% identical to a mature human IL-17, e.g., SEQ ID NO:2, 4, 6, 8, 10, 12, or 20.
- neither subunits is 100% identical
- substitutions in a subunit are not to residues in a corresponding murine protein.
- an IL-17R binding protein comprises an IL-17 cytokine including two subunits in which Site 1 of one receptor binding face includes one or more mutations, e.g., at least two or three mutations, e.g., non-conservative mutations or a mutation described herein.
- the binding protein includes at least one mutation in one of the foregoing Chain A residues of Site 1 and at least one mutation in one of the foregoing Chain B residues.
- Some exemplary mutations that can be made in Site 1 include:
- MET25 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- MET25 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- MET25 is mutated to Trp or Tyr.
- MET25 can be mutated to disrupt hydrophobic packing near the surface, e.g., by mutation to a charged residue or to a bulky aromatic.
- VAL23 of SEQ ID NO:2 ARG36 of SEQ ID NO:4, LEU48 of SEQ ID NO:6, LEU36 of SEQ ID NO:8, and LEU33 of SEQ ID NO: 10.
- ILE29 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ILE29 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to ILE27 of SEQ ID NO:2.
- ILE31 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ILE31 is mutated to a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non- conservative mutations can be made to ASN29 of SEQ ID NO:2.
- TRP58 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- TRP58 is mutated to a small aliphatic residue.
- Corresponding or non-conservative mutations can be made to GLU56 of SEQ ID NO:2, HIS85 of SEQ ID NO:4, THR97 of SEQ ID NO:6, TYR85 of SEQ ID NO:8, and ARG67 of SEQ ID NO: 10.
- ASN61 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ASN61 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non- conservative mutations can be made to GLU59 of SEQ ID NO:2, SER88 of SEQ ID NO:4, ASP100 of SEQ ID NO:6, ALA88 of SEQ ID NO:8, and ASN70 of SEQ ID NO: 10.
- TYR63 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- TYR63 is mutated to an aliphatic residue, a neutral hydrophilic residue, or a charged residue.
- TYR63 is mutated to Ala or Lys.
- Corresponding or non-conservative mutations can be made to TYR61 of SEQ ID NO:2, ILE90 of SEQ ID NO:4, TYR102 of SEQ ID NO:6, TYR90 of SEQ ID NO:8, and LEU72 of SEQ ID NO: 10.
- PR064 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- PR064 is mutated to glycine, an aliphatic residue, a neutral hydrophilic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to PR062 of SEQ ID NO:2, PR091 of SEQ ID NO:4, PRO103 of SEQ ID NO:6, PR091 of SEQ ID NO:8, and PR073 of SEQ ID NO:10.
- SER65 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- SER65 is mutated to an aliphatic residue, particularly a large aliphatic residue, a charged residue, or an aromatic residue.
- SER65 is mutated to Lys or Trp.
- Corresponding or non- conservative mutations can be made to SER63 of SEQ ID NO:2, VAL92 of SEQ ID NO:4, GLN104 of SEQ ID NO:6, ARG92 of SEQ ID NO:8, and GLN74 of SEQ ID NO: 10.
- VAL100 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL100 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to LEU98 of SEQ ID NO:2, ARG128 of SEQ ID NO:4, LEU140 of SEQ ID NO:6, LEU128 of SEQ ID NO:8, and PHEl 11 of SEQ ID NO: 10.
- ARG102 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ARG102 is mutated to an aliphatic residue, a neutral hydrophilic residue, an acidic residue, or an aromatic residue.
- ARG102 is mutated to Ala, Ser, Gin, or Asn.
- Corresponding mutations can be made to ARG100 of SEQ ID NO:2, ARG130 of SEQ ID NO:4, ARG142 of SEQ ID NO:6, ARG130 of SEQ ID NO:8, and ARG113 of SEQ ID NO: 10.
- HIS 104 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- HIS 104 is mutated to an aliphatic residue or an acidic residue.
- HIS 104 is mutated to Glu or Asp.
- VAL109 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL109 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- PHEl 1 1 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- PHEl 11 is mutated to a small aliphatic residue, a neutral hydrophilic residue, or a charged residue.
- PHEl 11 is mutated to Ala.
- Corresponding or non-conservative mutations can be made to PHE109 of SEQ ID NO:2, GLN143 of SEQ ID NO:4, PHE160 of SEQ ID NO:6, TYR141 of SEQ ID NO:8, and LEU128 of SEQ ID NO: 10.
- GLU66 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLU66 is mutated to an aliphatic residue, a neutral hydrophilic residue, a basic residue, or an aromatic residue.
- a mutation is made to disrupt hydrogen bonding by GLU66.
- Corresponding or non-conservative mutations can be made to VAL64 of SEQ ID NO:2, ASP93 of SEQ ID NO:4, LYS105 of SEQ ID NO:6, TYR93 of SEQ ID NO:8, and ASP75 of SEQ ID NO: 10.
- LYS115 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- LYS115 is mutated to an aliphatic residue, a neutral hydrophilic residue, an acidic residue, or an aromatic residue.
- LYS115 is mutated to Ala.
- Corresponding or non-conservative mutations can be made to LYS113 of SEQ ID NO:2, MET 147 of SEQ ID NO:4, PHE164 of SEQ ID NO:6, TYR145 of SEQ ID NO:8, and LEU132 of SEQ ID NO: 10.
- an IL-17R binding protein comprises an IL-17 cytokine including two subunits in which Site 2 of one receptor binding face includes one or more mutations, e.g., at least two or three mutations, e.g., non-conservative mutations or a mutation described herein.
- the binding protein includes at least one mutation in one of the foregoing Chain A residues of Site 2 and at least one mutation in one of the foregoing Chain B residues.
- Some exemplary mutations that can be made in Site 2 include:
- GLN36 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLN36 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- GLN36 is mutated to disrupt hydrogen bonding by this residue.
- Corresponding or non-conservative mutations can be made to THR34 of SEQ ID NO:2, MET47 of SEQ ID NO:4, GLY59 of SEQ ID NO:6, PR047 of SEQ ID NO:8, and SER44 of SEQ ID NO: 10.
- ARG37 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ARG37 is mutated to an aliphatic residue, a neutral hydrophilic residue, an acidic residue, or an aromatic residue.
- ARG37 is mutated to Ala or Glu.
- Corresponding or non-conservative mutations can be made to ASN35 of SEQ ID NO:2, VAL48 of SEQ ID NO:4, ARG60 of SEQ ID NO:6, ARG48 of SEQ ID NO:8, and CYS45 of SEQ ID NO: 10.
- MET40 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- MET40 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to ARG38 of SEQ ID NO:2, LEU51 of SEQ ID NO:4, ARG63 of SEQ ID NO:6, ALA51 of SEQ ID NO:8, and SER48 of SEQ ID NO: 10.
- ARG38 of SEQ ID NO:2 and ARG63 of SEQ ID NO:6 can be mutated to Glu, Asp, Gin, Asn, Thr, or Ser or to another residue that disrupts its ability to hydrogen bond or form salt bridges.
- SER41 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- SER41 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- SER41 is mutated to Ala, Trp, Tyr, Arg or Lys.
- Corresponding or non-conservative mutations can be made to SER39 of SEQ ID NO:2.
- ASN43 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ASN43 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- ASN43 is mutated to Glu or Asp.
- Corresponding or non-conservative mutations can be made to ASP41 of SEQ ID NO:2, MET70 of SEQ ID NO:4, ASP82 of SEQ ID NO:6, PRO70 of SEQ ID NO:8, and PR052 of SEQ ID NO: 10.
- ASP41 of SEQ ID NO:2 can be mutated to He, Leu, Tyr, Arg or Lys.
- GLU45 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLU45 is mutated to an aliphatic residue or an aromatic residue.
- Corresponding or non-conservative mutations can be made to TYR43 of SEQ ID NO:2, ASN72 of SEQ ID NO:4, HIS84 of SEQ ID NO:6, ASN72 of SEQ ID NO:8, and ASN54 of SEQ ID NO: 10.
- TYR54 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- TYR54 is mutated to an aliphatic residue, a neutral hydrophilic residue, or a charged residue.
- Corresponding or non- conservative mutations can be made to LEU52 of SEQ ID NO:2, TYR81 of SEQ ID NO:4, TYR93 of SEQ ID NO:6, TYR81 of SEQ ID NO:8, and TYR63 of SEQ ID NO: 10.
- VAL56 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL56 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to ARG54 of SEQ ID NO:2, ILE83 of SEQ ID NO:4, VAL95 of SEQ ID NO:6, ILE83 of SEQ ID NO:8, and LEU65 of SEQ ID NO: 10.
- VAL68 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL68 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- VAL68 is mutated to Gin, Asn, Ser, or Thr.
- Corresponding or non-conservative mutations can be made to TRP66 of SEQ ID NO:2, PR095 of SEQ ID NO:4, ALA107 of SEQ ID NO:6, PR095 of SEQ ID NO:8, and TYR77 of SEQ ID NO: 10.
- GLN94 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLN94 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non- conservative mutations can be made to GLN92 of SEQ ID NO:2, PHE122 of SEQ ID NO:4, LEU134 of SEQ ID NO:6, TYR122 of SEQ ID NO:8, and TYR105 of SEQ ID NO: 10.
- GLN95 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLN95 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- GLN95 is mutated to Asp, Glu, Ala or Trp.
- Corresponding or non-conservative mutations can be made to GLN93 of SEQ ID NO:2, SER123 of SEQ ID NO:4, GLN135 of SEQ ID NO:6, MET123 of SEQ ID NO:8, and HIS106 of SEQ ID NO: 10.
- GLU96 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- GLU96 is mutated to an aliphatic residue, a basic residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to GLU94 of SEQ ID NO:2, GLN124 of SEQ ID NO:4, SER136 of SEQ ID NO:6, PR0124 of SEQ ID NO:8, and ASN107 of SEQ ID NO: 10.
- LEU117 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- LEU117 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to LEU115 of SEQ ID NO:2, THR149 of SEQ ID NO:4, HIS 166 of SEQ ID NO:6, THR147 of SEQ ID NO:8, and ARG134 of SEQ ID NO: 10.
- VAL118 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL118 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to VAL116 of SEQ ID NO:2, ILE150 of SEQ ID NO:4, VAL167 of SEQ ID NO:6, ILE148 of SEQ ID NO:8, and VAL135 of SEQ ID NO: 10.
- LYS37 of SEQ ID NO:2 can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- it can be mutated to Glu, Asp, Gin, Asn, Thr, or Ser or to another residue that disrupts its ability to hydrogen bond or form salt bridges.
- ARG30 of SEQ ID NO:2 and ARG40 of SEQ ID NO: 10 can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- it can be mutated to Glu, Asp, Gin, Asn, Thr, or Ser or to another residue that disrupts its ability to hydrogen bond or form salt bridges.
- an IL-17R binding protein comprises an IL-17 cytokine including two subunits in which Site 3 of one receptor binding face includes one or more mutations, e.g., at least two or three mutations, e.g., non-conservative mutations or a mutation described herein.
- one or more of the following Site 3 residues are mutated: Chain A: LEU75, ILE86, SER87, ASN89, VAL91, VAL125, PR0127, VAL128, ILE129, HIS130, HIS131, and VAL132, and/or Chain A can be truncated at a residue preceding VAL125, THR126, PR0127, VAL128, ILE129, HIS130, HIS131, or VAL132; and Chain B: MET40, ARG42, ILE44, and ARG47, and corresponding residues in IL-17A, IL-17B, IL-17C, IL-17D, and IL-17E as shown in Fig 4D.
- the binding protein includes at least one mutation in one of the foregoing Chain A residues of Site 3 and at least one mutation in one of the foregoing Chain B residues.
- ARG42 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ARG42 is mutated to an aliphatic residue, a neutral hydrophilic residue, an acidic residue, or an aromatic residue.
- ARG42 is mutated to Glu, Asp, Trp, or Ala.
- Corresponding or non- conservative mutations can be made to SER40 of SEQ ID NO:2, TRP69 of SEQ ID NO:4, ALA81 of SEQ ID NO:6, PR069 of SEQ ID NO:8, and GLY51 of SEQ ID NO: 10.
- ILE44 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ILE44 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to TYR42 of SEQ ID NO:2, SER71 of SEQ ID NO:4, THR83 of SEQ ID NO:6, THR71 of SEQ ID NO:8, and LEU53 of SEQ ID NO: 10.
- ARG47 in Chain B can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ARG47 is mutated to an aliphatic residue, a neutral hydrophilic residue, an acidic residue, or an aromatic residue.
- ARG47 is mutated to Glu, Asp, Gin, or Asn.
- Corresponding or non- conservative mutations can be made to ARG45 of SEQ ID NO:2, ARG74 of SEQ ID NO:4, ARG86 of SEQ ID NO:6, ARG74 of SEQ ID NO:8, and ARG56 of SEQ ID NO: 10.
- LEU75 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- LEU75 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to LEU73 of SEQ ID NO:2, LEU102 of SEQ ID NO:4, ARG114 of SEQ ID NO:6, ARG102 of SEQ ID NO:8, and PR084 of SEQ ID NO: 10.
- ILE86 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ILE86 is mutated to a neutral hydrophilic residue, a small aliphatic residue, or a charged residue.
- Corresponding or non-conservative mutations can be made to TYR84 of SEQ ID NO:2, ARG114 of SEQ ID NO:4, ALA126 of SEQ ID NO:6, VALl 14 of SEQ ID NO:8, and PR097 of SEQ ID NO: 10.
- SER87 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- SER87 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non- conservative mutations can be made to HIS85 of SEQ ID NO:2, SER115 of SEQ ID NO:4, ALA127 of SEQ ID NO:6, ARG115 of SEQ ID NO:8, and ARG98 of SEQ ID NO: 10.
- ASN89 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ASN89 is mutated to an aliphatic residue, a charged residue, or an aromatic residue.
- ASN89 is mutated to Ala.
- Corresponding or non-conservative mutations can be made to ASN87 of SEQ ID NO:2, VAL117 of SEQ ID NO:4, ASN129 of SEQ ID NO:6, ARG117 of SEQ ID NO:8, and ASN100 of SEQ ID NO: 10.
- VAL91 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL91 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- VAL91 is mutated to Asp or Glu.
- Corresponding or non- conservative mutations can be made to VAL89 of SEQ ID NO:2, VAL119 of SEQ ID NO:4, VAL131 of SEQ ID NO:6, ALA119 of SEQ ID NO:8, and GLU102 of SEQ ID NO: 10.
- VAL125 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL125 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- Corresponding or non-conservative mutations can be made to VAL123 of SEQ ID NO:2, ILE157 of SEQ ID NO:4, VAL174 of SEQ ID NO:6, VAL155 of SEQ ID NO:8, and VAL142 of SEQ ID NO: 10.
- PR0127 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- PRO 127 is mutated to an aliphatic residue, a neutral hydrophilic residue, a charged residue, or an aromatic residue.
- PRO 127 is deleted.
- Corresponding or non-conservative mutations can be made to PR0125 of SEQ ID NO:2, PR0176 of SEQ ID NO:6, GLU157 of SEQ ID NO:8, and PR0144 of SEQ ID NO: 10.
- VAL128 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL128 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- VAL128 is deleted.
- Corresponding or non-conservative mutations can be made to ILE126 of SEQ ID NO:2, ARG177 of SEQ ID NO:6, PR0158 of SEQ ID NO:8, and ARG145 of SEQ ID NO: 10.
- ILE129 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- ILE129 is mutated to a neutral hydrophilic residue, a small aliphatic residue, a charged residue, or an aromatic residue.
- ILE129 is deleted.
- Corresponding or non-conservative mutations can be made to VAL127 of SEQ ID NO:2, SER178 of SEQ ID NO:6, GLU159 of SEQ ID NO:8, and VAL146 of SEQ ID NO: 10.
- HIS 130 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- HIS 130 is mutated to an aliphatic residue or an acidic residue.
- HIS 130 is deleted.
- Corresponding or non-conservative mutations can be made to HIS 128 of SEQ ID NO:2, VAL179 of SEQ ID NO:6, LYS160 of SEQ ID NO:8, and MET147 of SEQ ID NO: 10.
- HIS 131 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- HIS 131 is mutated to an aliphatic residue or an acidic residue.
- HIS131 is deleted.
- Corresponding or non-conservative mutations can be made to HIS 129 of SEQ ID NO:2, ASP161 of SEQ ID NO : 8 , and GLY 148 of SEQ ID NO : 10.
- VAL132 in Chain A can be mutated to another amino acid, e.g., alanine or an amino acid other than alanine.
- VAL132 is mutated to a neutral hydrophilic residue, a large aliphatic residue, a charged residue, or an aromatic residue.
- VAL132 is deleted.
- Corresponding or non-conservative mutations can be made to VAL130 of SEQ ID NO:2, and ALA162 of SEQ ID NO:8.
- the cytokine subunit can contain one or more deletions, e.g., at least two, three, four, or five between the following residues and the natural C-terminus of the subunit: PR0127 in SEQ ID NO: 12, PR0125 of SEQ ID NO:2, PR0176 of SEQ ID NO:6, GLU157 of SEQ ID NO:8, and PR0144 of SEQ ID NO: 10.
- the cytokine subunit is truncated immediately after one of the forgoing positions or one, two, or three residues away from such position.
- the polypeptide containing the cytokine subunit can terminate at such truncation, or alternatively can include other exogenous sequences (such as a polypeptide tag) fused to the terminus of the truncated cytokine subunit.
- Exemplary IL-17R binding proteins include a plurality of mutations, for example: • at least one, two, or three substitutions in Site 1 and at least one, two or three substitutions in Site 2;
- Exemplary IL-17R binding proteins include a plurality of substitutions and/or deletions in an IL-17 cytokine.
- an IL-17 binding protein can include at least two, three or four of the following features (according to the numbering in SEQ ID NO: 12): (i) substitutions in Chain A at R47, (ii) substitutions in Chain A at S65, (iii) substitutions in Chain A at W68, (iv) substitutions in Chain A at R102,(v) substitutions in Chain B at N89, and (vi) deletion of at least two C-terminal residues of SEQ ID NO: 12 or at least two, three, four, or five residues corresponding to 127- 132 of SEQ ID NO: 12.
- the protein can have still other features described herein.
- exemplary mutated IL-17 cytokine sequences are listed in Examples 24- 27. Sequences that are at least 85, 90, 92, 94, 96, 98, or 99% identical to such sequences and that include substitutions at the same positions as such sequences may also be used.
- IL-17E 10 ALA57, ILE58, SER59, PRO60, TRP61, ARG71, ALA79,
- an IL-17R binding protein is used to detect an IL-17R, e.g., on the surface of a cell, in a sample, or in a patient.
- the IL-17R binding protein can bind to and detect the IL-17R on the cell without agonizing the receptor.
- the IL-17R binding protein can be labeled.
- an IL-17R binding protein is used as a receptor antagonist, e.g., to bind to an IL-17 receptor subunit and prevent receptor
- Polypeptides described herein can be modified in a variety of ways including substitution, deletion, or addition.
- a substitution entails the replacement of one amino acid for another.
- Such replacements can be made using any one of the twenty amino acids directly encoded by the genetic code: alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan tyrosine, and valine.
- amino acids of a polypeptide can be replaced using amino acids not directly encoded by the genetic code for example: selenocysteine, pyrrolysine, p-nitrophenylalanine, p-sulfotyrosine, p-carboxyphenylalanine, o- nitrophenylalanine, 5-nitro His, 3-nitro Tyr, 2-nitro Tyr, nitro substituted Leu, nitro substituted His, nitro substituted He, nitro substituted Trp, 2-nitro Trp, 4-nitro Trp, 5- nitro Trp, 6-nitro Trp, 7-nitro Trp, aminotyrosines, and carboxypheny alanines.
- Conservative amino acid substitutions can frequently be made in a protein without altering either the conformation or the function of the protein. Substitutions can be chosen based on their potential effect on (a) backbone structure in the vicinity of the substitution, for example, a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the volume and branching of the side chain.
- Amino acid residues can be classified based on side-chain properties: (1) aliphatic: ala, met, val, leu, ile; (2) small aliphatic: ala, val; (3) large aliphatic: met, leu, ile; (4) neutral hydrophilic: ser, thr; asn; gin; (5) acidic: asp, glu; (6) basic: his, lys, arg; (7) charged: arg, asp, glu, his, lys; (8) residues that affect backbone conformation: gly, pro; and (9) aromatic: trp, tyr, phe.
- Non-conservative substitutions can include substituting a member of one of these classes for a member of a different class or making a substitution not identified in the table below.
- Conservative substitutions can include substituting a member of one of these classes for another member of the same class.
- mutations are not made to Cys.
- heterodimers of two cytokine subunits described herein include heterodimers of two different sequence variants of IL-17A, IL-17F, IL-17B, IL-17C, IL-17D, and IL-17E, as well as heterodimers that combine two different cytokine family members, e.g., a sequence variant of IL-17A and a wildtype or variant of IL-17F; a sequence variant of IL-17F and a wildtype or variant of IL-17A; and so forth.
- heterodimers One approach to forming heterodimers is to connect one of the two subunit to one sequence of a heterodimeric pair, and the other subunit to the other sequence of the pair.
- the exogenous heterodimerization sequence from the heterodimeric pair can be positioned N- or C-terminal to the cytokine subunit. For example, the
- heterodimeric pair is a non-cytokine protein, e.g., a heterodimerization domain of a transcription factor (e.g., fos/jun), a receptor, or an artificial sequence.
- An exemplary artificial sequence is an engineered acidic-basic zipper.
- Another exemplary heterodimerization approach is to use an Fc domain engineered to form a heterodimer, e.g., a knobs-in-hole modified CH3 domain, e.g., within an Fc domain or
- Still another approach includes attaching one cytokine subunit to the constant region of an immunoglobulin light chain, and the other cytokine subunit to the CHI constant region of an immunoglobulin heavy chain.
- the linker can be any appropriate length, e.g., at least 24, 25, 27, 29, 30 or 32 residues, e.g., between 25-34 or 27-37 residues.
- the linker can include a repeating sequence, e.g., (Gly-Gly-Ser) n or (Gly- Gly-Gly Ser) n or (Gly-Gly-Gly-Gly-Ser) n where "n" is, e.g., 2, 3, 4, 5, 6, 7 or more. Longer and shorter linkers can also be used. Linker lengths with maximum stability and maximum heterodimer formation can be selected and used.
- IL-17R binding proteins and other proteins described herein can be produced by expression in recombinant host cells, but also by other methods such as in vitro transcription and translation and chemical synthesis.
- one or more nucleic acids e.g., cDNA or genomic DNA
- a replicable vector for cloning or for expression.
- the vector may, for example, be a plasmid, cosmid, viral genome, phagemid, phage genome, or other autonomously replicating sequence.
- the appropriate coding nucleic acid sequence may be inserted into the vector by a variety of procedures. For example, appropriate restriction endonuclease sites can be engineered (e.g., using PCR). Then restriction digestion and ligation can be used to insert the coding nucleic acid sequence at an appropriate location.
- components generally include one or more of an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
- the binding protein can be produced with or without a signal sequence.
- it can be produced within cells so that it accumulates in inclusion bodies. It can also be secreted, e.g., by addition of a prokaryotic signal sequence, e.g., an appropriate leader sequence such as from alkaline phosphatase, penicillinase, or heat- stable enterotoxin II.
- exemplary bacterial host cells for expression include any transformable E. coli K-12 strain (such as E. coli C600, ATCC 23724; E. coli HB101 NRRLB-11371, ATCC-33694; E. coli MM294 ATCC-33625; E. coli W3110 ATCC-27325), strains of B. subtilis, Pseudomonas, and other bacilli. Proteins produced in bacterial systems will typically lack glycosylation.
- the binding protein can be expressed in a yeast host cell, e.g., Saccharomyces cerevisiae, Schizosaccharomyces pombe, Hanseula, or Pichia pastoris.
- yeast expression the binding protein can also be produced intracellularly or by secretion, e.g., using the yeast invertase leader or alpha factor leader.
- mammalian signal sequences may be used to direct secretion of the protein, such as signal sequences from secreted polypeptides of the same or related species, as well as viral secretory leaders.
- Expression vectors used in eukaryotic host cells can also contain sequences necessary for the termination of transcription and for stabilizing the mR A. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the binding protein.
- the expression vector may also include one or more intronic sequences.
- the binding protein can also be expressed in insect cells, e.g., Sf9 or SF21 cells, e.g., using the pFAST-BACTM system.
- the binding protein can also be expressed in mammalian cells. For example, cell lines of mammalian origin also may be employed.
- mammalian host cell lines examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al, Cell 23: 175, 1981), L cells, CI 27 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, and BHK (ATCC CRL 10) cell lines, and the CVl/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) as described by McMahan et al. (EMBO J. 10: 2821, 1991).
- Established methods for introducing DNA into mammalian cells have been described (Kaufman, R. J., Large Scale Mammalian Cell Culture, 1990, pp. 1569).
- IL-17 cytokine proteins can be expressed and purified by any appropriate method, e.g., in mammalian, fungal, or bacterial cells.
- the proteins can be glycosylated or not glycosylated.
- IL-17R binding proteins and proteins described herein can be recovered from culture medium, inclusion bodies, or cell lysates.
- Cells can be disrupted by various physical or chemical means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing agents (e.g., detergents).
- IL-17R binding proteins and proteins described herein can be purified from other cell proteins or polypeptides that can be found in cell lysates or in the cell medium.
- One exemplary purification procedure includes cation exchange chromatography and gel filtration. See, e.g., Murphy et al. Protein Expr Purif. 1998 Mar;12(2):208-14.
- compositions described herein are useful in methods for treating or preventing a disease or disorder in a vertebrate subject.
- the step of administering to the subject a composition containing one or more polypeptides is provided.
- the composition is administered intravesicularly, topically, orally, rectally, ocularly, optically, nasally, or via inhalation.
- a level of an inflammatory cytokine can be reduced upon the administration of a modified polypeptide in a mammalian subject, such as by administering to the subject a therapeutically effective amount of a composition comprising a modified IL-17.
- exemplary inflammatory cytokines are IL-1, IL-6, TNF-a, IL-17, IL-21, and IL-23.
- the level of inflammatory cytokine present in the blood and/or another tissue of the mammal is generally reduced.
- Modulation of the immune system also includes methods of increasing a level of an anti-inflammatory cytokine in a mammalian subject.
- the anti-inflammatory cytokine is IL-10, IL-4, IL-11, IL-13, or TGF- ⁇ .
- the level of the anti-inflammatory cytokine present in the blood of the mammal is increased.
- an IL-17R binding protein or other engineered protein described herein is administered to a subject to treat a Thl7 mediated disorder or a disorder mediated by an IL-17 cytokine family member.
- the protein can be administered to a subject to treat atopic and contact dermatitis, colitis,
- endotoxemia arthritis, rheumatoid arthritis, psoriatic arthritis, autoimmune ocular diseases (uveitis, scleritis), adult respiratory disease (ARD), demyelinating diseases, septic shock, multiple organ failure, inflammatory lung injury such as asthma, chronic obstructive pulmonary disease (COPD), airway hyper-responsiveness, chronic bronchitis, allergic asthma, psoriasis, eczema, IBS and inflammatory bowel disease (IBD) such as ulcerative colitis and Crohn's disease, diabetes, Helicobacter pylori infection, intra-abdominal adhesions and/or abscesses as results of peritoneal inflammation (i.e.
- COPD chronic obstructive pulmonary disease
- IBD inflammatory bowel disease
- systemic lupus erythematosus SLE
- multiple sclerosis systemic sclerosis
- systemic sclerosis nephrotic syndrome
- organ allograft rejection graft vs. host disease (GVHD)
- kidney, lung, heart, etc. transplant rejection streptococcal cell wall (SCW)-induced arthritis
- osteoarthritis graft vs. host disease
- GVHD graft vs. host disease
- SCW streptococcal cell wall
- SCW streptococcal cell wall
- IL- 17 and/or IL-23 expression including but not limited to prostate, renal, colon, ovarian and cervical cancer, and leukemias (Tartour et al, Cancer Res.
- the binding protein is capable of binding, blocking, inhibiting, reducing, antagonizing or neutralizing IL-17 family members (either individually or together).
- compositions described herein may be used therapeutically or
- Cocktails of various different polypeptides can be used together to bind to and act upon one or multiple targets, e.g., multiple cell types, at once.
- Successful treatment can be assessed by routine procedures familiar to a physician.
- an IL-17R binding protein or other engineered protein (e.g., an antibody) described herein is administered to treat ocular disorders, including ocular disorders affecting the surface of the eye, ocular disorders mediated at least in part by an autoimmune reaction, ocular disorders associated with a systemic autoimmune disorder (such as Sjogren's syndrome and rheumatoid arthritis) or with a disorder associated with an IL-17 cytokine family member.
- the patient may or may not have other manifestations of a more systemic autoimmune disorder.
- the ocular disorder can be a dry eye disorder that affects the surface of the eye.
- the disorder includes conditions also referred to keratoconjunctivitis sicca, keratitis sicca, sicca syndrome, xerophthalmia, tear film disorder, decreased tear production, aqueous tear deficiency, and Meibomian gland dysfunction.
- the binding proteins described herein can also be used to treat vernal conjunctivitis and inflammation associated with glaucoma.
- Dry eye can include forms that are associated with Sjogren's syndrome (SS), e.g., Sjogren's syndrome associated keratoconjunctivitis sicca, but also forms that are not so associated, e.g., non- Sjogren's syndrome associated keratoconjunctivitis sicca.
- SS Sjogren's syndrome
- the patient may or may not have other manifestations of a systemic autoimmune disorder.
- Subjects having a dry eye syndrome can exhibit inflammation of the eye dry, and can experience scratchy, stingy, itchy, burning or pressured sensations, irritation, pain, and redness. Dry eye can be associated with both excessive eye watering and conversely insufficient tear production.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to such subjects to ameliorate or prevent the onset or worsening of one or more such symptoms.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can also be used to treat other disorders affecting the surface of the eye, such as the cornea. Such disorders include corneal ocular surface inflammatory conditions, corneal neovascularization, keratitis, including peripheral ulcerative keratitis and microbial keratitis.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be used to treat disorders affecting the conjunctiva, including conjunctival scarring disorders and conjunctivitis.
- the IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be used to treat still other disorders such as pemphigoid syndrome and Stevens-Johnson syndrome.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to a subject who is about to receive, undergoing, or recovering from a procedure involving the eye, e.g., corneal transplantation/ keratoplasty, keratoprosthesis surgery, lamellar transplantation, selective endothelial transplantation.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein described herein can be administered to a subject to modulate neovascularization in or around the eye.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to a subject having an allergic reaction affecting the eye, e.g., a subject experiencing severe allergic (atopic) eye disease.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to a subject having an autoimmune disorder affecting the eye.
- exemplary autoimmune ocular disorders include sympathetic ophthalmia, Vogt-Koyanagi Harada (VKH) syndrome, birdshot retinochoriodopathy, ocular cicatricial pemphigoid, Fuchs' heterochronic iridocyclitis, and various forms of uveitis.
- a IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to a subject to treat any of the foregoing disorders.
- Uveitis includes acute and chronic forms and includes inflammation of one or more of the iris, the ciliary body, and the choroid, and includes anterior, immediate, and posterior forms.
- Chronic forms may be associated with systemic autoimmune disease, e.g., Behcet's syndrome, ankylosing spondylitis, juvenile rheumatoid arthritis, Reiter's syndrome, and inflammatory bowel disease.
- a IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered to a subject to treat any of the foregoing forms of uveitis.
- An IL-17R binding protein or other engineered protein (e.g., an antibody) described herein can be administered by any mode to treat an ocular disease.
- the agent can be delivered by a parenteral mode.
- the agent can be delivered directly to the eye or in the vicinity of the eye.
- the protein can be administered topically or intraocularly, e.g., as described below.
- Ophthalmic formulations can be delivered for topical administration, e.g., for administration as a liquid drop or an ointment, or for implantation, e.g., into an anterior chamber of the eye or the conjunctival sac.
- Liquid drops can be delivered using an eye dropper.
- the IL-17R binding protein can be present at 0.001-5%, e.g., 0.01-5%), 0.1-2% or l%-5% concentration.
- One or more therapeutic agent can be formulated with a pharmaceutically acceptable carrier for administration to a subject.
- a therapeutic agent is formulated in combination with a mobilization factor, and optionally a
- the active ingredients can be formulated alone
- pharmaceutically acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a subject.
- the components of the pharmaceutical compositions also are capable of being commingled with each other, in a manner such that there is no interaction, which would substantially impair the desired
- Such preparations may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants and optionally other therapeutic ingredients.
- compositions described herein may be administered as a free base or as a pharmaceutically acceptable salt.
- pharmacologically and pharmaceutically acceptable salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p- toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene sulphonic, and benzene sulphonic.
- pharmaceutically acceptable salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
- compositions also may comprise suitable solid or gel phase carriers or excipients.
- suitable solid or gel phase carriers or excipients include, but are not limited to, calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
- Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5%) w/v); and phosphoric acid and a salt (0.8-2%) w/v).
- Suitable preservatives include benzalkonium chloride (0.003- 0.03% w/v); chlorobutanol (0.3-0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
- Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes (including pH-dependent release formulations), lipidoids, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin.
- the pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of the compositions, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above.
- the pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer, Science 249: 1527-1533, 1990 and Langer and Tirrell, Nature, 2004 Apr 1; 428(6982): 487-92.
- compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy.
- the composition that is administered is in powder or particulate form rather than as a solution. Examples of particulate forms contemplated as part of the invention are provided in U.S. 2002/0128225.
- the composition that is administered is in powder or particulate form rather than as a solution. Examples of particulate forms contemplated as part of the invention are provided in U.S. 2002/0128225.
- the composition that is administered is in powder or particulate form rather than as a solution. Examples of particulate forms contemplat
- compositions are administered in aerosol form.
- the compositions are administered in aerosol form.
- compositions may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- a suitable vehicle e.g., sterile pyrogen-free water
- compositions described herein may be formulated as a depot preparation, time-release, delayed release or sustained release delivery system. Such systems can avoid repeated administrations of the compositions described herein, increasing convenience to the subject and the physician. Such long acting
- formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- suitable polymeric or hydrophobic materials for example as an emulsion in an acceptable oil
- ion exchange resins for example, as an emulsion in an acceptable oil
- sparingly soluble derivatives for example, as a sparingly soluble salt.
- release delivery systems include polymer based systems such as polylactic and polyglycolic acid, beta- glucan particles, polyanhydrides and polycaprolactone; nonpolymer systems that are lipids including sterols such as cholesterol, cholesterol esters and fatty acids, neutral fats such as mono-, di- and triglycerides or lipidoids; hydrogel release systems;
- silastic systems peptide based systems; wax coatings, compressed tablets using conventional binders and excipients, partially fused implants and the like.
- a pump- based hardware delivery system can be used, some of which are adapted for implantation.
- Controlled release can also be achieved with appropriate excipient materials that are biocompatible and biodegradable.
- These polymeric materials which effect slow release may be any suitable polymeric material for generating particles, including, but not limited to, nonbioerodable/non-biodegradable and
- bioerodable/biodegradable polymers Such polymers have been described in great detail in the prior art and include, but are not limited to: beta-glucan particles, polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, polyvinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes and copolymers thereof, alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxy-propyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose acetate butyrate, cellulose a
- polyethylene polypropylene poly(ethylene glycol), poly(ethylene oxide),
- the slow release polymer is a block copolymer, such as poly(ethylene glycol) (PEG)/poly(lactic-co-glycolic acid) (PLGA) block copolymer.
- non-biodegradable polymers include ethylene vinyl acetate, poly(meth) acrylic acid, polyamides, copolymers and mixtures thereof.
- biodegradable polymers include synthetic polymers, for example, beta-glucan particles, polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, polyurethanes, poly(butic acid), poly(valeric acid),
- poly(lactide-co-caprolactone), and natural polymers such as alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof.
- these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
- the foregoing materials may be used alone, as physical mixtures (blends), or as co-polymers.
- Preferred polymers are polyesters, polyanhydrides, polystyrenes and blends thereof.
- Effective amounts of the compositions described herein are administered to a subject in need of such treatment. Effective amounts are those amounts, which will result in a desired improvement in the condition, disease or disorder or symptoms of the condition, disease or disorder.
- Effective doses range from 1 ng/kg to 100 mg/kg body weight, or from 100 ng/kg to 50 mg/kg body weight, or from 1 ⁇ g/kg to 10 mg/kg body weight, depending upon the mode of administration. Alternatively, effective doses can range from 3 micrograms to 14 milligrams per 4 square centimeter area of cells. The absolute amount will depend upon a variety of factors (including whether the administration is in conjunction with other methods of treatment, the number of doses and individual patient parameters including age, physical condition, size and weight) and can be determined with routine experimentation. One useful dose that can be is the highest safe dose according to sound medical judgment.
- the time between the delivery of the various active agents can be defined rationally by first principles of the kinetics, delivery, release, agent
- the time between the delivery of the various agents can be defined empirically by experiments to define when a maximal effect can be achieved.
- the mode of administration may be any medically acceptable mode including oral administration, sublingual administration, intranasal administration, intratracheal administration, inhalation, ocular administration, topical administration, transdermal administration, intradermal administration, rectal administration, vaginal
- intramuscular administration intraperitoneal administration, intrasternal,
- administration may be via an extracorporeal device and/or tissue-penetrating electromagnetic device.
- the particular mode selected will depend upon the particular active agents selected, the desired results, the particular condition being treated and the dosage required for therapeutic efficacy.
- the methods described herein, generally speaking, may be practiced using any mode of administration that is medically acceptable, for example, any mode that produces effective levels of inflammatory response alteration without causing clinically unacceptable adverse effects.
- compositions can be provided in different vessels, vehicles or
- compositions depending upon the disorder and mode of administration.
- the compositions can be administered as sublingual tablets, gums, mouth washes, toothpaste, candy, gels, films, etc.; for ocular application, as eye drops in eye droppers, eye ointments, eye gels, eye packs, as a coating on a contact lens or an intraocular lens, in contacts lens storage or cleansing solutions, etc.; for topical application, as lotions, ointments, gels, creams, sprays, tissues, swabs, wipes, etc.; for vaginal or rectal application, as an ointment, a tampon, a suppository, a mucoadhesive formulation, etc.
- compositions may be administered by injection, e.g., by bolus injection or continuous infusion, via intravenous, subcutaneous, intramuscular, intraperitoneal, intrasternal routes.
- Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
- the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the compositions can be formulated readily by combining the compositions with pharmaceutically acceptable carriers well known in the art, e.g., as a sublingual tablet, a liquid formulation, or an oral gel.
- the compositions may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- the medical device is an inhaler. In other embodiments the medical device is a metered dose inhaler, diskhaler, Turbuhaler, diskus or a spacer. In certain of these
- the inhaler is a Spinhaler (Rhone-Poulenc Rorer, West Mailing, Kent).
- Other medical devices are known in the art and include Inhale/Pfizer,
- compositions may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g., containing conventional suppository bases such as cocoa butter or other glycerides.
- IL-17 cytokine antagonists are antibodies, e.g., antibodies that bind to an IL-17 cytokine receptor, such as IL-17RA, IL-17RB, IL-17RC, IL-17RD, or IL- 17RE or antibodies that bind to an IL-17 cytokine, e.g., IL-17A, IL-17B, IL-17C, IL- 17D, IL-17E, or IL-17F.
- an antibody refers to a protein that includes at least one immunoglobulin variable region.
- an antibody can include a heavy chain variable region (VH), and a light chain variable region (VL).
- VH heavy chain variable region
- VL light chain variable region
- an antibody includes two VH regions and two VL regions.
- antibody encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab fragments, F(ab') 2 fragments, Fd fragments, Fv fragments, and dAb fragments) as well as complete antibodies, e.g., intact immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes and modified versions thereof). Still other antibodies only include a single immunoglobulin variable domain. See, e.g., Janssens et al, Proc. Natl. Acad. Sci. USA, 103(41): 15130-5 (2006).
- Each VH and VL is typically composed of three "complementarity
- CDR determining regions
- FR framework regions
- hypervariable loops of an immunoglobulin variable can be inferred from its sequence, as described in Chothia et al. (1992) J. Mol. Biol. 227:799-817; Tomlinson et al. (1992) J. Mol. Biol. 227:776-798); and Tomlinson et al. (1995) EMBO J. 14(18):4628-38.
- An exemplary antibody binds specifically to an IL-17 cytokine or an IL-17 cytokine receptor, e.g., with a binding affinity 10 6 M or greater, preferably 10 7 M or greater, more preferably 10 8 M or greater, and most preferably 10 9 M or greater.
- the binding affinity of an antibody can be readily determined by one of ordinary skill in the art, for example, by Scatchard analysis.
- An exemplary antibody may also have an EC50 of less than 100 nM, 20 nM, or 5 nM.
- an exemplary antibody can interfere with binding of an IL-17 cytokine and an IL-17 cytokine receptor, e.g., binding of IL-17A to IL-17RA or IL-17RC, or binding of IL-17F to IL-17RA or IL- 17RC.
- a specific antibody does not significantly cross-react with unrelated polypeptide molecules, for example, if they detect a desired polypeptide(s), but not other cellular polypeptides using a standard Western blot analysis.
- the antibody is specific for one IL-17 cytokine or one IL-17 receptor relative to others, e.g., the antibody preferentially binds to one particular IL-17 cytokine or receptor by a factor of at least 10, 100, or 1000.
- the antibody binds to IL-17RA, e.g., the Dl or D2 domain of IL-17RA.
- the antibody binds to an epitope that includes one or more amino acids within amino acids 22-36, amino acids 83-96, amino acids 118-147, amino acids 152-179, or amino acids 256-271 of IL-17RA (SEQ ID NO: 14), e.g., one or more amino acids, e.g., at least two or three amino acids within: Thr25-Trp31, Leu86-Arg93, or Cys259-Arg265 of SEQ ID NO: 14.
- the antibody reduces binding between IL-17RA and an IL-17 cytokine, e.g., IL-17A or IL-17F, e.g., by at least 100, 200, 500, 1000, or 5000 fold.
- the antibody binds to IL-17RB, e.g., to an epitope that includes one or more amino acids within amino acids 25-39, amino acids 86-100, amino acids 126-155, amino acids 160-187, or amino acids 254-269 of IL-17RB (SEQ ID NO: 15) and/or amino acids 32-44 (e.g., 38-44), 82-98 (e.g., 88-98), and 252- 269 (e.g., 256-263) of SEQ ID NO: 15.
- the antibody binds to IL-17RC, e.g., to an epitope that includes one or more amino acids within amino acids 15-30, amino acids 70-84, amino acids 96-124, amino acids 129-156, or amino acids 227-237 of IL-17RC (SEQ ID NO:16) and/or amino acids 24-35, 78-91, and 248-257 of SEQ ID NO:16.
- Polyclonal antibodies to a polypeptide can be prepared using known methods. See, for example, Green et al., "Production of Polyclonal Antisera," in
- monoclonal antibodies can be obtained by injecting mice with a composition including the polypeptide, verifying the presence of antibody production by removing a serum sample, removing the spleen to obtain B-lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones that produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
- Human antibodies to the polypeptide can also be derived.
- Human monoclonal antibodies are obtained from transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge.
- elements of the human heavy and light chain locus are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy chain and light chain loci.
- the transgenic mice can synthesize human antibodies specific for human antigens, and the mice can be used to produce human antibody-secreting hybridomas.
- Methods for obtaining human antibodies from transgenic mice are described, for example, by Green et al, Nature Genet. 7: 13 (1994), Lonberg et al, Nature 368:856 (1994), and Taylor et al, Int. Immun. 6:579 (1994).
- Monoclonal antibodies can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion- exchange chromatography ⁇ see, for example, Coligan; Baines et al, "Purification of Immunoglobulin G (IgG),” in Methods in Molecular Biology, (The Humana Press, Inc. 1992)).
- An antibody can be a "humanized” monoclonal antibody.
- Humanized monoclonal antibodies are produced by transferring mouse complementary determining regions from heavy and light variable chains of the mouse
- assays known to those skilled in the art can be utilized to detect antibodies which specifically bind to a polypeptide. Exemplary assays are described in detail in Antibodies: A Laboratory Manual, Harlow and Lane (Eds.), Cold Spring Harbor Laboratory Press, 1988. Representative examples of such assays include: radioimmunoassays, radioimmunoprecipitations, enzyme-linked immunosorbent assays (ELISA), dot blot or Western blot assays, inhibition or competition assays, sandwich assays, and surface plasmon resonance.
- ELISA enzyme-linked immunosorbent assays
- a protein disclosed herein can be associated with a heterologous domain, such as a constant domain of an immunoglobulin or the Fc region of an immunoglobulin, a serum albumin, or a serum albumin binding domain.
- a heterologous domain such as a constant domain of an immunoglobulin or the Fc region of an immunoglobulin, a serum albumin, or a serum albumin binding domain.
- at least one IL-17 polypeptide seqeuence and one or more constant domains of an Fc region can be components of the same polypeptide chain, and can for example be joined by a linker.
- An exemplary Fc region is from a human IgG, e.g., IgGl , IgG2, IgG3, or IgG4.
- the heterologous polypeptide can include all or a portion of the CH2 domain, the CH3 domain, and/or a hinge region, of an immunoglobulin.
- the heterologous polypeptide can be connected by a linker, e.g., a flexible linker.
- Fragments of an Fc region can also be used, as can Fc muteins.
- Fc muteins For example, certain residues within the hinge region of an F c region are critical for high affinity binding to F c yRI.
- Canfield and Morrison (1991) J. Exp. Med. 173 : 1483) reported that Leu234 and Leu235 are critical to high affinity binding of IgG 3 to F C YRI present on U937 cells. Similar results were obtained by Lund et al. (1991) J. Immunol.
- Such mutations can be made in an IgGl Fc region to decrease the affinity of IgGl for FcR.
- Other Fc muteins that effect Fc binding, antibody-dependent cell mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC) are described in Shields et al. (2001) J. Biol. Chem. 276(9):6591 and US 2004/0132101.
- a binding protein described herein can be labeled directly or indirectly with a moiety that is a label or produces a signal, e.g., an enzyme, a radiolabel, an epitope, or a fluorescent protein (such as green fluorescent protein).
- the binding protein can be contacted to a sample or to cells to determine if a receptor is present in the sample or on the cells, e.g., using standard immunoblotting, immunofluorescence, enzyme immunoassay (EIA), radioimmunoassay (RIA), fluorescence energy transfer, Western blot, and other diagnostic and detection techniques.
- the binding protein can also be labeled for in vivo detection and administered to a subject.
- the subject can be imaged, e.g., by NMR or other tomographic means.
- the binding agent can be labeled with a radiolabel such as 1311, 11 lln, 1231, 99mTc, 32P, 1251, 3H, 14C, and 188Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography (“PET”) scanner, chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase.
- the binding protein can be labeled with a contrast agent such as paramagnetic agents and ferromagnetic or superparamagnetic (which primarily alter T2 response)
- a binding protein can also be used to purify cells which express the receptor to which it binds.
- the binding protein can be coupled to an immobilized support (e.g., magnetic beads or a column matrix) and contacted to cells which may express the receptor.
- the support can be washed, e.g., with a physiological buffer, and the cells can be recovered from the support.
- a binding protein can also be used to purify soluble forms of the receptor to which it binds. For example, samples containing the soluble receptor can be contacted to immobilized binding protein and then, e.g., after washing, can be recovered from the immobilized binding protein.
- a binding protein that binds to an IL-17 receptor can also be used to delivery a toxin or cytotoxic effect to an IL-17 receptor expressing cell.
- the binding protein can be associated with (e.g., covalently) with a toxin or may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent or a radioactive metal ion.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells, including another protein, e.g., a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin, or an Fc domain competent to recruit an ADCC or complement mediated cytotoxic response.
- toxins that can be associated with the binding protein include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil
- alkylating agents e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine and lomustine, cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin
- anthracyclines e.g., daunorubicin (formerly daunomycin) and doxorubicin
- antibiotics e.g., dactinomycin, bleomycin, mithramycin, and anthramycin
- antimitotic agents e.g., vincristine and vinblastine.
- the binding protein can be coupled to a radioactive isotope such as an ⁇ , ⁇ , or ⁇ -emitter.
- radioactive isotopes include iodine ( 131 I or 125 I), yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, or bismuth ( 212 Bi or 213 Bi).
- the binding protein can be coupled to a biological protein, a molecule of plant or bacterial origin (or derivative thereof), e.g., a maytansinoid (e.g., maytansinol, an analog thereof or DM1), as well as a taxane (e.g., taxol or taxotere), or a
- calicheamicin examples include those having a modified aromatic ring (e.g., C-19-decloro, C-20-demethoxy, C-20-acyloxy) and those having modifications at other positions (e.g., C-9-CH, C-14-alkoxymethyl, C-14- hydroxymethyl or aceloxymethyl, C-15-hydroxy/acyloxy, C-15-methoxy, C-18-N- demethyl, 4,5-deoxy).
- Maytansinol and maytansinol analogues are described, for example, in U.S. 6,333,410.
- Maytansinol can be coupled using, e.g., an N- succinimidyl 3-(2-pyridyldithio)proprionate (also known as N-succinimidyl 4-(2- pyridyldithio)pentanoate or SPP), 4-succinimidyl-oxycarbonyl-a-(2-pyridyldithio)- toluene (SMPT), N-succinimidyl-3-(2-pyridyldithio)butyrate (SDPB), 2- iminothiolane, or S-acetylsuccinic anhydride.
- SPP N- succinimidyl 3-(2-pyridyldithio)proprionate
- SPP 4-(2- pyridyldithio)pentanoate or SPP
- SPP 4-succinimidyl-oxycarbonyl-a-(2-pyridyldithio)-
- Example 1 IL-17RA-IL-17F complex expression and crystallization
- the IL-17RA ectodomain is composed of two unusual Fnlll domain modules joined by an 18-amino acid linker (Fig. 1). Although not apparent from the sequence, the IL-17RA structure is reminiscent of hematopoietic cytokine receptors in that it contains tandem b-sandwich domains; however, the domains themselves contain some substantial deviations from canonical Fnlll folds, and the manner of ligand interaction is entirely distinct from other cytokine receptors.
- Residues 2-272 of the predicted 286 ectodomain residues (where residue 1 is the first amino acid of the mature peptide, as shown in SEQ ID NO: 14) were modeled into continuous electron density for the receptor chain and five of the potential seven N-linked glycans were clearly visualized.
- the first Fnlll domain (Dl) has an additional 40 amino acid N-terminal extension that forms a unique fold.
- the chain makes a hairpin-like turn bridged by a disulfide bond (Cysl2-Cysl9), and the second strand of the turn forms a ⁇ -strand ( ⁇ ') that extends the Fnlll ⁇ -sheet and then wraps around the face of the Dl domain, disulfide bonding with the C strand Cys95, before passing over the domain to start the A-strand of the Fnlll domain.
- the interdomain linker region contains a short helix and is stabilized by an internal disulfide bond (Cysl54-Cysl65).
- the second Fnlll domain (D2) has two atypical disulfide bonds, one linking the C-C loop (Cys214) to the D-F loop (Cys245) and a second within the F-G loop (Cys259-Cys263).
- a third disulfide bond exists between F-G loop (Cys246) and C-terminus of the G-strand (Cys272), similar to that observed in class-II cytokine receptors (21), however this bond is not well defined in the current electron density map.
- IL-17RA-bound IL-17F molecule While the core structure of the IL-17RA-bound IL-17F molecule was essentially unchanged compared to that of the unliganded form of IL-17F (7), peripheral strands and loops underwent structural accommodations to facilitate binding to IL-17RA. The conformation observed in the unliganded IL-17F structure could not be maintained in the IL-17RA-bound state, as it would generate steric clashes with the N-terminal coil region of the receptor.
- Each IL-17F monomer is composed of two pairs of anti-parallel ⁇ -sheets (strands 1-4) with the second and fourth strands connected by two disulfide bonds in a manner homologous to cysteine- knot family proteins.
- IL-17RA forms an extensive binding interface with IL-17F, burying -2200 A 2 of surface area; -70% of this buried surface area is mediated by the IL-17RA Dl domain. There are three major interaction sites at the binding interface (Fig. 2).
- Site 1 is formed between the N-terminal extension of IL-17RA (Thr25- Trp31 of SEQ ID NO: 14) and the 1-2 loop (Pro60-Tyr63) plus the C-terminal region of strand 3 (VallOO, Argl02) of IL-17F chain B; this interaction buries -330 A 2 (Fig. 2C).
- Trp31 of the receptor is buried in the center of this binding site; the main-chain O forms hydrogen bonds with Argl02 and the side chain forms hydrogen bonds with Pro60.
- Two additional hydrogen bonds are formed between IL-17RA Thr25 and Cys26 and IL-17F Tyr63.
- Site 2 is the most prominent interface feature of the complex, and is composed of the IL-17RA Dl C'-C loop (Leu86-Arg93 of SEQ ID NO: 14) which slots into a deep binding-pocket flanked by the N-terminal extension and strand 2 of IL-17F chain B and strand 3 of IL-17F chain A; this interaction buries almost 550 A 2 (Fig. 2A,B).
- This 8 -amino acid IL-17RA loop forms extensive hydrophobic and polar interactions with both chains of IL-17F including a potential salt bridge between IL-17RA Glu92 and IL-17F chain B Arg37, and a hydrogen bond between the main-chain O of IL-17RA Asn89 and IL-17F chain A Asn95.
- Site 3 which encompasses -410 A 2 of buried surface area (BSA), is formed between the IL- 17RA D2 F-G loop (Cys259-Arg265) and the C-terminal regions of stands 3 and 4 of IL-17F chain A, and the N-terminal extension of IL-17F chain B (Fig. 2D).
- Site 3 is rich in charged interactions with nine potential hydrogen bonds and a salt bridge between IL-17RA Asp262 and IL-17F chain B Arg47. Overall the interface is extensive and is composed of numerous specific contacts. It is envisaged that an analogous binding mode will be used by other IL-17 receptor-cytokine pairs, given the sequence conservation of contact residues (discussed below). However, a greater bond-network and/or shape complementarity may be employed in the higher affinity complexes.
- the strategy was to immobilize one receptor on the SPR chip at a low coupling density in order to minimize possible homo-dimerization (e.g. cross-linking) of the receptors on the chip.
- the dimeric IL-17 cytokine was then captured by this receptor so that each receptor would be bound to one dimeric IL-17 ligand, leaving an exposed and accessible second receptor-binding site.
- the second receptor was subsequently passed over the preformed receptor-cytokine complexes to measure the affinity of the second receptor-binding event.
- IL-17A bound to both IL-17RA (2.8 ⁇ 0.9 nM) and IL-17RC (1.2 ⁇ 0.1 nM) with high affinity. Once IL-17A was bound by one IL-17RA molecule, the binding affinity for a second IL-17RA was reduced to 3.1 ⁇ 0.5 ⁇ whereas the IL-17RC affinity for this second binding site was 174 ⁇ 3 nM.
- IL-17A was originally captured by IL-17RC, a second IL-17RA bound to the existing IL-17RC-IL-17A complex with 162 ⁇ 29 nM affinity; the binding affinity of a second IL-17RC to existing IL-17RC-IL-17A complex was only 8.0 ⁇ 0.5 ⁇ .
- IL-17RA has been implicated in IL-17E (also known as IL-25) signaling together with IL-17RB (23).
- IL-25 promotes Th2 inflammatory responses and shares approximately -20% identity with IL-17A and IL-17F. Binding experiments have demonstrated that whilst IL-25 binds to IL-17RB with high affinity, it has no apparent affinity for IL-17RA (23-25). We hypothesized that IL-17RA may only bind IL-25 once IL-25 is captured by IL-17RB.
- a second IL-17RA molecule to form the hypothetical 2:2 receptor-cytokine complex (Fig. 3B).
- the base of IL-17RA D2 would come into very close proximity with the D2 of the second IL-17RA (Fig. 3B, dashed box).
- His212 on the C-C loop of one IL-17RA would clash with the second IL-17RA His212.
- This potential interaction site may allow the receptors to regulate their pairing. Steric clashes may cause reduced affinity for a second identical receptor, or favorable receptor-receptor interactions may stabilize heteromeric receptor complexes.
- Example 5 IL-17RA functions as a common receptor
- IL-17RA binds to IL-17A with ⁇ 100-fold higher affinity than IL-17F.
- IL-17A and IL-17F share -50% identity, and mapping the conserved residues onto the structure of IL-17F reveals a horseshoe-shaped ring of variable residues around the receptor-binding pocket (Fig. 4).
- the majority of the IL-17RA C'-C loop interactions are formed with residues that differ between the IL-17A and IL-17F molecules whereas the N-terminal region and IL-17RA D2 F-G loop interactions involve predominately conserved residues.
- IL-17RA extracellular region of IL-17RA can also bind to the IL-17RB-IL-25 complex, and it was recently shown that IL-17RD can interact with IL-17RA to mediate IL-17A signaling (26). Given this association of IL-17RA with diverse IL-17 family members we speculate that IL- 17RA may act as a shared receptor analogous to those utilized in class I cytokine receptor complexes (27). To investigate this possibility, we mapped the residues conserved among all IL-17 family members onto the IL-17F surface.
- IL-17RA may modulate specificity for each cytokine by contacting non-conserved cytokine residues with the C-C loop ( Figure 4C).
- IL-17RA appears to use a strategy of cross-reactivity based on a subset of conserved contacts, amongst a background of distinct contacts, with several different IL-17 cytokines.
- receptor-cysteine-knot growth factor ligand complexes such as nerve growth factor (NGF) (28-30), vascular endothelial growth factor (VEGF) (31) two glial cell-derived neurotrophic factor (GDNF) family members (32), and others; these structures can serve as instructive comparisons with the mode of ligand engagement mediated by IL-17RA (Fig. 5).
- NGF nerve growth factor
- VEGF vascular endothelial growth factor
- GDNF glial cell-derived neurotrophic factor family members
- IL-17RA IL-17RA
- the receptor bears no structural similarity to IL-17RA; however, like IL-17RA, p75NTR engages NGF within a concave groove at the ligand dimer interface (Fig. 5B).
- TrkA complex with NGF an immunoglobulin (Ig)-domain in TrkA, which is structurally related to the Fnlll domains of IL-17RA, is used for ligand binding.
- Ig-domain of TrkA binds end-on to a flat face in the 'saddle' of NGF formed by the NGF ⁇ -sheets; thus the mode of binding is distinct (Fig. 5C).
- the NGF-p75NTR complex has been reported as both 1 :2 and 2:2 complexes that may represent partial and complete forms of a homodimeric p75 signaling complex, respectively (28, 30).
- homodimeric NGF ligand engages two identical p75 molecules, and thus does not require a structural mechanism for the symmetric dimeric ligand to heterodimerize two different receptors.
- Example 7 Human IL-17RC or Human IL-17RA Binding
- Baby Hamster Kidney (BHK) cells transfected with expression vectors encoding human IL-17RA, human IL-17RC, or both of these receptors are assessed for their ability to bind biotinylated human IL-17A, human IL-17F, and their variants including antagonists described herein.
- Cells are harvested with versene, counted and diluted to 10 7 cells per ml in staining media (SM), which is HBSS plus 1 mg/ml bovine serum albumin (BSA), 10 mM HEPES, and 0.1% sodium azide (w/v).
- SM staining media
- BSA bovine serum albumin
- HEPES 0.1% sodium azide
- Biotinylated human IL-17A, human IL-17F, and other proteins of interest are incubated with the cells on ice for 30 minutes at various concentrations. After 30 minutes, excess protein is washed away with SM and the cells are incubated with a 1 : 100 dilution of streptavidin conjugated to phycoerythrin (SA-PE) for 30 minutes on ice. Excess SA-PE is washed away and cells are analyzed by flow cytometry. The amount of binding is quantitated from the mean fluorescence intensity of the staining.
- SA-PE streptavidin conjugated to phycoerythrin
- PBMC Mononuclear Cells
- PBMCs are prepared from whole blood by Ficoll density gradient centrifugation. PBMC at 10 7 cells per ml are simultaneously incubated with biotinylated IL-17A or IL-17F or proteins of interest at 1 ⁇ g/ml and fluorochrome conjugated antibodies to specific cell surface proteins that are designed to distinguish various white blood cell lineages. These markers include CD4, CD8, CD 19, CD1 lb, CD56 and CD 16. Excess antibody and cytokine are washed away, and specific cytokine binding is detected by incubating with SA-PE as described above. Samples are analyzed by flow cytometry.
- Binding studies are performed as discussed above, but excess unlabeled human IL-17A and IL-17F or excess unlabeled proteins of interest such as proteins described herein are included in the binding reaction. In studies with BHK cells, the amount of unlabeled protein is varied over a range of concentrations and unlabeled IL-17A and proteins of interest are evaluated for ability to compete for binding of both IL-17A and IL-17F to both IL-17RC and IL-17RA.
- Example 8 Murine NIH3T3 Cells Respond to Human IL-17A and IL-17F
- Murine NIH3T3 cells are transfected with Kzl42 adenovirus particles containing a consensus NF- ⁇ binding site, the tandem NF- ⁇ binding sites of the human immunodeficiency virus- 1 long terminal repeat, two copies of the collagenase AP-1 element, and a single copy of the c-Jun TRE ligated into a luciferase reporter cassette and placed in the pACCMV.pLpA adenoviral shuttle vector as described in Blumberg et al. (2001) Cell 104:9-19.
- adenovirus particle reporter Following the overnight incubation with the adenovirus particle reporter, treatments (e.g., with IL-17A, IL-17F, or others proteins of interest) are prepared in serum free media containing 0.28% BSA. The adenovirus particles and media are removed and the appropriate doses are given. Incubation at 37°C and 5% C0 2 is continued for 4 hours, after which the media is removed, cells lysed for 15 minutes and mean fluorescence intensity (MFI) measured using the luciferase assay system and reagents. (Cat.#el531 Promega, Madison, WI) and a microplate luminometer. Stable cell lines can also be made. Stable and/or transient cell lines can be used to evaluate a protein described herein for activity.
- MFI mean fluorescence intensity
- Example 9 IL-17A Induces Elevated Levels of IFNy and TNFa in Human Peripheral Blood Mononuclear Cells
- PBMC Human peripheral blood mononuclear cells
- PBMC Human peripheral blood mononuclear cells
- Replicate cultures for each of these conditions are set up and are given no cytokine, 25 ng/ml human IL-17A, 25 ng/ml human IL-17F, or varying concentrations of a protein of interest (for example in the presence of cytokine).
- the mouse Collagen Induced Arthritis (CIA) model can be used to evaluate therapeutic potential of drugs (such as proteins described herein) to treat human arthritis.
- drugs such as proteins described herein
- Eight to ten-week old male DBA/IJ mice (Jackson Labs; 25-30 g each) are used for these studies. On day-21, animals are given an intradermal tail injection of 100 of 1 mg/ml chick type II collagen formulated in Complete Freund's Adjuvant and three weeks later on Day 0 mice are given the same injection except prepared in Incomplete Freund's Adjuvant. Animals begin to show symptoms of arthritis following the second collagen injection, with most animals developing inflammation within 1-2 weeks. The extent of disease is evaluated in each paw by using a caliper to measure paw thickness, and by assigning a clinical score (0-3) to each paw:
- Incidence of disease in this model is typically 95-100%, and 0-2 non- responders (determined after 6 weeks of observation) are typically seen in a study using 40 animals. Note that as inflammation begins, a common transient occurrence of variable low-grade paw or toe inflammation can occur. For this reason, an animal is not considered to have established disease until marked, persistent paw swelling has developed.
- Treatments Established disease is defined as a qualitative score of paw inflammation ranking 1 or more. Once established disease is present, the date is recorded, designated as that animal's first day with "established disease", and treatment started. Mice are treated with PBS, or with varying doses of the protein of interest, i.p. every other day for a total of five doses: 150 ⁇ g; 75 ⁇ g; 25 ⁇ g; and 10 ⁇ g.
- Blood is collected throughout the experimental period to monitor serum levels of anti-collagen antibodies, as well as serum immunoglobulin and cytokine levels. Animals are euthanized 48 hours following their last (5th) treatment, about 10 days following disease onset. Blood is collected for serum, and all paws are collected into 10% NBF for histology. Serum is collected and frozen at -80°C for immunoglobulin and cytokine assays. A dose-dependent, significant reduction in clinical score severity in treated mice indicates a biological effect for the protein in this test system.
- IBD Inflammatory Bowel Disease
- inflammatory mediators compared to tissue from healthy controls.
- This enhanced production of inflammatory mediators includes but not limited to IL- ⁇ , IL-4, IL-5, IL-6, IL-8, IL-12, IL-13, IL-15, IL-17 A and F, IL-18, IL-23, TNF-a, IFN- ⁇ , MIP family members, MCP-1, G- and GM-CSF, etc.
- IBDs Crohn's disease (CD) and ulcerative colitis (UC) by way of their effect(s) on activating inflammatory pathways and downstream effector cells.
- this model can simulate this enhanced inflammatory mediator aspect of IBD. Furthermore, when intestinal tissue from healthy controls or from human intestinal epithelial cell (IEC) lines is cultured in the presence of these inflammatory components, inflammatory pathway signaling can be observed, as well as evidence of tissue and cell damage.
- IEC human intestinal epithelial cell
- Therapeutics that would be efficacious in human IBD in vivo would work in the above ex vivo or IEC models by inhibiting and/or neutralizing the production and/or presence of inflammatory mediators.
- human intestinal tissue is collected from patients with IBD or from healthy controls undergoing intestinal biopsy, re-sectioning or from post-mortem tissue collection, and processed using a modification of Alexakis et al. (Gut 53:85-90; 2004). Under aseptic conditions, samples are gently cleaned with copious amounts of PBS, followed by culturing of minced sections of tissue, in the presence of complete tissue culture media (plus antibiotics to prevent bacterial overgrowth). Samples from the same pool of minced tissue are treated with one of the following: vehicle (PBS); recombinant human (rh) IL-17A; rhIL-17F; or rhIL-17A+rhIL-17F.
- these samples can be treated with or without an antagonist of either IL-17A, IL-17F, IL- 17B, IL-17C, IL-17D, and IL-17E alone or in combination.
- This experimental protocol is followed for studies with human IEC lines, with the exception that cells are passaged from existing stocks. After varying times in culture (from 1 h to several days), supernatants are collected and analyzed for levels of inflammatory mediators, including those listed above. In samples from patients with IBD or in samples treated with rhIL-17A and/or F, levels of inflammatory cytokines and chemokines are elevated compared to untreated healthy control tissue samples. Proteins of interest can be evaluated for ability to reduce the production of inflammatory mediators, and thus, to be efficacious in human IBD.
- Proteins of interest can be evaluated in a mouse model for dry eye disease. Dry eye can be induced in mice by subcutaneous injection of scopolamine and then placement of the mice in contra lled-environment chambers.
- the controlled environment chamber can be controlled for relative humidity, temperature, and air flow. See, e.g., Barabino et al, Invest. Ophth. Vis. Sci., 46:2766-71, 2005.
- Various mouse strains can be used. These include, e.g., C57BL/6, BALB/c, NZB/W, and MLR/lpr, MLR +.
- Other animals e.g., rabbits, rats, monkeys, dogs, and cats, can also be used as dry eye disease models.
- dry eye can be induced in normal healthy 6 to 10 weeks old female C57BL/6 mice by continuous exposure to dry environment in a controlled environmental chamber with humidity less than 30% (generally about 19%), high airflow (generally greater than about 15 liters/minute) and constant temperature (about 22°C).
- the mice placed in the chamber are also treated with scopolamine to inhibit tear secretion.
- One quarter of a sustained release transdermal scopolamine patch (Novartis, Summit NJ) is applied to the depilated mid-tail of mice every 48 hours, or the scopolamine can be injected, e.g., 750 ⁇ g, twice daily subcutaneously.
- mice can be treated after disease onset with a protein of interest for 7 to 14 days under these conditions and compared to placebo or vehicle treated controls. Mice can be monitored and evaluated for dry eye, e.g., by performing: (a) an assessment of aqueous tear production; (b) corneal fluorescein staining which is a marker of corneal surface damage; (c) an assessment of goblet cell density in the superior and inferior conjunctiva; (d) general ophthalmic examination, e.g., for conjunctival epithelial morphology; (e) scanning electron microscope examination of corneal surface; and (f) immunohistochemistry.
- This model is designed to show that human synovial cultures (including synovial macrophages, synovial fibroblasts, and articular chondrocytes) and explants from patients with RA and OA produce higher levels of inflammatory mediators compared to cultures/explants from healthy controls.
- inflammatory mediators including but not limited to oncostatin M, IL- ⁇ , IL-6, IL-8, IL-12, IL-15, IL-17 A and F, IL-18, IL-23, TNF-a, IFN- ⁇ , IP-10, RANTES, RANKL, MIP family members, MCP-1, G- and GM-CSF, nitric oxide, etc.
- inflammatory mediators include but not limited to oncostatin M, IL- ⁇ , IL-6, IL-8, IL-12, IL-15, IL-17 A and F, IL-18, IL-23, TNF-a, IFN- ⁇ , IP-10, RANTES, RANKL, MIP family members, MCP-1, G- and GM-CSF, nitric oxide, etc.
- this model can simulate the destructive inflammatory aspects of RA and OA in in vitro and ex vivo experiments. Furthermore, when explants and synovial cultures from healthy controls are cultured in the presence of several of these inflammatory components (e.g. oncostatin M, TNF-a, IL- ⁇ , IL-6, IL-17A and F, IL- 15, etc.), inflammatory pathway signaling can be observed. Therapeutics that would be efficacious in human RA in vivo may have an effect in the above in vitro and ex vivo models by inhibiting and/or neutralizing the production and/or presence of inflammatory mediators.
- these inflammatory components e.g. oncostatin M, TNF-a, IL- ⁇ , IL-6, IL-17A and F, IL- 15, etc.
- Example 13 Induction of G-CSF, IL-6 and IL-8
- Human small airway epithelial cells (SAEC) treated with human IL-17A or with human IL-17F can show a dose-dependent induction of G-CSF, IL-6, and IL-8, e.g., by evaluation of cell supernatants 48 hr after treatment. Proteins of interest can be evaluated for their ability to inhibit this induction.
- inflammatory mediators including but not limited to oncostatin M, IL- ⁇ , IL-6, IL-8, IL-12, IL-15, IL-17 A and F, IL-18, IL-23, TNF-a, IFN- ⁇ , IP- 10, RANTES, RANKL, MIP family members, MCP-1, MMP-9, G- and GM-CSF, nitric oxide, etc.
- inflammatory mediators include but not limited to oncostatin M, IL- ⁇ , IL-6, IL-8, IL-12, IL-15, IL-17 A and F, IL-18, IL-23, TNF-a, IFN- ⁇ , IP- 10, RANTES, RANKL, MIP family members, MCP-1, MMP-9, G- and GM-CSF, nitric oxide, etc.
- these models can simulate the destructive inflammatory aspects of RA and OA in in vitro and ex vivo experiments. Furthermore, when explants and synovial cultures from healthy controls are cultured in the presence of exogenously added inflammatory components (e.g. oncostatin M, TNF-a, IL- ⁇ , IL-6, IL-17A and F, IL- 15, etc.), or alternatively, in the presence of synovial fluid from RA patients (which would contain inflammatory components endogenously), inflammatory and degradative pathway signaling can be observed.
- Therapeutics that would be efficacious in human RA in vivo would work in the above in vitro and ex vivo models by inhibiting and/or neutralizing the production and/or presence of inflammatory mediators.
- human synovial explants are collected from patients with RA, OA, or from healthy controls undergoing joint replacement or from post-mortem tissue collection, and processed using a modification of Wooley and Tetlow (Arthritis Res 2: 65-70; 2000) and van't H of et al. (Rheumatotogy 39: 1004-1008; 2000).
- samples After varying time of culture (from 1 h to several days), supernatants and cells are collected and analyzed for levels of inflammatory mediators and cartilage/bone/matrix biomarkers, including those listed above. Samples can be treated with a protein of interest and evaluated for ability to reduce the production of inflammatory and cartilage/bone/matrix
- Example 15 Single Chain Human IL17A:IL17F Heterodimers
- Recombinant human IL17A:IL17F heterodimer protein or recombinant IL17A:IL17F-variant is produced from expression of the appropriate single chain construct in CHO DXBl 1 cells and cell culture in a WAVE apparatus.
- One construct is comprised of sequences for human IL-17A at the N-terminus with IL-17F at the C- terminus linked with a (G 4 S) 3 linker;
- another exemplary construct is comprised of sequences for human IL-17A at the N-terminus with a IL-17F -variant at the C- terminus linked with a (G 4 S) 3 linker.
- a His tag can be included at the C-terminus for product capture.
- An exemplary purification method is described in US 20080241138. Briefly, it can include an acid precipitation step, filtration, followed by
- chromatography For example, approximately 10 L of conditioned media are harvested and sterile filtered using a 0.2 ⁇ filter. The media is adjusted to pH 5.0 with addition of acetic acid while stirring. After precipitation, the pH-adjusted media is again filtered through a two stage 0.8 to 0.2 micron filter. The media can then be subjected to cation exchange chromatography on SP Fast Flow resin, and eluted with a salt gradient. Peak fractions can then be subjected to IMAC chromatography, e.g., using a 5 mL HISTRAP® IMAC column (GE Healthcare).
- peak fractions can be subjected size exclusion chromatography, e.g., on SUPERDEX® 200. Peak fractions can then be pooled and used. Fractions can be evaluated by Western analysis (e.g., with an anti-His tag antibody) and/or by SDS- PAGE with Coomassie gel staining.
- Recombinant protein was transiently expressed in suspension 293 GnTI- cells grown in PR0293TM media (Lonza) supplemented with 1% fetal calf serum (FBS) and 10 mM Na butyrate at 37°C.
- Full length IL-17F with a C-terminal hexa-His tag was cloned into the pAcGP67-A expression vector (BD Biosciences) and the protein secreted by High Five insect cells grown in INSECT XPRESSTM media (Lonza) at 27°C.
- the supernatants containing the IL-17RA and IL-17F proteins were mixed and concentrated before Ni-affinity purification.
- the IL-17RA protein was deglycosylated via endoglycosidase-H treatment and the IL-17RA and IL-17F purification tags cleaved using 3C-protease and carboxypeptidase A (Sigma-Aldrich).
- the protein complex was subjected to reductive lysine methylation using dimethylamine-borane complex and formaldehyde as described by Walter et al. (38).
- the IL-17RA-IL-17F complex was further purified using a SUPERDEX® 200 size exclusion column (GE Healthcare) equilibrated in 10 mM HEPES pH 7.4 and 150 mM NaCl. Fractions containing the IL-17RA-IL-17F complex were concentrated to ⁇ 15 mg/ml for crystallization trials.
- proteins were expressed and purified essentially as described above.
- the IL-17RA, IL-17RB and IL-17RC extracellular domains were expressed by 293s GnTI- cells with and without a C-terminal BirA ligase tag.
- IL- 17RC was expressed with an additional C- terminal Fc tag that was cleaved by 3C- protease prior to size exclusion chromatography.
- IL-17A, IL-17F and IL-25 cytokines were expressed by High Five cells with C-terminal hexa-His tags. Proteins were enzymatically biotinylated using BirA ligase and purified via size exclusion chromatography.
- Example 17 Crystallization and x-ray data collection
- IL-17RA-IL-17F complexes were initially grown via hanging-drop vapor diffusion in 10% PEG6000 and 0.1 M bicine pH 9.0. Optimized native and SeMet protein complex crystals were grown in PEG6000 (4-14%) and 0.1 M CAPSO buffer
- the crystals belong to the space group P41212 and have unit cells dimensions of -171, 171, 83 A.
- the initial native data set was collected at Stanford Synchrotron Radiation Lightsource (SSRL) beamline 9-2 (Stanford, CA).
- the Pt-derivative and SeMet datasets were collected at SSRL beamline 11-1.
- the higher resolution native dataset was collected at the Advanced Photon Source (APS) beamline ID-23D
- a molecular replacement solution for a single IL- 17F homodimer was determined using the program Phaser43 with the previously determined 2.85 A IL- 17F structure as a model (PDB ID 1JPY) (7).
- the initial maps showed additional density on one side of the IL-17F dimer illuminating the binding site for IL-17RA.
- Phases were calculated using a K 2 PtCl 4 derivative via single isomorphous
- the position of the IL-17RA Met residues was calculated via fast Fourier transform (FFT) to generate an anomalous difference map using the program FFT in the CCP4 suite.
- FFT fast Fourier transform
- the partially built model was used as a molecular replacement model for the SeMet dataset and the calculated phases used to find the selenonium peaks.
- Three of a potential six SeMet residues were located, corresponding to IL- 17RA Metl59, Metl66 and Met218.
- the model includes a dimethyl-lysine at position 43 of the IL-17RA chain, five single N-Acetylglucosamine (GlcNAc) sites on the IL-17RA chain, one site with two GlcNAc residues on the IL-17F chain B and a calcium ion.
- the programs PROCHECK48 and WHAT CHECK (49) were used to assess the geometry of the final model.
- the CCP4 suite programs Contact and Areaimol were used to determined the interface contacts and buried surface area respectively. All structural figures were generated using the program Pymol (50).
- Binding affinities were calculated via surface plasmon resonance (SPR) on a BIACORE® T100 (GE Healthcare). C-terminally biotinylated IL-17 receptors were coupled to immobilized streptavidin on either an SA or CM4-sensor chip (GE).
- IL-17F bound to IL-17RA was analyzed.
- Asn89 is conserved between IL-17A and IL-17F and in chain A forms a hydrogen bond to the IL- 17RA backbone in the site 3 pocket.
- a substitution e.g., with alanine, would remove the interaction.
- Gln-95 in chain A makes some hydrophobic interactions in the site 2 pocket.
- Substitution with a small residue such as alanine can be used to disrupt interactions and substitution with a bulky group, e.g. tryptophan, can be used to block the IL- 17RA loop insertion.
- Arg37 in chain B of IL-17F (SEQ ID NO: 12): Arg37 forms potential hydrogen bonds and salt bridges with IL-17RA, and position 41 is serine although the side chain could not be modeled with confidence. Alanine at Arg37 would disrupt the hydrogen bonds and salt bridges.
- IL-17A does not have a charged residue at position corresponding to Arg37 however has a lysine at position 37 in SEQ ID NO:2
- Arg42, Arg47, and Argl02 in chain B are conserved arginine residues.
- these arginine residues may form hydrogen bonds and salt bridges in site 3 (Arg42 and Arg47) and site 1 (Arg 102).
- Arg42 and Arg47 are in a similar environment, they can both be targeted together. Any one, two or all three can be substituted, e.g., in the same molecule, e.g., with an uncharged residue or an acidic residue.
- Arg38 of SEQ ID NO:2 can be substituted, e.g., in combination with positions corresponding to Arg47 and Argl02.
- Tyr63 in chain B is conserved in four of the six IL-17 cytokines, and is hydrophobic in the other two. Tyr63 makes extensive hydrophobic interactions, including with Trp31 that is buried in the centre of site 1. Tyr63 also forms potential hydrogen bonds with other site 1 residues. An alanine substitution can be used to disrupt the interactions and substitution with a charged residue (e.g., lysine) can be used to block the pocket.
- a charged residue e.g., lysine
- Val68 in chain B forms hydrophobic interactions with the receptor at site 2.
- Substituting Val68 for example with a long, polar side chain e.g. glutamine
- a long, polar side chain e.g. glutamine
- IL-17 cytokine dimer proteins were designed as heterodimers of two different subunit sequences.
- One approach to preparing such heterodimers is by fusion of each respective subunit to one of two heterodimeric zipper sequences, e.g., one of a pair acidic-basic zippers. See, e.g., O'Shea et al, Curr Biol. (1993), 3(10):658-67.
- one subunit of IL-17A was expressed with a C- terminal tag that contained an acidic sequence and a hexahistidine tag.
- Another subunit of IL-17A was expressed with a C-terminal tag that contained a basic sequence and a hexahistidine tag.
- the sequence of these subunits is as follows:
- Example 22 IL-17 Heterodimers Formed By Single Chain Fusion
- Another approach to preparing heterodimers is by covalently linking the two subunits using a flexible peptide linker and expressing them as a single polypeptide chain.
- An example of a single chain IL-17A molecule is as follows:
- This protein was expressed in 293 cells. Supernatants from the cells were run on non-reducing gels and Western blot analysis using an anti-hexahistidine antibody was performed. A substantial portion of the His-tagged protein migrated at a molecular weight ( ⁇ 35 kDa) corresponding to the monomeric form of the single-chain protein.
- Control IL-17A and IL-17F proteins and mutant IL-17A and IL-17F proteins were evaluated in a cell-based functional assay according to the method of Fossiez et al, J. Exp. Med. 183(6):2593-603 (1996). Briefly, MRC-5 human embryonic fibroblast cells were subcultured in 96-well plates at a concentration of lxl 0 5 cells/well in DMEM with 10% FBS. Control proteins and proteins of interest in PBS, pH 7.4, were added to respective wells at a final concentration of 0.1-10,000 ng/mL. Cells were incubated an additional 48 hours.
- IL-6 concentration in the supernatants was then measured by ELISA using the Thermo Scientific Human IL-6 Screening Set (cat# ENESS0005). Using this assay, IL-17A and IL-17F control proteins were observed to have an EC50 within published ranges of 1-10 ng/mL for IL-17A and 50- 100 ng/mL for IL-17F.
- IL-17A Another useful reference sequence for IL-17A is as follows and corresponds to SEQ ID NO:2 with the N-terminal glycine included:
- Proteins were prepared using subunits having the sequences listed below and where mutations in IL-17A were identified according to the numbering of the reference sequence above (col. 2) and according to IL-17F numbering (col. 3):
- the C-terminal truncation was immediately before position 128 of SEQ ID NO: 12 (position 126 of SEQ ID NO:2 or position 127 in SEQ ID NO:20), leaving proline at position 127 of SEQ ID NO: 12 (position 125 of SEQ ID NO:2 or position 126 in SEQ ID NO:20).
- proteins with the following combinations of mutations were observed to bind to IL-17RA in a plate binding assay.
- Still other exemplary mutant sequences for other human IL-17 cytokines include:
- TIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAP AGP AGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVL R47E; R102A 41 SAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNL ESVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFG EEDVRFRSAPVYMPTVVLRATPACAGGRSVYTEAYV TIPVGCTCVPEKDADSINSSIDKQGAKLLLGPNDAP AGP
- a mutant single-chain IL-17A protein was evaluated in cell-based antagonism assay.
- the mutant protein was a single-chain IL-17 A in which one subunit included the R47E and S65K mutations (e.g., as shown above in SEQ ID NO:22) and the second subunit included the N89A mutation and the C-terminal truncation (as shown above in SEQ ID NO:27).
- the two subunits were joined by a linker of the (G 4 S) 6 design.
- the protein also included a C-terminal histidine tag.
- the sequence of the protein was as follows:
- MRC-5 human embryonic fibroblast cells were cultured in the wells of 96-well plates at a concentration of lxl 0 5 cells/well in DMEM + 10% FBS. Mutant single-chain IL-17A proteins were added to the wells at a final concentration of 4 - 2400 nM. Wild-type IL-17A and TNF-a were added to the wells at final concentrations of 5 ng/mL and 2 ng/mL respectively. Cells were incubated at 37°C, 5% C0 2 for 48 hours. IL-6 concentration in the supernatants was then measured by ELISA using the Thermo Scientific Human IL-6 Screening Set (cat# ENESS0005). The results are shown in Table 9 below and demonstrate that this protein was able to antagonize IL-17A with an IC50 of about 10-15 nM.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biotechnology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2010800536540A CN102648002A (zh) | 2009-10-10 | 2010-10-11 | Il-17家族细胞因子组合物及用途 |
| EP10822826.3A EP2485763A4 (en) | 2009-10-10 | 2010-10-11 | CYTOKINE COMPOSITIONS OF THE IL-17 FAMILY AND ITS USES |
| AU2010303166A AU2010303166A1 (en) | 2009-10-10 | 2010-10-11 | IL-17 family cytokine compositions and uses |
| BR112012008444A BR112012008444A2 (pt) | 2009-10-10 | 2010-10-11 | proteína isolada, composição farmacêutica, métodos para modular uma resposta imune ou inflamatória em um sujeito, para tratar um distúrbio mediado po ir-17 em um sujeito e para preparar uma proteína recombinante, ácido nucleico isolado, e, célula hospedeira recombinante |
| US13/501,244 US20130064788A1 (en) | 2009-10-10 | 2010-10-11 | Il-17 family cytokine compositions and uses |
| EA201270528A EA201270528A1 (ru) | 2009-10-10 | 2010-10-11 | Композиции цитокинов семейства il-17 и их применение |
| CA2777222A CA2777222A1 (en) | 2009-10-10 | 2010-10-11 | Il-17 family cytokine compositions and uses |
| JP2012533384A JP2013507132A (ja) | 2009-10-10 | 2010-10-11 | Il−17ファミリーサイトカイン組成物及び使用 |
| IL219209A IL219209A0 (en) | 2009-10-10 | 2012-04-15 | Il-17 family cytokine compositions and uses |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US27877909P | 2009-10-10 | 2009-10-10 | |
| US61/278,779 | 2009-10-10 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011044563A2 true WO2011044563A2 (en) | 2011-04-14 |
| WO2011044563A3 WO2011044563A3 (en) | 2011-06-03 |
Family
ID=43857433
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/052194 Ceased WO2011044563A2 (en) | 2009-10-10 | 2010-10-11 | Il-17 family cytokine compositions and uses |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20130064788A1 (https=) |
| EP (1) | EP2485763A4 (https=) |
| JP (1) | JP2013507132A (https=) |
| KR (1) | KR20120093932A (https=) |
| CN (1) | CN102648002A (https=) |
| AU (1) | AU2010303166A1 (https=) |
| BR (1) | BR112012008444A2 (https=) |
| CA (1) | CA2777222A1 (https=) |
| EA (1) | EA201270528A1 (https=) |
| IL (1) | IL219209A0 (https=) |
| WO (1) | WO2011044563A2 (https=) |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012138977A1 (en) * | 2011-04-06 | 2012-10-11 | Board Of Trustees Of The Leland Stanford Junior University | Structural based design of il-17 dominant negative mutants |
| WO2013059644A1 (en) * | 2011-10-21 | 2013-04-25 | Baylor College Of Medicine | Method to measure inflammation in the conjunctiva of patients with tear dysfunction |
| WO2013075066A2 (en) | 2011-11-18 | 2013-05-23 | Eleven Biotherapeutics, Inc. | Proteins with improved half-life and other properties |
| WO2013186236A1 (en) * | 2012-06-12 | 2013-12-19 | Orega Biotech | Antagonists of il-17 isoforms and their uses |
| JP2013253842A (ja) * | 2012-06-06 | 2013-12-19 | Univ Of Tokyo | pH依存的に標的分子に結合するペプチドのスクリーニング方法 |
| CN103974976A (zh) * | 2011-10-19 | 2014-08-06 | 莫佛塞斯公司 | 用于治疗炎性病症的il17c拮抗剂 |
| US8853150B2 (en) | 2010-07-29 | 2014-10-07 | Eleven Biotherapeutics, Inc. | Chimeric IL-1 receptor type I antagonists |
| US9944691B2 (en) | 2012-03-16 | 2018-04-17 | Albumedix A/S | Albumin variants |
| EP3417878A1 (en) * | 2012-06-12 | 2018-12-26 | Orega Biotech | Antagonists of il-17 isoforms and their uses |
| US10233228B2 (en) | 2010-04-09 | 2019-03-19 | Albumedix Ltd | Albumin derivatives and variants |
| US10501524B2 (en) | 2012-11-08 | 2019-12-10 | Albumedix Ltd | Albumin variants |
| US10633428B2 (en) | 2015-08-20 | 2020-04-28 | Albumedix Ltd | Albumin variants and conjugates |
| US10696732B2 (en) | 2009-10-30 | 2020-06-30 | Albumedix, Ltd | Albumin variants |
| WO2020201442A1 (en) | 2019-04-03 | 2020-10-08 | Orega Biotech | Combination therapies based on pd1 and il-17b inhibitors |
| US10799589B2 (en) | 2013-03-13 | 2020-10-13 | Buzzard Pharmaceuticals AB | Chimeric cytokine formulations for ocular delivery |
| WO2021023624A1 (en) * | 2019-08-02 | 2021-02-11 | Orega Biotech | Novel il-17b antibodies |
| WO2021170750A1 (en) | 2020-02-28 | 2021-09-02 | Orega Biotech | Combination therapies based on ctla4 and il-17b inhibitors |
| WO2022032592A1 (en) * | 2020-08-13 | 2022-02-17 | Tsinghua University | Interleukin-17d and cd93 as a new cytokine-receptor pair in the immune system |
| US11555061B2 (en) | 2009-02-11 | 2023-01-17 | Albumedix, Ltd | Albumin variants and conjugates |
| US12296008B2 (en) | 2014-12-22 | 2025-05-13 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7767206B2 (en) | 2006-10-02 | 2010-08-03 | Amgen Inc. | Neutralizing determinants of IL-17 Receptor A and antibodies that bind thereto |
| WO2013016220A1 (en) * | 2011-07-22 | 2013-01-31 | Amgen Inc. | Il-17 receptor a is required for il-17c biology |
| CA2909706C (en) * | 2013-04-17 | 2023-02-14 | Genzyme Corporation | Use of an il17 inhibitor for treating and preventing macular degeneration |
| ES3044918T3 (en) * | 2016-03-25 | 2025-11-27 | The Univ Of Osaka | Conjugate vaccine targeting disorder-causing in vivo protein |
| JP2019513775A (ja) * | 2016-04-19 | 2019-05-30 | アズーラ オフサルミックス エルティーディー. | 角化症の処置のための組成物 |
| EP3655007A4 (en) * | 2017-07-21 | 2021-04-28 | The Cleveland Clinic Foundation | SBE APTAMERE FOR THE TREATMENT OF IL-17A DISEASES AND DISEASES |
| WO2019222296A1 (en) | 2018-05-14 | 2019-11-21 | Werewolf Therapeutics, Inc. | Activatable interleukin 12 polypeptides and methods of use thereof |
| AU2019271148B9 (en) | 2018-05-14 | 2025-05-29 | Werewolf Therapeutics, Inc. | Activatable interleukin-2 polypeptides and methods of use thereof |
| EP3969035A4 (en) | 2019-05-14 | 2023-06-21 | Werewolf Therapeutics, Inc. | SEPARATION UNITS AND METHODS AND THEIR USE |
| KR102265435B1 (ko) * | 2019-08-20 | 2021-06-15 | 주식회사 케어젠 | 피부 미백 활성을 갖는 펩타이드 및 이의 용도 |
| MX2022005666A (es) | 2019-11-14 | 2022-10-07 | Werewolf Therapeutics Inc | Polipeptidos de citocina activables y metodos de uso de los mismos. |
| EP4087655A4 (en) | 2020-01-10 | 2024-02-21 | Azura Ophthalmics Ltd | INSTRUCTIONS FOR COMPOSITION AND SENSITIVITY |
| CN113403259B (zh) * | 2021-06-04 | 2023-01-17 | 华南农业大学 | 一种提高克隆胚胎发育质量的添加剂及其应用 |
| CN113563453A (zh) * | 2021-07-23 | 2021-10-29 | 四川大学 | 鸡白细胞介素17b重组乳酸菌免疫制剂的制备和应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6333410B1 (en) | 2000-08-18 | 2001-12-25 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
| US20020128225A1 (en) | 2000-10-18 | 2002-09-12 | Massachusetts Institute Of Technology | Methods and products related to pulmonary delivery of polysaccharides |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| US20080241138A1 (en) | 2007-03-28 | 2008-10-02 | Levin Steven D | Soluble il-17ra/rc fusion proteins and related methods |
Family Cites Families (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ306653A (en) * | 1995-03-23 | 1999-03-29 | Immunex Corp | Isolated dna il-17 receptors |
| US6569419B2 (en) * | 2000-02-29 | 2003-05-27 | Zymogenetics, Inc. | Methods for promoting production of myelin by Schwann cells |
| US20030203451A1 (en) * | 2000-08-24 | 2003-10-30 | Genentech, Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| DE60125563T2 (de) * | 2000-10-13 | 2007-10-04 | Eli Lilly And Co., Indianapolis | Verfahren zur verwendung eines humanen il-17 verwandten polypeptids zur behandlung von krankheiten |
| CA2425506A1 (en) * | 2000-10-18 | 2002-08-01 | Immunex Corporation | Methods for treating rheumatoid arthritis using il-17 antagonists |
| US20040115191A1 (en) * | 2002-01-24 | 2004-06-17 | Moore Emma E | Method for treating psoriasis |
| CA2452233A1 (en) * | 2001-03-26 | 2002-10-03 | Zymogenetics, Inc. | Method of inducing proliferation of retinal stem cells |
| US20070160576A1 (en) * | 2001-06-05 | 2007-07-12 | Genentech, Inc. | IL-17A/F heterologous polypeptides and therapeutic uses thereof |
| US20040142325A1 (en) * | 2001-09-14 | 2004-07-22 | Liat Mintz | Methods and systems for annotating biomolecular sequences |
| EP2784084B2 (en) * | 2003-07-08 | 2023-10-04 | Novartis Pharma AG | Antagonist antibodies to IL-17A/F heterologous polypeptides |
| GB0417487D0 (en) * | 2004-08-05 | 2004-09-08 | Novartis Ag | Organic compound |
| US20070197441A1 (en) * | 2006-02-10 | 2007-08-23 | Rixon Mark W | Truncated il-17ra soluble receptor and methods of using in inflammation |
| EP1996622A2 (en) * | 2006-03-10 | 2008-12-03 | Zymogenetics, Inc. | Antibodies that bind both il-17a and il-17f and methods of using the same |
| GB0612928D0 (en) * | 2006-06-29 | 2006-08-09 | Ucb Sa | Biological products |
| EP2046835B1 (en) * | 2006-08-11 | 2011-10-26 | Schering Corporation | Antibodies to il-17a |
| US7767206B2 (en) * | 2006-10-02 | 2010-08-03 | Amgen Inc. | Neutralizing determinants of IL-17 Receptor A and antibodies that bind thereto |
| EP2144928A2 (en) * | 2007-04-20 | 2010-01-20 | Amgen Inc. | Jacquelinidentification and method for using the pre-ligand assembly domain of the il-17 receptor |
| JP5116842B2 (ja) * | 2007-04-27 | 2013-01-09 | ザイモジェネティクス, インコーポレイテッド | IL−17AおよびIl−17Fの両方に結合する抗体ならびにそれを使用する方法 |
| ES2614735T3 (es) * | 2007-07-23 | 2017-06-01 | Janssen Biotech, Inc. | Métodos y composiciones para tratar los trastornos relacionados con fibrosis usando antagonistas de la IL-17 |
-
2010
- 2010-10-11 US US13/501,244 patent/US20130064788A1/en not_active Abandoned
- 2010-10-11 KR KR1020127011769A patent/KR20120093932A/ko not_active Withdrawn
- 2010-10-11 EP EP10822826.3A patent/EP2485763A4/en not_active Withdrawn
- 2010-10-11 AU AU2010303166A patent/AU2010303166A1/en not_active Abandoned
- 2010-10-11 JP JP2012533384A patent/JP2013507132A/ja active Pending
- 2010-10-11 WO PCT/US2010/052194 patent/WO2011044563A2/en not_active Ceased
- 2010-10-11 CA CA2777222A patent/CA2777222A1/en not_active Abandoned
- 2010-10-11 BR BR112012008444A patent/BR112012008444A2/pt not_active IP Right Cessation
- 2010-10-11 EA EA201270528A patent/EA201270528A1/ru unknown
- 2010-10-11 CN CN2010800536540A patent/CN102648002A/zh active Pending
-
2012
- 2012-04-15 IL IL219209A patent/IL219209A0/en unknown
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6333410B1 (en) | 2000-08-18 | 2001-12-25 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
| US20020128225A1 (en) | 2000-10-18 | 2002-09-12 | Massachusetts Institute Of Technology | Methods and products related to pulmonary delivery of polysaccharides |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| US20080241138A1 (en) | 2007-03-28 | 2008-10-02 | Levin Steven D | Soluble il-17ra/rc fusion proteins and related methods |
Non-Patent Citations (114)
| Title |
|---|
| "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| "Antibody Engineering Protocols", 1995, HUMANA PRESS, INC. |
| "Current Protocols in Immunology", 1991, JOHN WILEY & SONS |
| "Cytokine Reference", 2001, ACADEMIC PRESS |
| "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR PRESS |
| "The CCP4 suite: programs for protein crystallography", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR., vol. 50, 1994, pages 760 - 763 |
| AFONINE PV; GROSSE-KUNSTLEVE RW; ADAMS PD, THE PHENIX REFINEMENT FRAMEWORK. CCP4 NEWSLETTER, 2005, pages 42 |
| ALEXAKIS ET AL., GUT, vol. 53, 2004, pages 85 - 90 |
| ARAI ET AL., ANNU. REV. BIOCHEM., vol. 5P, 1990, pages 783 |
| BAINES ET AL.: "Methods in Molecular Biology", 1992, THE HUMANA PRESS, INC., article "Purification of Immunoglobulin G (IgG" |
| BARABINO ET AL., INVEST. OPHTH. VIS. SCI., vol. 46, 2005, pages 2766 - 71 |
| BARABINO; DANA, INVEST. OPHTH. VIS. SCI., vol. 45, no. 6, 2004, pages 1641 - 46 |
| BARTON WA ET AL., PROTEIN SCI., vol. 15, 2006, pages 2008 - 2013 |
| BAZAN JF., PROC NATL ACAD SCI USA., vol. 87, 1990, pages 6934 - 6938 |
| BLUMBERG ET AL., CELL, vol. 104, 2001, pages 9 - 19 |
| BRUNGER AT: "Version 1.2 of the Crystallography and NMR system", NAT PROTOC., vol. 2, 2007, pages 2728 - 2733 |
| CANFIELD; MORRISON, J. EXP. MED., vol. 173, 1991, pages 1483 |
| CARTER ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHANG SH; PARK H; DONG C, J BIOL CHEM., vol. 281, 2006, pages 35603 - 35607 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 227, 1992, pages 799 - 817 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLAUDIO E ET AL., J IMMUNOL., vol. 182, 2009, pages 1617 - 1630 |
| DAGLEISH; O'BYRNE, CANCER TREAT RES., vol. 130, 2006, pages 1 |
| DAVIDSON; DIAMOND, NEW ENGL. J. MED., vol. 345, 2001, pages 340 |
| DE LA FORTELLE E; BRICOGNE G, METHODS ENZYMOL., vol. 276, 1997, pages 472 - 494 |
| DELANO WL., DELANO SCIENTIFIC. SAN CARLOS; CA, USA, 2002 |
| DEUTSCHER, METHODS IN ENZYMOLOGY, vol. 182, 1990 |
| DUKKIPATI A ET AL., PROTEIN EXPR PURIF., vol. 62, 2008, pages 160 - 170 |
| EMSLEY P; COWTAN K, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR., vol. 60, 2004, pages 2126 - 2132 |
| FOSSIEZ ET AL., J. EXP. MED., vol. 183, no. 6, 1996, pages 2593 - 603 |
| GAFFEN SL, NAT REV IMMUNOL., 2009 |
| GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175 |
| GONG Y; CAO P; YU HJ; JIANG T, NATURE, vol. 454, 2008, pages 789 - 793 |
| GREEN ET AL., NATURE GENET., vol. 7, 1994, pages 13 |
| GREEN ET AL.: "Immunochemical Protocols", 1992, HUMANA PRESS, article "Production of Polyclonal Antisera" |
| HARRINGTON LE ET AL., NAT IMMUNOL., vol. 6, 2005, pages 1123 - 1132 |
| HE XL; GARCIA KC, SCIENCE, vol. 304, 2004, pages 870 - 875 |
| HOOFT RW; VRIEND G; SANDER C; ABOLA EE: "Errors in protein structures", NATURE, vol. 381, 1996, pages 272 |
| HYMOWITZ SG ET AL., EMBO J., vol. 20, 2001, pages 5332 - 5341 |
| ISHIGAME H ET AL., IMMUNITY, vol. 30, 2009, pages 108 - 119 |
| JANSSENS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, no. 41, 2006, pages 15130 - 5 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services", 1991, NIH PUBLICATION NO. 91-3242 |
| KATO ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 282, 2001, pages 735 |
| KAUFMAN, R. J., LARGE SCALE MAMMALIAN CELL CULTURE, 1990, pages 1569 |
| KELLEY ET AL.: "Protein Engineering: Principles and Practice", 1996, JOHN WILEY & SONS, INC., article "Engineering Therapeutic Antibodies" |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KORN T ET AL.: "IL-17 and Th17 Cells", ANNU REV IMMUNOL., vol. 27, 2009, pages 485 - 517 |
| KRAMER JM ET AL., J IMMUNOL., vol. 176, 2006, pages 711 - 715 |
| KRAMER JM ET AL., J IMMUNOL., vol. 179, 2007, pages 6379 - 6383 |
| KRUSKAL, J. B.: "Time warps, string edits and macromolecules: the theory and practice of sequence comparison", 1983, ADDISON WESLEY, article "An overview of sequence comparison", pages: 1 - 44 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LANGER; TIRRELL, NATURE, vol. 428, no. 6982, 1 April 2004 (2004-04-01), pages 487 - 92 |
| LANGOWKSI ET AL., NATURE, vol. 442, 2006, pages 461 |
| LAPORTE SL ET AL., CELL, vol. 132, 2008, pages 259 - 272 |
| LASKOWSKI RA; MOSS DS; THORNTON JM: "Main-chain bond lengths and bond angles in protein structures", J MOL BIOL., vol. 231, 1993, pages 1049 - 1067, XP024008947, DOI: doi:10.1006/jmbi.1993.1351 |
| LEE J ET AL., J BIOL CHEM., vol. 276, 2001, pages 1660 - 1664 |
| LESLIE AGW, JOINT CCP4 + ESF-EAMCB NEWSLETTER ON PROTEIN CRYSTALLOGRAPHY, 1992, pages 26 |
| LI TS ET AL., CELL SIGNAL., vol. 18, 2006, pages 1287 - 1298 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 |
| LU ET AL., MOL. CANCER RES., vol. 4, 2006, pages 221 |
| LUND ET AL., J. IMMUNOL., vol. 147, 1991, pages 2657 |
| MAITRA A ET AL., PROC NATL ACAD SCI USA., vol. 104, 2007, pages 7506 - 7511 |
| MCCOY AJ ET AL.: "Phaser crystallographic software", J APPL CRYSTALLOGR, vol. 40, 2007, pages 658 - 674 |
| MCMAHAN ET AL., EMBO J., vol. 10, 1991, pages 2821 |
| MOSMANN TR; COFFMAN RL., ANNU REV IMMUNOL., vol. 7, 1989, pages 145 - 173 |
| MOSMANN, CURR. OPIN. IMMUNOL, vol. 5, 1991, pages 311 |
| MURPHY ET AL., PROTEIN EXPR PURIF., vol. 12, no. 2, March 1998 (1998-03-01), pages 208 - 14 |
| NEEDLEMAN, S. B.; WUNSCH, C. D., J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| NGUYEN; PECK, OCUL. SURF., vol. 7, no. 1, 2009, pages 11 - 27 |
| NOVATCHKOVA M ET AL., TRENDS BIOCHEM SCI., vol. 28, 2003, pages 226 - 229 |
| O'CONNOR W, JR ET AL., NAT IMMUNOL., vol. 10, 2009, pages 603 - 609 |
| ORLANDI ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 3833 |
| O'SHEA ET AL., CURR BIOL., vol. 3, no. 10, 1993, pages 658 - 67 |
| PARK H ET AL., NAT IMMUNOL., vol. 6, 2005, pages 1133 - 1141 |
| PAUL; SEDER, CELL, vol. 76, 1994, pages 241 |
| PICKSLEY ET AL.: "DNA Cloning 2: Expression Systems", 1995, OXFORD UNIVERSITY PRESS, article "Production of monoclonal antibodies against proteins expressed in E. coli" |
| QIAN Y ET AL., NAT IMMUNOL., vol. 8, 2007, pages 247 - 256 |
| RICE, P. ET AL.: "European Bioinformatics Institute (Cambridge UK) EMBOSS: The European Molecular Biology Open Software Suite", TRENDS IN GENETICS, vol. 16, no. 6, 2000, pages 276 - 277 |
| RICKEL EA ET AL., J IMMUNOL., vol. 181, 2008, pages 4299 - 4310 |
| RIDGWAY PROTEIN ENG., vol. 9, no. 7, July 1996 (1996-07-01), pages 617 - 2 |
| ROCHMAN Y; SPOLSKI R; LEONARD WJ, NAT REV IMMUNOL., vol. 9, 2009, pages 480 - 490 |
| RONG Z ET AL., CELL RES., vol. 19, 2009, pages 208 - 215 |
| SANDHU, CRIT. REV. BIOTECH., vol. 12, 1992, pages 437 |
| SCOPES: "Protein Purification: Principles and Practice", 2010, SPRINGER-VERLAG |
| See also references of EP2485763A4 |
| SHI ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 19167 - 19176 |
| SHI Y ET AL., J BIOL CHEM., vol. 275, 2000, pages 19167 - 19176 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 276, no. 9, 2001, pages 6591 |
| SINGER ET AL., J. IMMUN., vol. 150, 1993, pages 2844 |
| STEINER ET AL., PROSTATE, vol. 56, 2003, pages 171 |
| STRONG M ET AL., PROC NATL ACAD SCI USA., vol. 103, 2006, pages 8060 - 8065 |
| TARTOUR ET AL., CANCER RES., vol. 5P, 1999, pages 3698 |
| TAYLOR ET AL., INT. IMMUN., vol. 6, 1994, pages 579 |
| TIAN ET AL., ONCOGENE, vol. 19, 2000, pages 2098 - 2109 |
| TOMLINSON ET AL., EMBO J., vol. 14, no. 18, 1995, pages 4628 - 38 |
| TOMLINSON ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TOY D ET AL., J IMMUNOL., vol. 177, 2006, pages 36 - 39 |
| VAN'T H OF ET AL., RHEUMATOLOGY, vol. 39, 2000, pages 1004 - 1008 |
| VAN'T H OF ET AL., RHEUMATOTOGY, vol. 39, 2000, pages 1004 - 1008 |
| VON ANDRIAN; MACKAY, NEW ENGL. J. MED., vol. 343, 2000, pages 1020 |
| WALTER TS ET AL., STRUCTURE, vol. 14, 2006, pages 1617 - 1622 |
| WANG X; BALOH RH; MILBRANDT J; GARCIA KC, STRUCTURE, vol. 14, 2006, pages 1083 - 1092 |
| WANG X; LUPARDUS P; LAPORTE SL; GARCIA KC, ANNU REV IMMUNOL., vol. 27, 2009, pages 29 - 60 |
| WEAVER CT; HATTON RD; MANGAN PR; HARRINGTON LE, ANNU REV IMMUNOL., vol. 25, 2007, pages 821 - 852 |
| WEHRMAN T ET AL., NEURON, vol. 53, 2007, pages 25 - 38 |
| WIESMANN C ET AL., CELL, vol. 91, 1997, pages 695 - 704 |
| WIESMANN C; ULTSCH MH; BASS SH; DE VOS AM, NATURE, vol. 401, 1999, pages 184 - 188 |
| WOOLEY; TETLOW, ARTHRITIS RES, vol. 2, 2000, pages 65 - 70 |
| WRIGHT JF ET AL., J BIOL CHEM., vol. 282, 2007, pages 13447 - 13455 |
| WRIGHT JF ET AL., J IMMUNOL., vol. 181, 2008, pages 2799 - 2805 |
| XIONG ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 50273 - 50282 |
| YOU Z ET AL., CANCER RES., vol. 66, 2006, pages 175 - 183 |
| ZHENG Y ET AL., NAT MED., vol. 14, 2008, pages 282 - 289 |
Cited By (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11555061B2 (en) | 2009-02-11 | 2023-01-17 | Albumedix, Ltd | Albumin variants and conjugates |
| US10696732B2 (en) | 2009-10-30 | 2020-06-30 | Albumedix, Ltd | Albumin variants |
| US10233228B2 (en) | 2010-04-09 | 2019-03-19 | Albumedix Ltd | Albumin derivatives and variants |
| US8853150B2 (en) | 2010-07-29 | 2014-10-07 | Eleven Biotherapeutics, Inc. | Chimeric IL-1 receptor type I antagonists |
| US9458216B2 (en) | 2010-07-29 | 2016-10-04 | Eleven Biotherapeutics, Inc. | Nucleic acid encoding chimeric IL-1 receptor type I antagonists |
| WO2012138977A1 (en) * | 2011-04-06 | 2012-10-11 | Board Of Trustees Of The Leland Stanford Junior University | Structural based design of il-17 dominant negative mutants |
| US10815297B2 (en) | 2011-10-19 | 2020-10-27 | Morphosys Ag | Antagonists of IL17C for the treatment of inflammatory disorders |
| CN103974976A (zh) * | 2011-10-19 | 2014-08-06 | 莫佛塞斯公司 | 用于治疗炎性病症的il17c拮抗剂 |
| JP2014530836A (ja) * | 2011-10-19 | 2014-11-20 | モルフォシス・アー・ゲー | 炎症障害治療用のil17cのアンタゴニスト |
| WO2013059644A1 (en) * | 2011-10-21 | 2013-04-25 | Baylor College Of Medicine | Method to measure inflammation in the conjunctiva of patients with tear dysfunction |
| US10711050B2 (en) | 2011-11-18 | 2020-07-14 | Albumedix Ltd | Variant serum albumin with improved half-life and other properties |
| WO2013075066A2 (en) | 2011-11-18 | 2013-05-23 | Eleven Biotherapeutics, Inc. | Proteins with improved half-life and other properties |
| US10329340B2 (en) | 2012-03-16 | 2019-06-25 | Albumedix Ltd | Albumin variants |
| US9944691B2 (en) | 2012-03-16 | 2018-04-17 | Albumedix A/S | Albumin variants |
| US9574190B2 (en) | 2012-06-06 | 2017-02-21 | The University Of Tokyo | Screening method for peptide binding to target molecule in pH-dependent manner |
| JP2013253842A (ja) * | 2012-06-06 | 2013-12-19 | Univ Of Tokyo | pH依存的に標的分子に結合するペプチドのスクリーニング方法 |
| JP2024056989A (ja) * | 2012-06-12 | 2024-04-23 | オレガ・バイオテック | Il-17アイソフォームのアンタゴニストおよびその使用 |
| WO2013186236A1 (en) * | 2012-06-12 | 2013-12-19 | Orega Biotech | Antagonists of il-17 isoforms and their uses |
| EP3417878A1 (en) * | 2012-06-12 | 2018-12-26 | Orega Biotech | Antagonists of il-17 isoforms and their uses |
| US9834601B2 (en) | 2012-06-12 | 2017-12-05 | Orega Biotech | Antagonists of IL-17 isoforms and their uses |
| JP2020128388A (ja) * | 2012-06-12 | 2020-08-27 | オレガ・バイオテック | Il−17アイソフォームのアンタゴニストおよびその使用 |
| US10351623B2 (en) | 2012-06-12 | 2019-07-16 | Orega Biotech | Antagonists of IL-17 isoforms and their uses |
| US10934341B2 (en) | 2012-11-08 | 2021-03-02 | Albumedix, Ltd. | Albumin variants |
| US10501524B2 (en) | 2012-11-08 | 2019-12-10 | Albumedix Ltd | Albumin variants |
| US10799589B2 (en) | 2013-03-13 | 2020-10-13 | Buzzard Pharmaceuticals AB | Chimeric cytokine formulations for ocular delivery |
| US12485172B2 (en) | 2014-12-22 | 2025-12-02 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12296008B2 (en) | 2014-12-22 | 2025-05-13 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12485173B2 (en) | 2014-12-22 | 2025-12-02 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12544438B2 (en) | 2014-12-22 | 2026-02-10 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12599664B2 (en) | 2014-12-22 | 2026-04-14 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US10633428B2 (en) | 2015-08-20 | 2020-04-28 | Albumedix Ltd | Albumin variants and conjugates |
| US12116400B2 (en) | 2015-08-20 | 2024-10-15 | Sartorius Albumedix Limited | Albumin variants and conjugates |
| WO2020201442A1 (en) | 2019-04-03 | 2020-10-08 | Orega Biotech | Combination therapies based on pd1 and il-17b inhibitors |
| EP4681778A2 (en) | 2019-04-03 | 2026-01-21 | Orega Biotech | Combination therapies based on pd1 and il-17b inhibitors |
| WO2021023624A1 (en) * | 2019-08-02 | 2021-02-11 | Orega Biotech | Novel il-17b antibodies |
| WO2021170750A1 (en) | 2020-02-28 | 2021-09-02 | Orega Biotech | Combination therapies based on ctla4 and il-17b inhibitors |
| WO2022032592A1 (en) * | 2020-08-13 | 2022-02-17 | Tsinghua University | Interleukin-17d and cd93 as a new cytokine-receptor pair in the immune system |
Also Published As
| Publication number | Publication date |
|---|---|
| EA201270528A1 (ru) | 2012-12-28 |
| US20130064788A1 (en) | 2013-03-14 |
| IL219209A0 (en) | 2012-06-28 |
| CA2777222A1 (en) | 2011-04-14 |
| WO2011044563A3 (en) | 2011-06-03 |
| JP2013507132A (ja) | 2013-03-04 |
| EP2485763A4 (en) | 2013-10-30 |
| AU2010303166A1 (en) | 2012-05-24 |
| EP2485763A2 (en) | 2012-08-15 |
| BR112012008444A2 (pt) | 2019-09-24 |
| CN102648002A (zh) | 2012-08-22 |
| KR20120093932A (ko) | 2012-08-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20130064788A1 (en) | Il-17 family cytokine compositions and uses | |
| US20120269765A1 (en) | Cytokine compositions and methods of use thereof | |
| JP7538721B2 (ja) | 抗インターロイキン17a抗体、医薬組成物、およびその使用 | |
| JP6883591B2 (ja) | 抗ヒトインターロイキン−17aモノクローナル抗体、その製造方法及び使用 | |
| US5871740A (en) | Methods of using poxvirus p35 as a chemokine inhibitor and compositions therefore | |
| KR20080022539A (ko) | 키메라 단백질 | |
| KR102321861B1 (ko) | Il-17a 및 il-17f 모두에 대한 단일클론 항체 및 이의 용도 | |
| RU2478645C2 (ru) | Растворимый мутант рецептора фактора некроза опухоли | |
| JP5081277B2 (ja) | IL−1ゼータ、IL−1ゼータスプライス変異体およびXrec2のDNAおよびポリペプチド | |
| WO2011147320A1 (zh) | B细胞激活因子拮抗剂及其制备方法与用途 | |
| EP2319929A1 (en) | IL-1 related polypeptides | |
| CA2718634A1 (en) | Antibodies against interleukin-10-like cytokines and uses therefor | |
| JP2002533122A5 (https=) | ||
| JP4623342B2 (ja) | Il−1エータのdna及びポリペプチド | |
| US20140105855A1 (en) | Structural based design of il-17 dominant negative mutants | |
| US20120094935A1 (en) | Methods for creating or identifying compounds that bind tumor necrosis factor alpha | |
| Han et al. | Molecular cloning and characterization of chicken interferon-γ receptor α-chain | |
| AU2018423921B2 (en) | Anti-human interleukin 17A monoclonal antibody and application thereof | |
| WO2026036390A1 (zh) | 白介素12突变体及其用途 | |
| Fields | The Molecular Basis of Il-1 Family Signaling: Strategies to Modulate Inflammation | |
| EA046350B1 (ru) | Анти-интерлейкин-17а антитело, фармацевтическая композиция и их применение |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080053654.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10822826 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2777222 Country of ref document: CA Ref document number: 2012533384 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 219209 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010303166 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1094/KOLNP/2012 Country of ref document: IN Ref document number: 201270528 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20127011769 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010822826 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2010303166 Country of ref document: AU Date of ref document: 20101011 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13501244 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012008444 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012008444 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120410 |