WO2011003633A1 - Pegylated l-asparaginase - Google Patents

Pegylated l-asparaginase Download PDF

Info

Publication number
WO2011003633A1
WO2011003633A1 PCT/EP2010/054156 EP2010054156W WO2011003633A1 WO 2011003633 A1 WO2011003633 A1 WO 2011003633A1 EP 2010054156 W EP2010054156 W EP 2010054156W WO 2011003633 A1 WO2011003633 A1 WO 2011003633A1
Authority
WO
WIPO (PCT)
Prior art keywords
conjugate
asparaginase
peg
protein
administered
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2010/054156
Other languages
English (en)
French (fr)
Inventor
Thierry Abribat
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Jazz Pharmaceuticals PLC
Original Assignee
Alize Pharma 2 SAS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Alize Pharma 2 SAS filed Critical Alize Pharma 2 SAS
Priority to PE2012000023A priority Critical patent/PE20120501A1/es
Priority to MX2012000424A priority patent/MX2012000424A/es
Priority to NZ597912A priority patent/NZ597912A/en
Priority to PL10730170.7T priority patent/PL2451486T5/pl
Priority to FIEP10730170.7T priority patent/FI2451486T4/fi
Priority to ES10730170T priority patent/ES2636476T5/es
Priority to SI201031521T priority patent/SI2451486T2/sl
Priority to RS20170778A priority patent/RS57077B2/sr
Priority to EA201270134A priority patent/EA021168B1/ru
Priority to PE2016001555A priority patent/PE20161325A1/es
Priority to HK13100524.0A priority patent/HK1173092B/xx
Priority to SG2011096013A priority patent/SG176984A1/en
Priority to MYPI2012000054A priority patent/MY180758A/en
Priority to US13/382,276 priority patent/US20120100121A1/en
Priority to HRP20171180TT priority patent/HRP20171180T4/hr
Priority to JP2012518956A priority patent/JP6014956B2/ja
Priority to BR112012000367A priority patent/BR112012000367A2/pt
Priority to KR1020127003202A priority patent/KR101731999B1/ko
Priority to PT107301707T priority patent/PT2451486T/pt
Priority to MEP-2017-171A priority patent/ME02945B/me
Priority to MA34598A priority patent/MA33503B1/fr
Priority to LTEP10730170.7T priority patent/LT2451486T/lt
Priority to CA2767149A priority patent/CA2767149C/en
Priority to PCT/EP2010/059599 priority patent/WO2011003886A1/en
Priority to HUE10730170A priority patent/HUE035771T2/en
Priority to EP10730170.7A priority patent/EP2451486B2/en
Priority to DK10730170.7T priority patent/DK2451486T4/da
Priority to CN201080030392.6A priority patent/CN102573917B/zh
Priority to AU2010270294A priority patent/AU2010270294B2/en
Publication of WO2011003633A1 publication Critical patent/WO2011003633A1/en
Priority to IL217392A priority patent/IL217392A/en
Anticipated expiration legal-status Critical
Priority to IN958DEN2012 priority patent/IN2012DN00958A/en
Priority to CO12020409A priority patent/CO6612174A2/es
Priority to US14/819,305 priority patent/US9920311B2/en
Priority to CY20171100834T priority patent/CY1119779T1/el
Priority to US15/886,216 priority patent/US20180346900A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • C12N9/80Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
    • C12N9/82Asparaginase (3.5.1.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/50Hydrolases (3) acting on carbon-nitrogen bonds, other than peptide bonds (3.5), e.g. asparaginase
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/01Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amides (3.5.1)
    • C12Y305/01001Asparaginase (3.5.1.1)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention concerns a conjugate of a protein having substantial L-asparagine aminohydrolase activity and polyethylene glycol, particularly wherein the polyethylene glycol has a molecular weight less than or equal to about 5000 Da, particularly a conjugate wherein the protein is a L-asparaginase from Erwinia, and its use in therapy.
  • L- asparaginases Proteins with L-asparagine aminohydrolase activity, commonly known as L- asparaginases, have successfully been used for the treatment of Acute Lymphoblastic Leukemia
  • ALL in children for many years. ALL is the most common childhood malignancy (Avramis and Panosyan, Clin. Pharmacokinet. (2005) 44:367-393).
  • L-asparaginase has also been used to treat Hodgkin's disease, acute myelocytic leukemia, acute myelomonocytic leukemia, chronic lymphocytic leukemia, lymphosarcoma, reticulosarcoma, and melanosarcoma (Kotzia and Labrou, J. Biotechnol. 127 (2007) 657-669).
  • L-asparaginase The anti-tumor activity of L-asparaginase is believed to be due to the inability or reduced ability of certain malignant cells to synthesize L-asparagine (Kotzia and Labrou, J. Biotechnol. 127 (2007) 657-669). These malignant cells rely on an extracellular supply of L-asparagine. However, the L-asparaginase enzyme catalyzes the hydrolysis of L-asparagine to aspartic acid and ammonia, thereby depleting circulating pools of L-asparagine and killing tumor cells which cannot perform protein synthesis without L-asparagine (Kotzia and Labrou, J. Biotechnol. 127 (2007) 657-669).
  • L-asparaginase from E. coli was the first enzyme drug used in ALL therapy and has been marketed as Elspar® in the USA or as Kidrolase® and L-asparaginase Medac® in Europe.
  • L- asparaginases have also been isolated from other microorganisms, e.g., an L-asparaginase protein from Erwinia chrysanthemi, named crisantaspase, that has been marketed as Erwinase® (Wriston Jr., J.C. (1985) "L-asparaginase” Meth. Enzymol. 113, 608-618; Goward, CR. et al.
  • L-asparaginases of bacterial origin have a high immunogenic and antigenic potential and frequently provoke adverse reactions ranging from mild allergic reaction to anaphylactic shock in sensitized patients (Wang, B. et al. (2003) "Evaluation of immunologic cross reaction of anti- asparaginase antibodies in acute lymphoblastic leukemia (ALL and lymphoma patients),
  • E. coli L-asparaginase is particularly immunogenic, with reports of the presence of anti-asparaginase antibodies to E. coli L-asparaginase following i.v. or i.m. administration reaching as high as 78% in adults and 70% in children (Wang, B. et al. (2003) Leukemia 17, 1583-1588).
  • L-asparaginases from Escherichia coli and Erwinia chrysanthemi differ in their pharmacokinetic properties and have distinct immunogenic profiles, respectively (Klug Albertsen, B. et al. (2001) "Comparison of intramuscular therapy with Erwinia asparaginase and asparaginase Medac: pharmacokinetics, pharmacodynamics, formation of antibodies and influence on the coagulation system" Brit. J. Haematol. 115, 983-990). Furthermore, it has been shown that antibodies that developed after a treatment with L-asparaginase from E. coli do not cross react with L-Asparaginase from Erwinia (Wang, B.
  • L-asparaginase from Erwinia has been used as a second line treatment of ALL in patients that react to E. coli L-asparaginase (Duval, M. et al. (2002) "Comparison of Escherichia co/z-asparaginase with £Vwzm ' ⁇ -asparaginase in the treatment of childhood lymphoid malignancies: results of a randomized European Organisation for Research and Treatment of
  • Oncaspar® This so-called mPEG-L- asparaginase, or pegaspargase, marketed as Oncaspar® (Enzon Inc., USA), was first approved in the U.S. for second line treatment of ALL in 1994, and has been approved for first- line therapy of ALL in children and adults since 2006. Oncaspar® has a prolonged in vivo half-life and a reduced immunogenicity/antigenicity.
  • Oncaspar® is E. coli L-asparaginase that has been modified at multiple lysine residues using 5 kDa mPEG-succinimidyl succinate (SS-PEG) (U.S. Patent No. 4,179,337).
  • SS-PEG is a mPEG-succinimidyl succinate
  • PEG reagent of the first generation that contains an instable ester linkage that is sensitive to hydro lysis by enzymes or at slightly alkaline pH values (U.S. Patent No. 4,670,417; Makromol. Chem. 1986, 187, 1131-1144). These properties decrease both in vitro and in vivo stability and can impair drug safety.
  • Erwinia chrysanthemi L-asparaginase treatment is often used in the event of hypersensitivity to E. co/z-derived L-asparaginases. However, it has been observed that as many as 30-50% of patients receiving Erwinia L-asparaginase are antibody-positive (Avramis and
  • PEGylated In the case of proteins, the most important amino acids are lysine, cysteine, glutamic acid, aspartic acid, C-terminal carboxylic acid and the N-terminal amino group. In view of the wide range of reactive groups in a protein nearly the entire peptide chemistry has been applied to activate the PEG moiety. Examples for this activated PEG-reagents are activated carbonates, e.g., p-nitrophenyl carbonate, succinimidyl carbonate; active esters, e.g., succinimidyl ester; and for site specific coupling aldehydes and maleimides have been developed (Harris, M., Adv. Drug - A -
  • L-asparaginase preparations do not provide alternative or complementary therapies—particularly therapies to treat ALL— that are characterized by high catalytic activity and significantly improved pharmacological and pharmacokinetic properties, as well as reduced immunogenicity.
  • the present invention is directed to a conjugate of a protein having substantial L- asparagine aminohydrolase activity and polyethylene glycol, wherein the polyethylene glycol has a molecular weight less than or equal to about 5000 Da, particularly a conjugate where the protein is a L-asparaginase from Erwinia.
  • the conjugate comprises an L- asparaginase from Erwinia having at least 80% identity to the amino acid of SEQ ID NO:1 and polyethylene glycol (PEG), wherein the PEG has a molecular weight less than or equal to about 5000 Da.
  • the L-asparaginase has at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the amino acid of SEQ ID NO:1.
  • the PEG has a molecular weight of about 5000 Da, 4000, Da, 3000 Da, 2500 Da, or 2000 Da.
  • the conjugate has an in vitro activity of at least 60%, 65%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% as compared to the L- asparaginase when not conjugated to PEG.
  • the conjugate has an L- asparagine depletion activity at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 times more potent than the L-asparaginase when not conjugated to PEG.
  • the conjugate depletes plasma L-asparagine levels to an undetectable level for at least about 12, 24, 48, 96, 108, or 120 hours.
  • the conjugate has a longer in vivo circulating half life compared to the L-asparaginase when not conjugated to PEG.
  • the conjugate has a longer ti /2 than pegaspargase ⁇ i.e., PEG-conjugated L-asparaginase from E. col ⁇ ) administered at an equivalent protein dose (e.g., measured in ⁇ g/kg).
  • the conjugate has a Xy 2 of at least about 58 to about 65 hours at a dose of about 50 ⁇ g/kg on a protein content basis, and a Xy 2 of at least about 34 to about 40 hours at a dose of about 10 ⁇ g/kg on a protein content basis, following iv administration in mice.
  • the conjugate has a Xy 2 of at least about 100 to about 200 hours at a dose ranging from about 10,000 to about 15,000 IU/m (about 20-30 mg protein/m ).
  • the conjugate has a greater area under the curve (AUC) compared to the L-asparaginase when not conjugated to PEG.
  • the conjugate has a mean AUC that is at least about 3 times greater than pegaspargase at an equivalent protein dose.
  • the PEG is covalently linked to one or more amino groups (wherein
  • amino groups includes lysine residues and/or the N-terminus) of the L-asparaginase.
  • the PEG is covalently linked to the one or more amino groups by an amide bond.
  • the PEG is covalently linked to at least from about 40% to about 100% of the accessible amino groups (e.g., lysine residues and/or the N-terminus of the protein) or at least from about 40% to about 90% of total amino groups (e.g., lysine residues and/or the N-terminus of the protein).
  • the conjugate has the formula:
  • Asp is the L-asparaginase
  • NH is one or more of the NH groups of the lysine residues and/or the N-terminus of the Asp
  • PEG is a polyethylene glycol moiety
  • n is a number that represents at least about 40% to about 100% of the accessible amino groups (e.g., lysine residues and/or the N-terminus) in the Asp
  • x is an integer ranging from about 1 to about 8, more specifically, from about 2 to about 5.
  • the PEG is monomethoxy- polyethylene glycol (mPEG).
  • the invention is directed to a method of making a conjugate comprising combining an amount of PEG with an amount of the L-asparaginase in a buffered solution for a time period sufficient to covalently link the PEG to the L-asparaginase.
  • the invention is directed to a pharmaceutical composition comprising the conjugate of the invention.
  • the invention is directed to a method of treating a disease treatable by
  • the disease is a cancer.
  • the cancer is ALL.
  • the conjugate is administered at an amount of about 5 U/kg body weight to about 50 U/kg body weight.
  • the conjugate is administered at a dose ranging from about 10,000 to about 15,000 IU/m (about 20-30 mg protein/m ).
  • the administration may be intravenous or intramuscular and may be less than once per week (e.g., once per month or once every other week), once per week, twice per week, or three times per week.
  • the conjugate is administered as monotherapy and, more specifically, without an asparagine synthetase inhibitor. In other embodiments, the conjugate is administered as part of a combination therapy (but in some embodiments, the combination therapy does not comprise an asparagine synthetase inhibitor).
  • the patient receiving treatment has had a previous hypersensitivity to an E. coli asparaginase or PEGylated form thereof or to an Erwinia asparaginase.
  • the patient receiving treatment has had a disease relapse, in particular a relapse that occurs after treatment with an E. coli asparaginase or PEGylated form thereof.
  • Figure 1 SDS-polyacrylamide gel electrophoresis of purified recombinant Erwinia chrysanthemi L-asparaginase.
  • Purified recombinant Erwinia chrysanthemi L-asparaginase (r- crisantaspase) was analyzed on SDS-PAGE. Protein bands were stained with silver nitrate. Lane
  • lane 1 Molecular Weight Marker (116, 66.2, 45, 35, 25, 18.4, and 14.4kDa), lane 2: purified recombinant Erwinia chrysanthemi L-asparaginase (r-crisantaspase).
  • Figure 2 SDS-PAGE analysis of mPEG-r-crisantaspase conjugates.
  • FIG. 3 Plasma L-asparagine levels following a single intravenous dose of Erwinase®
  • Figure 4 Plasma L-asparagine levels following a single intravenous injection of mPEG- r-crisantaspase conjugates compared to Erwinase® in mice.
  • the numbers "40%” and “100%” indicate an approximate degree of PEGylation of, respectively, about 40-55% (partially PEGylated) and about 100% (maximally PEGylated) of the accessible amino groups.
  • Figure 5 Area under the curves (AUC) (residual enzymatic activity) calculated from L- asparaginase profiles following a single intravenous injection of mPEG-r-crisantaspase conjugates in mice.
  • AUC Area under the curves
  • Figure 6 Plasma L-asparagine levels following a single intravenous dose in mice of 2 kDa-100% mPEG-r-crisantaspase (5U/kg, 25U/kg and 50U/kg body weight) ( Figure 6A), 5 kDa- 100% mPEG-r-crisantaspase (5U/kg, 25U/kg and 50U/kg body weight) ( Figure 6B), or 2 kDa- 100% mPEG-r-crisantaspase (5U/kg), 5 kDa-100% mPEG-r-crisantaspase (5U/kg), and pegaspargase (Oncaspar®) (1 U/kg) ( Figure 6C).
  • Figure 6A Plasma L-asparagine levels following a single intravenous dose in mice of 2 kDa-100% mPEG-r-crisantaspase (5U/kg, 25U/kg and 50U/kg body weight)
  • Figure 6B Plasma L-
  • Figure 7 Dose-effect Relationship of 2 kDa-100% PEGylated r-crisantaspase compared to 5 kDa-100% PEGylated r-crisantaspase.
  • Figure 7A shows the residual enzymatic activity in plasma following a single intravenous dose of 2 kDa-100% PEGylated r-crisantaspase at 5 U/kg (lO ⁇ g/kg on a protein content basis), 25 U/kg, and 50 U/kg.
  • Figure 7B shows the residual enzymatic activity in plasma following a single intravenous dose of 5 kDa-100% PEGylated r- crisantaspase at 5 U/kg (lO ⁇ g/kg on a protein content basis), 25 U/kg, and 50 U/kg.
  • Figure 8 Dose-effect relationship of 2 kDa-100% PEGylated r-crisantaspase compared to 5 kDa-100% PEGylated r-crisantaspase. AUCs of the residual enzymatic activity measured in mice after a single intravenous dose of 2 kDa-100% or 5 kDa-100% mPEG-conjugates. Overall, when compared at the same dose level, AUCs measured for the 5 kDa-100% mPEG-r- crisantaspase were higher than those observed for the 2-kDa-100% mPEG-r-crisantaspase. A difference of 31, 37, and 14% was observed at 5, 25, and 50 U/kg doses, respectively.
  • Figure 9 Pharmacokinetics of mPEG-r-crisantaspase conjugates vs. pegaspargase
  • Figure 9A represents the residual enzymatic activity measured in mice after a single intravenous dose of 2 kDa-100% mPEG-r-crisantaspase, 5 kDa-100% mPEG-r- crisantaspase, or pegaspargase (Oncaspar®).
  • Figure 9B represents AUCs of the residual enzymatic activity measured in mice after a single intravenous dose of 2 kDa-100% mPEG-r- crisantaspase, 5 kDa-100% mPEG-r-crisantaspase, or pegaspargase (Oncaspar®).
  • Figure 11 Serum levels of anti-conjugate specific antibodies after treatment with mPEG-r-crisantaspase maximally (100%) PEGylated conjugates.
  • Figure 1 IB results presented as the percentage of animals with absorbance values > 0.5 in the anti-conjugate ELISA.
  • the problem to be solved by the invention is to provide an L-asparaginase preparation with:
  • Described herein is a PEGylated L-asparaginase from Erwinia with improved pharmacological properties as compared with the unmodified L-asparaginase protein, as well as compared to the pegaspargase preparation from E. coli.
  • the PEGylated L-asparaginase conjugate described herein e.g., Erwinia chrysanthemi L-asparaginase PEGylated with 5000 Da molecular weight PEG, serves as a therapeutic agent particularly for use in patients who show hypersensitivity (e.g., an allergic reaction or silent hypersensitivity) to treatment with L- asparaginase or PEGylated L-asparaginase from E.
  • the PEGylated L-asparaginase conjugate described herein is also useful as a therapeutic agent for use in patients who have had a disease relapse, e.g., a relapse of ALL, and have been previously treated with another form of asparaginase, e.g., with L-asparaginase or PEGylated L-asparaginase from E. coli.
  • the conjugate of the invention shows unexpectedly superior properties compared to known L-asparaginase preparations such as pegaspargase.
  • L-asparaginase preparations such as pegaspargase.
  • unmodified L-asparaginase from Erwinia chrysanthemi crisantaspase
  • has a significantly lower half-life than unmodified L-asparaginase from E. coli Avramis and Panosyan, Clin. Pharmacokinet. (2005) 44:367-393, incorporated herein by reference in its entirety.
  • the PEGylated conjugate of the invention has a half life that is greater than PEGylated L-asparaginase from E. coli at an equivalent protein dose. Definitions
  • disease treatable by depletion of asparagine refers to a condition or disorder wherein the cells involved in or responsible for the condition or disorder either lack or have a reduced ability to synthesize L-asparagine.
  • Depletion or deprivation of L- asparagine can be partial or substantially complete (e.g., to levels that are undetectable using methods and apparatus that are known in the art).
  • the term "therapeutically effective amount” refers to the amount of a protein ⁇ e.g., asparaginase or conjugate thereof), required to produce a desired therapeutic effect.
  • the protein according to the invention is an enzyme with L-asparagine aminohydrolase activity, namely an L-asparaginase.
  • L-asparaginase proteins have been identified in the art, isolated by known methods from microorganisms. ⁇ See, e.g., Savitri and Azmi, Indian J. Biotechnol 2 (2003) 184- 194, incorporated herein by reference in its entirety). The most widely used and commercially available L-asparaginases are derived from E. coli or from Erwinia chrysanthemi, both of which share 50% or less structural homology.
  • Erwinia L-asparaginases include, for example, those provided in Table 1 : Table 1
  • L-asparaginases used in therapy are L-asparaginase isolated from E. coli and from Erwinia, specifically, Erwinia chrysanthemi.
  • the L-asparaginases may be native enzymes isolated from the microorganisms. They can also be produced by recombinant enzyme technologies in producing microorganisms such as E. coli.
  • the protein used in the conjugate of the invention can be a protein form E. coli produced in a recombinant E. coli producing strain, of a protein from an Erwinia species, particularly Erwinia chrysanthemi, produced in a recombinant E. coli producing strain.
  • Enzymes can be identified by their specific activities. This definition thus includes all polypeptides that have the defined specific activity also present in other organisms, more particularly in other microorganisms. Often enzymes with similar activities can be identified by their grouping to certain families defined as PFAM or COG.
  • PFAM protein family database of alignments and hidden Markov models; http : //pfam. sangcr. ac .uk/) represents a large collection of protein sequence alignments. Each PFAM makes it possible to visualize multiple alignments, see protein domains, evaluate distribution among organisms, gain access to other databases, and visualize known protein structures.
  • COGs Clusters of Orthologous Groups of proteins; http://www.ncbi.nlm.nih.gov/CQG/) are obtained by comparing protein sequences from 43 fully sequenced genomes representing 30 major phylogenetic lines. Each COG is defined from at least three lines, which permits the identification of former conserved domains.
  • the means of identifying homologous sequences and their percentage homology and/or identity are well known to those skilled in the art, and include in particular the BLAST programs, which can be used from the website httpi//bJasyicbjj]]rajiiLgoy/B]ast 1 cgi with the default parameters indicated on that website.
  • the sequences obtained can then be exploited (e.g., aligned) using, for example, the programs CLUSTALW (http://wwwxbi.ae ⁇ Lk/Tools/clustalw2/indexJitinl) or MULTALIN with the default parameters indicated on those websites.
  • the L-asparaginase protein has at least about 80% homology or identity with the protein comprising the sequence of SEQ ID NO:1, more specifically at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% homology or identity with the protein comprising the sequence of SEQ ID NO:1.
  • SEQ ID NO:1 is as follows:
  • SEQ ID NO:1 RSTRTGNGIVPPDEELPGLVSDSLNPAHARILLMLALTRTSDPKVIQEYFHTY (SEQ ID NO:1) [0048]
  • the term "comprising the sequence of SEQ ID NO:1" means that the amino-acid sequence of the protein may not be strictly limited to SEQ ID NO:1 but may contain additional amino-acids.
  • the protein is the L-asparaginase of Erwinia chrysanthemi having the sequence of SEQ ID NO:1.
  • the L-asparaginase is from Erwinia chrysanthemi NCPPB 1066 (Genbank Accession No. CAA32884, incorporated herein by reference in its entirety), either with or without signal peptides and/or leader sequences.
  • Fragments of the protein of SEQ ID NO:1 are also comprised within the definition of the protein used in the conjugate of the invention.
  • the term "a fragment of SEQ ID NO:1" means that the sequence of the polypeptide may include less amino-acid than SEQ ID NOl but still enough amino-acids to confer L-aminohydrolase activity.
  • a polypeptide can be modified by substitution, insertion, deletion and/or addition of one or more amino-acids while retaining its enzymatic activity. For example, substitution of one amino-acid at a given position by a chemically equivalent amino- acid that does not affect the functional properties of a protein is common. Substitutions may be defined as exchanges within one of the following groups:
  • the positions where the amino-acids are modified and the number of amino-acids subject to modification in the amino-acid sequence are not particularly limited. The skilled artisan is able to recognize the modifications that can be introduced without affecting the activity of the protein. For example, modifications in the N- or C-terminal portion of a protein may be expected not to alter the activity of a protein under certain circumstances. With respect to asparaginases, in particular, much characterization has been done, particularly with respect to the sequences, structures, and the residues forming the active catalytic site. This provides guidance with respect to residues that can be modified without affecting the activity of the enzyme. All known L-asparaginases from bacterial sources have common structural features.
  • the active site flexible loop contains amino acid residues 14-33, and structural analysis show that Thrl5, Thr95, Ser62, Glu63, Asp96, and Alal20 contact the ligand (Papageorgiou et al, FEBS J. 275 (2008) 4306-4316).
  • Aghaipour et al have conducted a detailed analysis of the four active sites of Erwinia chrysanthemi L- asparaginase by examining high resolution crystal structures of the enzyme complexed with its substrates (Aghaipour et al, Biochemistry 40 (2001) 5655-5664).
  • Kotzia et al provide sequences for L-asparaginases from several species and subspecies of Erwinia and, even though the proteins have only about 75-77% identity between Erwinia chrysanthemi and Erwinia carotovora, they each still have L-asparaginase activity (Kotzia et al, J. Biotechnol. 127 (2007)
  • Polymers are selected from the group of non-toxic water soluble polymers such as polysaccharides, e.g. hydroxyethyl starch, poly amino acids, e.g. poly lysine, polyester, e.g., polylactic acid, and poly alkylene oxides, e.g., polyethylene glycol (PEG).
  • non-toxic water soluble polymers such as polysaccharides, e.g. hydroxyethyl starch, poly amino acids, e.g. poly lysine, polyester, e.g., polylactic acid, and poly alkylene oxides, e.g., polyethylene glycol (PEG).
  • Polyethylene glycol (PEG) or mono-methoxy-polyethyleneglycol (mPEG) is well known in the art and comprises linear and branched polymers. Examples of some polymers, particularly PEG, are provided in the following, each of which is herein incorporated by reference in its entirety: US Pat. No. 5,672,662; US Pat. No. 4,179,337; US Pat. No. 5,252,714; US Pat. Appl.
  • the quality of such polymers is characterized by the polydispersity index (PDI).
  • PDI polydispersity index
  • the PDI reflects the distribution of molecular weights in a given polymer sample and is calculated from the weight average molecular weight divided by the number average molecular weight. It indicates the distribution of individual molecular weights in a batch of polymers.
  • the polyethylene glycol has advantageously a molecular weight comprised within the range of about 500 Da to about 9,000 Da. More specifically, the polyethylene glycol (e.g, mPEG) has a molecular weight selected from the group consisting of polyethylene glycols of 2000 Da, 2500 Da, 3000 Da, 3500 Da, 4000 Da, 4500 Da, and 5000 Da. In a particular embodiment, the polyethylene glycol (e.g., mPEG) has a molecular weight of 5000 Da.
  • the polymer moiety contains an activated functionality that preferably reacts with amino groups in the protein.
  • the invention is directed to a method of making a conjugate, the method comprising combining an amount of polyethylene glycol (PEG) with an amount of L- asparaginase in a buffered solution for a time period sufficient to covalently link the PEG to the L-asparaginase.
  • PEG polyethylene glycol
  • the L-asparaginase is from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the PEG is monomethoxy-poly ethylene glycol (mPEG).
  • the reaction between the polyethylene glycol and L-asparaginase is performed in a buffered solution.
  • the pH value of the buffer solution ranges between about 7.0 and about 9.0.
  • the most preferred pH value ranges between about 7.5 and about 8.5, e.g., a pH value of about 7.5, 7.6,7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, or 8.5.
  • the L-asparaginase is from Erwinia species, more specifically
  • Erwinia chrysanthemi and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO: 1.
  • PEGylation of L-asparaginase is performed at protein concentrations between about 0.5 and about 25 mg/mL, more specifically between about 2 and about 20 mg/mL and most specifically between about 3 and about 15 mg/mL.
  • the protein concentration is about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 mg/mL.
  • the PEGylation of L-asparaginase at these protein concentrations is of Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the PEGylation reaction proceeds rapidly, within less than 2 hours. Furthermore, a molar excess of polymer over amino groups in L-asparaginase of less than about 20:1 is applied. For example, the molar excess is less than about 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11 :1, 10:1, 9:1, 8:1, 7.5:1, 7:1, 6.5:1, 6:1, 5.5:1, 5:1, 4.5:1, 4:1, 3.5:1, 3:1, 2.5:1, 2:1, 1.5:1, or 1 :1.
  • the molar excess is less than about 10:1 and in a more specific embodiment, the molar excess is less than about 8:1.
  • the L-asparaginase is from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the number of PEG moieties which can be coupled to the protein will be subject to the number of free amino groups and, even more so, to which amino groups are accessible for a
  • the degree of PEGylation i.e., the number of PEG moieties coupled to amino groups on the L-asparaginase
  • the degree of PEGylation is within a range from about 10% to about 100% of free and/or accessible amino groups (e.g., about 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%).
  • 100% PEGylation of accessible amino groups is also referred to herein as “maximally PEGylated.”
  • One method to determine the modified amino groups in mPEG-r- crisantaspase conjugates is a method described by Habeeb (A.F.S.A. Habeeb, "Determination of free amino groups in proteins by trinitrobenzensulfonic acid", Anal. Biochem. 14 (1966), p. 328, incorporated herein by reference in its entirety).
  • the PEG moieties are coupled to one or more amino groups (wherein amino groups include lysine residues and/or the N-terminus) of the L-asparaginase.
  • the degree of PEGylation is within a range of from about 10% to about 100% of total or accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus), e.g., about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100%.
  • 100% of the total amino groups ⁇ e.g., lysine residues and/or the N-terminus) are coupled to a PEG moiety.
  • the accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus are coupled to a PEG moiety.
  • 40-55% or 100% of the accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus) are coupled to a PEG moiety.
  • the PEG moieties are coupled to the L-asparaginase by a covalent linkage.
  • the L-asparaginase is from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate of the invention can be represented by the formula
  • Asp is a L-asparaginase protein
  • NH is the NH group of a lysine residue and/or the N- terminus of the protein chain
  • PEG is a polyethylene glycol moiety
  • n is a number of at least 40% to about 100% of the accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus) in the protein, all being defined above and below in the examples
  • x is an integer ranging from 1 to 8 (e.g., 1, 2, 3, 4, 5, 6, 7, 8), preferably 2 to 5 (e.g., 2, 3, 4, 5).
  • the L-asparaginase is from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • Other methods of PEGylation that can be used to form the conjugates of the invention are provided, for example, in U.S. Pat. No. 4,179,337, U.S. Pat. No. 5,766,897, U.S. Pat. Appl. Publ. No. US 2002/0065397A1, and U.S. Pat. Appl. Publ. No. US 2009/0054590A1, each of which is herein incorporated by reference in its entirety.
  • proteins having substantial L-Asparagine aminohydrolase activity and polyethylene glycol selected from the group of conjugates wherein:
  • the protein has at least 90% homology of structure with the L-asparaginase from Erwinia chrysanthemi as disclosed in SEQ ID NO:1 - the polyethylene glycol has a molecular weight of about 5000 Da,
  • the protein has at least 90% homology with the L-asparaginase from Erwinia chrysanthemi as disclosed in SEQ ID NO:1
  • the polyethylene glycol has a molecular weight of about 5000 Da, - the protein and polyethylene glycol moieties are covalently linked to the protein by amide bonds, and
  • the protein has at least 90% homology with the L-asparaginase from Erwinia chrysanthemi as disclosed in SEQ ID NO:1
  • the polyethylene glycol has a molecular weight of about 2000 Da, - the protein and polyethylene glycol moieties are covalently linked to the protein by amide bonds, and
  • the protein has at least 90% homology with the L-asparaginase from Erwinia chrysanthemi as disclosed in SEQ ID NO:1
  • the polyethylene glycol has a molecular weight of about 2000 Da, - the protein and polyethylene glycol moieties are covalently linked to the protein by amide bonds, and
  • Conjugates of the invention have certain advantageous and unexpected properties compared to unmodified L-asparaginases, particularly compared to unmodified Erwinia L- asparaginases, more particularly compared to unmodified L-asparaginase from Erwinia chrysanthemi, and more particularly compared to unmodified L-asparaginase having the sequence of SEQ ID NO: 1.
  • the conjugate of the invention reduces plasma L-asparagine levels for a time period of at least about 12, 24, 48, 72, 96, or 120 hours when administered at a dose of 5 U/kg body weight (bw) or 10 ⁇ g/kg (protein content basis). In other embodiments, the conjugate of the invention reduces plasma L-asparagine levels to undetectable levels for a time period of at least about 12, 24, 48, 72, 96, 120, or 144 hours when administered at a dose of 25
  • the conjugate of the invention reduces plasma L-asparagine levels for a time period of at least about 12, 24, 48, 72, 96, 120, 144, 168, 192, 216, or 240 hours when administered at a dose of 50 U/kg bw or 100 ⁇ g/kg (protein content basis). In another embodiment, the conjugate of the invention reduces plasma L-asparagine levels to undetectable levels for a time period of at least about 12, 24, 48,
  • the conjugate comprises L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da.
  • at least about 40% to about 100% of accessible amino groups are PEGylated.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 40-55% accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus) with 5000 Da mPEG.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 100% accessible amino groups (e.g., lysine residues and/or the N-terminus) with 5000 Da mPEG.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 40-55% accessible amino groups (e.g., lysine residues and/or the N-terminus) with 10,000 Da mPEG.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 100% accessible amino groups (e.g., lysine residues and/or the N-terminus) with 10,000 Da mPEG.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 40-55% accessible amino groups ( ⁇ -g-, lysine residues and/or the N-terminus) with 2,000 Da mPEG.
  • the conjugate comprises a ratio of mol PEG/mol monomer of about
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1, with PEGylation of approximately 100% accessible amino groups
  • the conjugate of the invention has an increased potency of at least about 10 times, 20 times, 30 times, 40 times, 50 times, 60 times, 70 times, 80 times, 90 times, or
  • the conjugate with these properties comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L- asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about
  • At least about 40% to about 100% of accessible amino groups are PEGylated.
  • the conjugate of the invention has a pharmacokinetic profile according to the following parameters:
  • the half-life time of the residual enzyme activity in plasma is derived from the following formula:
  • t l/2 In(C 1 / C 0 ) where Xy 2 is the half-life, t is the time point, c t is the residual plasma activity at the time point and Co the residual plasma activity at the beginning.
  • Area under the curve (AUC) is calculated using a pharmacokinetics software program, e.g., SigmaPlot Versionl 1.
  • the conjugate of the invention has a single-dose pharmacokinetic profile according to the following, specifically wherein the conjugate comprises mPEG at molecular weight of less than or equal to 2000 Da and an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1 :
  • a max about 150 U/L to about 250 U/L;
  • T Am a x about 4h to about 8h, specifically about 6h;
  • AUC about 12000 to about 30000
  • the conjugate of the invention has a single-dose pharmacokinetic profile according to the following, specifically where the conjugate comprises mPEG at molecular weight of less than or equal to 5000 Da and an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1 :
  • a max about 18 U/L to about 250 U/L;
  • T Am3x about Ih to about 5Oh
  • AUC about 500 to about 35000.
  • the conjugate of the invention results in a similar level of L- asparagine depletion over a period of time (e.g., 24, 48, or 72 hours) after a single dose compared to an equivalent quantity of protein of pegaspargase.
  • the conjugate comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da.
  • at least about 40% to about 100% of accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus) are PEGylated, more particularly about 40-55% or 100%.
  • the conjugate of the invention has a longer Xy 2 than pegaspargase administered at an equivalent protein dose.
  • the conjugate has a Xy 2 of at least about 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, or 65 hours at a dose of about 50 ⁇ g/kg (protein content basis).
  • the conjugate has a ti /2 of at least about 30, 32, 34, 36, 37, 38, 39, or 40 hours at a dose of about 10 ⁇ g/kg (protein content basis).
  • the conjugate has a ty 2 of at least about 100 to about 200 hours at a dose ranging from about 10,000 to about 15,000 IU/m 2 (about 20-30 mg protein/m 2 ).
  • the conjugate of the invention has a mean AUC that is at least about
  • the conjugate of the invention does not raise any significant antibody response for a particular period of time after administration of a single dose, e.g, greater than about 1 week, 2 weeks, 3 weeks, 4, weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks,
  • the conjugate of the invention does not raise any significant antibody response for at least 8 weeks.
  • "does not raise any significant antibody response” means that the subject receiving the conjugate is identified within art-recognized parameters as "antibody-negative.”
  • Antibody levels can be determined by methods known in the art, for example ELISA or surface plasmon resonance
  • Conjugates of the invention may have any combination of these properties.
  • the conjugates of the invention can be used in the treatment of a disease treatable by depletion of asparagine.
  • the conjugate is useful in the treatment or the manufacture of a medicament for use in the treatment of acute lymphoblastic leukemia (ALL) in both adults and children, as well as other conditions where asparagine depletion is expected to have a useful effect.
  • ALL acute lymphoblastic leukemia
  • Such conditions include, but are not limited to the following: malignancies, or cancers, including but not limited to hematalogic malignancies, non-Hodgkin's lymphoma, NK lymphoma, pancreatic cancer, Hodgkin's disease, acute myelocytic leukemia, acute myelomonocytic leukemia, chronic lymphocytic leukemia, lymphosarcoma, reticulosarcoma, and melanosarcoma.
  • Representative non-malignant hematologic diseases which respond to asparagine depletion include immune system-mediated blood diseases, e.g., infectious diseases such as those caused by HIV infection (i.e., AIDS).
  • Non-hematologic diseases associated with asparagine dependence include autoimmune diseases, for example rheumatoid arthritis, SLE, autoimmune, collagen vascular diseases, AIDS, etc.
  • Other autoimmune diseases include osteoarthritis, Issac's syndrome, psoriasis, insulin dependent diabetes mellitus, multiple sclerosis, sclerosing panencephalitis, systemic lupus erythematosus, rheumatic fever, inflammatory bowel disease (e.g., ulcerative colitis and Crohn's disease), primary billiary cirrhosis, chronic active hepatitis, glomerulonephritis, myasthenia gravis, pemphigus vulgaris, and Graves' disease.
  • autoimmune diseases for example rheumatoid arthritis, SLE, autoimmune, collagen vascular diseases, AIDS, etc.
  • Other autoimmune diseases include osteoarthritis, Issac's syndrome, psoriasis, insulin
  • the invention is directed to a method of treating a disease treatable in a patient, the method comprising administering to the patient an effective amount of a conjugate of the invention.
  • the disease is ALL.
  • the conjugate used in the treatment of a disease treatable by asparagine depletion comprises an L- asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da.
  • at least about 40% to about 100% of accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus) are PEGylated, more particularly about 40-55% or 100%.
  • treatment with a conjugate of the invention will be administered as a first line therapy.
  • treatment with a conjugate of the invention will be administered as a second line therapy in patients, particularly patients with ALL, where objective signs of allergy or hypersensitivity, including "silent hypersensitivity,” have developed to other asparaginase preparations, in particular, the native Escherichia co/z-derived L-asparaginase or its PEGylated variant (pegaspargase).
  • objective signs of allergy or hypersensitivity include testing "antibody positive" for an asparaginase enzyme.
  • the conjugate of the invention is used in second line therapy after treatment with pegaspargase.
  • the conjugate used in second line therapy comprises an L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate further comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da, more specifically about 5000 Da.
  • PEG e.g., mPEG
  • at least about 40% to about 100% of accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus
  • the invention is directed to a method for treating acute lymphoblastic leukemia comprising administering to a patient in need of the treatment a therapeutically effective amount of a conjugate of the invention.
  • treatment will be administered at a dose ranging from about 1500 IU/m 2 to about 15,000 IU/m 2 , typically about 10,000 to about 15,000 IU/m (about 20-30 mg protein/m ), at a schedule ranging from about twice a week to about once a month, typically once per week or once every other week, as a single agent (e.g., monotherapy) or as part of a combination of chemotherapy drugs, including, but not limited to glucocorticoids, corticosteroids, anticancer compounds or other agents, including, but not limited to methotrexate, dexamethasone, prednisone, prednisolone, vincristine, cyclophosphamide, and anthracycline.
  • conjugate of the invention As an example, patients with ALL will be administered the conjugate of the invention as a component of multi-agent chemotherapy during 3 chemotherapy phases including induction, consolidation or intensification, and maintenance.
  • the conjugate is not administered with an asparagine synthetase inhibitor
  • the conjugate is not administered with an asparagine synthetase inhibitor, but is administered with other chemotherapy drugs.
  • the conjugate can be administered before, after, or simultaneously with other compounds as part of a multi-agent chemotherapy regimen.
  • the conjugate comprises L- asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da.
  • PEG e.g., mPEG
  • at least about 40% to about 100% of accessible amino groups are PEGylated, more particularly about 40-55% or 100%.
  • the method comprises administering a conjugate of the invention at an amount of about lU/kg to about 25 U/kg (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 U/kg) or an equivalent amount thereof (e.g., on a protein content basis).
  • the conjugate is administered at an amount selected from the group consisting of about 5, about 10, and about 25 U/kg.
  • the conjugate is administered at a dose ranging from about 1,000 IU/m 2 to about 20,000 IU/m 2 (e.g., 1,000 IU/m 2 , 2,000 IU/m 2 , 3,000 IU/m 2 , 4,000 IU/m 2 , 5,000 IU/m 2 , 6,000 IU/m 2 , 7,000 IU/m 2 , 8,000 IU/m 2 , 9,000 IU/m 2 , 10,000 IU/m 2 , 11,000 IU/m 2 , 12,000 IU/m 2 , 13,000 IU/m 2 , 14,000 IU/m 2 , 15,000 IU/m 2 , 16,000 IU/m 2 , 17,000 IU/m 2 , 18,000
  • the conjugate is administered at a dose that depletes L-asparagine to undetectable levels using methods and apparatus known in the art for a period of about 3 days to about 10 days (e.g., 3, 4, 5, 6, 7, 8, 9, or 10 days) for a single dose.
  • the method comprises administering a conjugate of the invention that elicits a lower immunogenic response in a patient compared to an unconjugated L-asparaginase.
  • the method comprises administering a conjugate of the invention that has a longer in vivo circulating half-life after a single dose compared to the unconjugated L-asparaginase.
  • the method comprises administering a conjugate that has a longer Xy 2 than pegaspargase administered at an equivalent protein dose.
  • the method comprises administering a conjugate that has a Xy 2 of at least about 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, or 65 hours at a dose of about 50 ⁇ g/kg (protein content basis).
  • the method comprises administering a conjugate that has a ti /2 of at least about 30, 32, 34, 36, 37, 37, 39, or 40 hours at a dose of about 10 ⁇ g/kg (protein content basis).
  • the method comprises administering a conjugate that has a ty 2 of at least about 100 to about 200 hours at a dose ranging from about 10,000 to about 15,000 IU/m 2 (about 20-30 mg protein/m 2 ).
  • the method comprises administering a conjugate that has a mean AUC that is at least about 2, 3, 4 or 5 times greater than pegaspargase at an equivalent protein dose.
  • the method comprises administering a conjugate of the invention that has a greater AUC value after a single dose compared to the unconjugated L-asparaginase.
  • the conjugate comprises L-asparaginase from Erwinia species, more specifically
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da.
  • PEG e.g., mPEG
  • at least about 40% to about 100% of accessible amino groups ⁇ e.g., lysine residues and/or the N- terminus
  • the conjugate of the invention may be used in a method of treating patients with relapsed ALL who were previously treated with other asparaginase preparations, in particular those who were previously treated with E. co/z ' -derived asparaginases.
  • the uses and methods of treatment of the invention comprise administering an L-asparaginase conjugate having properties or combinations of properties described herein above ⁇ e.g., in the section entitled "L-asparaginase PEG conjugates") or herein below.
  • compositions Compositions, Formulations, and Routes of Administration
  • the invention also includes a pharmaceutical composition comprising a conjugate of the invention.
  • the pharmaceutical composition is contained in a vial as a lyophilized powder to be reconstituted with a solvent, such as currently available native L- asparaginases, whatever the bacterial source used for its production (Kidrolase®, Elspar®, Erwinase®).
  • the pharmaceutical composition is a "ready to use " solution, such as pegaspargase (Oncaspar®) enabling, further to an appropriate handling, an administration through, e.g., intramuscular, intravenous (infusion and/or bolus), intra-cerebro- ventricular (icv), sub-cutaneous routes.
  • Conjugates of the invention including compositions comprising conjugates of the invention (e.g., a pharmaceutical composition) can be administered to a patient using standard techniques. Techniques and formulations generally may be found in Remington's Pharmaceutical
  • Suitable dosage forms depend upon the use or the route of entry, for example, oral, transdermal, transmucosal, or by injection (parenteral). Such dosage forms should allow the therapeutic agent to reach a target cell or otherwise have the desired therapeutic effect.
  • pharmaceutical compositions injected into the blood stream preferably are soluble.
  • Conjugates and/or pharmaceutical compositions according to the invention can be formulated as pharmaceutically acceptable salts and complexes thereof.
  • Pharmaceutically acceptable salts are non-toxic salts present in the amounts and concentrations at which they are administered. The preparation of such salts can facilitate pharmaceutical use by altering the physical characteristics of the compound without preventing it from exerting its physiological effect. Useful alterations in physical properties include lowering the melting point to facilitate transmucosal administration and increasing solubility to facilitate administering higher concentrations of the drug.
  • the pharmaceutically acceptable salt of an asparaginase may be present as a complex, as those in the art will appreciate.
  • Pharmaceutically acceptable salts include acid addition salts such as those containing sulfate, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, cyclohexylsulfamate, and quinate.
  • Pharmaceutically acceptable salts can be obtained from acids, including hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, cyclohexylsulfamic acid, fumaric acid, and quinic acid.
  • acids including hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, cyclohexylsulfamic acid, fumaric acid, and quinic acid.
  • Pharmaceutically acceptable salts also include basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present.
  • basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present.
  • acidic functional groups such as carboxylic acid or phenol are present.
  • Pharmaceutically acceptable carriers and/or excipients can also be incorporated into a pharmaceutical composition according to the invention to facilitate administration of the particular asparaginase.
  • carriers suitable for use in the practice of the invention include calcium carbonate, calcium phosphate, various sugars such as lactose, glucose, or sucrose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and physiologically compatible solvents.
  • physiologically compatible solvents include sterile solutions of water for injection (WFI), saline solution and dextrose.
  • compositions according to the invention can be administered by different routes, including intravenous, intraperitoneal, subcutaneous, intramuscular, oral, topical (transdermal), or transmucosal administration.
  • oral administration is preferred.
  • the compounds can be formulated into conventional oral dosage forms such as capsules, tablets, and liquid preparations such as syrups, elixirs, and concentrated drops.
  • injection parenteral administration
  • pharmaceutical compositions are formulated in liquid solutions, preferably in physiologically compatible buffers or solutions, such as saline solution, Hank's solution, or Ringer's solution.
  • the compounds may be formulated in solid form and redissolved or suspended immediately prior to use.
  • lyophilized forms of the conjugate can be produced.
  • the conjugate is administered intramuscularly.
  • the conjugate is administered intravenously.
  • Systemic administration can also be accomplished by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants include, for example, for transmucosal administration, bile salts, and fusidic acid derivatives.
  • detergents may be used to facilitate permeation.
  • Transmucosal administration for example, may be through nasal sprays, inhalers (for pulmonary delivery), rectal suppositories, or vaginal suppositories.
  • compounds can be formulated into ointments, salves, gels, or creams, as is well known in the art.
  • the amounts of the conjugate to be delivered will depend on many factors, for example, the IC 5 O, EC 5 O, the biological half-life of the compound, the age, size, weight, and physical condition of the patient, and the disease or disorder to be treated. The importance of these and other factors to be considered are well known to those of ordinary skill in the art.
  • the amount of the conjugate to be administered will range from about 10 International Units per square meter of the surface area of the patient's body (IU/m 2 ) to 50,000 IU/m 2 , with a dosage range of about 1,000 IU/m 2 to about 15,000 IU/m 2 being preferred, and a range of about 6,000 IU/m 2 to about 15,000 IU/m 2 being more preferred, and a range of about 10,000 to about 15,000 IU/m (about 20-30 mg protein/m ) being particularly preferred to treat a malignant hematologic disease, e.g., leukemia.
  • a malignant hematologic disease e.g., leukemia.
  • these dosages are administered via intramuscular or intravenous injection at an interval of about 3 times weekly to about once per month, typically once per week or once every other week during the course of therapy.
  • other dosages and/or treatment regimens may be employed, as determined by the attending physician.
  • the conjugate and/or pharmaceutical composition or formulation to be administered as described herein comprises L-asparaginase from Erwinia species, more specifically Erwinia chrysanthemi, and more specifically, the L-asparaginase comprising the sequence of SEQ ID NO:1.
  • the conjugate comprises
  • the conjugate comprises PEG (e.g., mPEG) having a molecular weight of less than or equal to about 5000 Da. In a more particular embodiment, at least about 40% to about 100% of amino groups ⁇ e.g., lysine residues and/or the N-terminus) are PEGylated.
  • Example 1 Preparation of Recombinant Crisantaspase [0100]
  • the recombinant bacterial strain used to manufacture the naked recombinant Erwinia chrysanthemi L-asparaginase protein (also referred to herein as "r-crisantaspase") was an E. coli BL21 strain with a deleted ansB gene (the gene encoding the endogenous E. coli type II L- asparaginase) to avoid potential contamination of the recombinant Erwinia chrysanthemi L- asparaginase with this enzyme.
  • the deletion of the ansB gene relies on homologous recombination methods and phage transduction performed according to the three following steps:
  • a bacterial strain (NMI lOO) expressing a defective lambda phage which supplies functions that protect and recombine electroporated linear DNA substrate in the bacterial cell was transformed with a linear plasmid (kanamycin cassette) containing the kanamycin gene flanked by an FLP recognition target sequence (FRT). Recombination occurs to replace the ansB gene by the kanamycin cassette in the bacterial genome, resulting in a ⁇ ansB strain; 2) phage transduction was used to integrate the integrated kanamycin cassette region from the ⁇ ansB NMI lOO strain to the ansB locus in BL21 strain. This results in an E.
  • the E. co/z ' -optimized DNA sequence encoding for the mature Erwinia chrysanthemi L- asparaginase fused with the ENX signal peptide from Bacillus subtilis was inserted into an expression vector.
  • This vector allows expression of recombinant Erwinia chrysanthemi L- asparaginase under the control of hybrid T5/lac promoter induced by the addition of Isopropyl ⁇ - D-1-thiogalactopyranoside (IPTG) and confers resistance to kanamycin.
  • BL21 ⁇ ansB strain was transformed with this expression vector.
  • the transformed cells were used for production of the r-crisantaspase by feed batch glucose fermentation in Reisenberg medium. The induction of the cell was done 16h at 23°C with IPTG as inducer.
  • the theoretical isoelectric point of the Erwinia chrysanthemi L-asparaginase permits the recombinant enzyme to adsorb to cation exchange resins at pH6.
  • the recombinant enzyme was captured on a Capto S column (cation exchange chromatography) and eluted with salt gradient in Buffer A. Fractions containing the recombinant enzyme were pooled. The pooled solution was next purified on Capto MMC column (cation exchange chromatography) in Buffer A with salt gradient. .
  • the eluted fractions containing Erwinia chrysanthemi L-asparaginase were pooled and concentrated before protein separation on Superdex 200pg size exclusion chromatography as polishing step. Fractions containing recombinant enzymes were pooled, concentrated, and diafiltered against 10OmM sodium phosphate buffer pH8. The purity of the final Erwinia chrysanthemi L-asparaginase preparation was evaluated by SDS-PAGE ( Figure 1) and RP-HPLC and was at least 90%. The integrity of the recombinant enzyme was verified by
  • a solution of L-asparaginase from Erwinia chrysanthemi was stirred in a 100 mM sodium phosphate buffer at pH 8.0, at a protein concentration between 2.5 and 4 mg/mL, in the presence of 150 mg/mL or 36 mg/mL 10 kDa mPEG-NHS, for 2 hours at 22°C.
  • the resulting crude 10 kDa mPEG-L-asparaginase was purified by size exclusion chromatography using a Superdex 200 pg column on an Akta purifier UPC 100 system. Protein-containing fractions were pooled and concentrated to result in a protein concentration between 2 and 8 mg/mL.
  • Two 10 kDa mPEG-L-asparaginase conjugates were prepared in this way, differing in their degree of PEGylation as determined by TNBS assay with unmodified L-asparaginase as a reference, one corresponding to full PEGylation (100% of accessible amino groups (e.g., lysine residues and/or the N-terminus) residues being conjugated corresponding to PEGylation of 78% of total amino groups (e.g., lysine residues and/or the N-terminus)); the second one corresponding to partial PEGylation (39% of total amino groups (e.g., lysine residues and/or the N-terminus) or about 50% of accessible amino groups (e.g., lysine residues and/or the N-terminus)) .
  • SDS-PAGE analysis of the conjugates is shown in Figure 2. The resulting conjugates appeared as an essentially homogeneous band and contained no detectable unmodified r-crisant
  • a solution of L-asparaginase from Erwinia chrysanthemi was stirred in a 100 mM sodium phosphate buffer at pH 8.0, at a protein concentration of 4 mg/mL, in the presence of 150 mg/mL or 22.5 mg/mL 5 kDa mPEG-NHS, for 2 hours at 22°C.
  • the resulting crude 5 kDa mPEG-L-asparaginase was purified by size exclusion chromatography using a Superdex 200 pg column on an Akta purifier UPC 100 system. Protein-containing fractions were pooled and concentrated to result in a protein concentration between 2 and 8 mg/mL.
  • Two 5 kDa mPEG-L- asparaginase conjugates were prepared in this way, differing in their degree of PEGylation as determined by TNBS assay with unmodified L-asparaginase as a reference, one corresponding to full PEGylation (100% of accessible amino groups (e.g., lysine residues and/or the N-terminus) being conjugated corresponding to PEGylation of 84% of total amino groups (e.g., lysine residues and/or the N-terminus)); the second one corresponding to partial PEGylation (36% of total amino groups (e.g., lysine residues and/or the N-terminus) or about 43% of accessible amino groups (e.g., lysine residues and/or the N-terminus)).
  • SDS-PAGE analysis of the conjugates is shown in Figure 2. The resulting conjugates appeared as an essentially homogeneous band and contained no detectable unmodified r-crisantaspase
  • Two 2 kDa mPEG-L- asparaginase conjugates were prepared in this way, differing in their degree of PEGylation as determined by TNBS assay with unmodified L-asparaginase as reference, one corresponding to maximum PEGylation (100% of accessible amino groups (e.g., lysine residues and/or the N- terminus) being conjugated corresponding to PEGylation of 86% of total amino groups (e.g., lysine residues and/or the N-terminus)); the second one corresponding to partial PEGylation (47% of total amino groups (e.g., lysine residues and/or the N-terminus) or about 55% of accessible amino groups ⁇ e.g., lysine residues and/or the N-terminus)).
  • SDS-PAGE analysis of the conjugates is shown in Figure 2. The resulting conjugates appeared as an essentially homogeneous band and contained no detectable unmodified r-crisantaspase.
  • L-asparaginase aminohydrolase activity of each conjugate described in the proceeding examples was determined by Nesslerization of ammonia that is liberated from L-asparagine by enzymatic activity. Briefly, 50 ⁇ L of enzyme solution were mixed with 2OmM of L-asparagine in a 50 mM Sodium borate buffer pH 8.6 and incubated for 10 min at 37°C. The reaction was stopped by addition of 200 ⁇ L of Nessler reagent. Absorbance of this solution was measured at 450 nm. The activity was calculated from a calibration curve that was obtained from Ammonia sulfate as reference. The results are summarized in Table 2, below:
  • Residual activity of mPEG-r-crisantaspase conjugates ranged between 483 and 543 Units/mg. This corresponds to 78-87% of L-asparagine aminohydrolase activity of the unmodified enzyme.
  • Example 6 L-Asparagine-Depleting Effect of Unmodified Crisantaspase
  • Erwinase® is a commercially available crisantaspase (L-asparaginase derived from Erwinia chrysanthem ⁇ ). Briefly, 2 animals per group received a single i.v. injection of 5, 25, 125, or 250 Units/kg bw Erwinase® At -1 h pre-dose and at 6 h, 12h, 24 h, and 48 h post-dose, plasma samples were collected from orbital sinus and analyzed for plasma levels of L-asparagine.
  • Plasma amino acid levels were determined with a PICO-TAG Amino Acid Analysis Kit
  • Example 7 L-Asparagine-Depleting Effect and Plasma L- Asparaginase Activity Following Single Administration of Six mPEG-r-Crisantaspase Conjugates
  • plasma samples were collected from the orbital sinus of each animal and analyzed for plasma levels of L-asparagine and residual enzyme activity, respectively.
  • Plasma amino acid levels were determined with a PICO-TAG Amino Acid Analysis Kit
  • Enzyme activity in plasma was determined by a chromogenic assay.
  • L-aspartic ⁇ - hydroxamate (AHA) was used as substrate.
  • the enzymes hydrolyzed AHA to L-Asp and hydroxylamine, which was determined at 710 nm after condensation with 8-hydroxyquinoline and oxidation to indooxine. (Analytical Biochemistry 309 (2002): 117-126, incorporated herein by reference in its entirety).
  • Enzymatic activity was consistent with L-asparagine depletion. As shown in Figure 5, the 5 kDa-100% conjugate exhibited the largest AUC, reflecting a longer half- life. Lower AUCs were observed with PEG-40% (partially PEGylated) vs. PEG- 100% (maximally PEGylated) conjugates for the 2 kDa and 5 kDa candidates and no difference was observed for the 10 kDa candidates.
  • the conjugates tested were the 2 kDa maximally (100%) PEGylated r- crisantaspase and the 5 kDa maximally (100%) PEGylated r-crisantaspase at 3 doses. Briefly, 8 animals per group received a single i.v. injection of 5, 25 or 50 Units/kg bw of the r- crisantaspase conjugates, corresponding to 10, 50 or 100 ⁇ g protein/kg. As a comparative arm, Oncaspar® was tested at 1 Unit/kg, corresponding to 10 ⁇ g protein/kg.
  • Plasma amino acid levels were determined with a PICO-TAG Amino Acid Analysis Kit
  • Enzyme activity in plasma was determined by a chromogenic assay.
  • L-aspartic ⁇ - hydroxamate (AHA) was used as substrate.
  • the enzymes hydrolyzed AHA to L-Asp and hydroxylamine, which was determined at 710 nm after condensation with 8-hydroxyquinoline and oxidation to indooxine. (Analytical Biochemistry 309 (2002): 117-126).
  • Table 3 Primary pharmacokinetics of a single treatment with 250 U/kg bw of Erwinase®, 1 U/kg bw Pegaspargase (Oncaspar®), or 2 kDa mPEG-r- crisantaspase 100% conjugates (residual plasma enzyme activity)
  • Table 4 Primary pharmacokinetics of a single treatment with 250 U/kg bw of Erwinase®, 1 U/kg bw Pegaspargase (Oncaspar®), or 5 kDa mPEG-r- crisantaspase 100% conjugates (residual plasma enzyme activity)
  • the 5 kDa-100% conjugate also appeared to have a longer half- life than Oncaspar® itself when tested at the same dose on a protein content basis, as shown in Figure 9 and in the derived pharmacokinetic parameters shown in Table 4.
  • the superior pharmacokinetic profiles for the Erwinia conjugates are surprising, since E. co/z-derived L- asparaginase is known to have a longer half- life in human and in animals than Erwinia chrysanthemi-derived L-asparaginase (crisantaspase). Hence, a longer half-life would have logically been predicted for PEGylated E.
  • pegaspargase coli L-asparaginase
  • PEGylated r-crisantaspase has a longer half-life than pegaspargase.
  • Table 5 summarizes pharmacokinetic and pharmacodynamic data gathered from several experiments, including those described in Examples 7-9 herein, showing that: 1) both the 2 kDa-100% and the 5 kDa-100% conjugates were highly potent in increasing potency and duration of action of crisantaspase, as shown by the marked differences observed compared to Erwinase®; 2) the 5 kDa-100% conjugate was longer-acting than both the 2 kDa-100% conjugate and Oncaspar®, as shown by a longer half-life observed at all doses tested.
  • the immunogenicity data showed that the 10 kDa-100% exhibited an unacceptable immunogenicity profile, a major drawback when considering administering the compound to patients who are allergic to E. coli L-asparaginase or have developed anti-L-asparaginase antibodies.
  • the 10 kDa-100% conjugate is really not suitable.
  • the 2 kDa-100% and the 5 kDa-100% are preferable, and the 5 kDa-100% conjugate is particularly preferable.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Medicinal Preparation (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2010/054156 2009-07-06 2010-03-30 Pegylated l-asparaginase Ceased WO2011003633A1 (en)

Priority Applications (35)

Application Number Priority Date Filing Date Title
KR1020127003202A KR101731999B1 (ko) 2009-07-06 2010-07-06 Peg화된 l-아스파라기나제
PT107301707T PT2451486T (pt) 2009-07-06 2010-07-06 L-asparaginase peguilada
NZ597912A NZ597912A (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
PL10730170.7T PL2451486T5 (pl) 2009-07-06 2010-07-06 Pegylowana l-asparaginaza
FIEP10730170.7T FI2451486T4 (fi) 2009-07-06 2010-07-06 Pegyloitu L-asparaginaasi
ES10730170T ES2636476T5 (es) 2009-07-06 2010-07-06 L-asparaginasa pegilada
SI201031521T SI2451486T2 (sl) 2009-07-06 2010-07-06 Pegilirana L-asparaginaza
RS20170778A RS57077B2 (sr) 2009-07-06 2010-07-06 Pegilovana l-asparaginaza
EA201270134A EA021168B1 (ru) 2009-07-06 2010-07-06 Пегилированная l-аспарагиназа
MA34598A MA33503B1 (fr) 2009-07-06 2010-07-06 L-asparaginase pegylée
HK13100524.0A HK1173092B (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
SG2011096013A SG176984A1 (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
MYPI2012000054A MY180758A (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
US13/382,276 US20120100121A1 (en) 2009-07-06 2010-07-06 Pegylated L-Asparaginase
HRP20171180TT HRP20171180T4 (hr) 2009-07-06 2010-07-06 Pegilirana l-asparaginaza
JP2012518956A JP6014956B2 (ja) 2009-07-06 2010-07-06 ペグ化されたl−アスパラギナーゼ
BR112012000367A BR112012000367A2 (pt) 2009-07-06 2010-07-06 l-asparaginase peguilada.
PE2012000023A PE20120501A1 (es) 2009-07-06 2010-07-06 L-asparaginasa tratada con peg
MEP-2017-171A ME02945B (me) 2009-07-06 2010-07-06 Pegilovana l-asparaginaza
MX2012000424A MX2012000424A (es) 2009-07-06 2010-07-06 L-asparaginasa pegilada.
PE2016001555A PE20161325A1 (es) 2009-07-06 2010-07-06 L-asparaginasa tratada con peg
LTEP10730170.7T LT2451486T (lt) 2009-07-06 2010-07-06 Pegilinta l-asparaginazė
CA2767149A CA2767149C (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
PCT/EP2010/059599 WO2011003886A1 (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
HUE10730170A HUE035771T2 (en) 2009-07-06 2010-07-06 PEG-ILATED L-Asparaginase
EP10730170.7A EP2451486B2 (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase
DK10730170.7T DK2451486T4 (da) 2009-07-06 2010-07-06 Pegyleret L-asparaginase
CN201080030392.6A CN102573917B (zh) 2009-07-06 2010-07-06 聚乙二醇化的l-天冬酰胺酶
AU2010270294A AU2010270294B2 (en) 2009-07-06 2010-07-06 Pegylated L-asparaginase
IL217392A IL217392A (en) 2009-07-06 2012-01-05 Asparaginase conjugates - l that have been pegilated, preparations containing them and uses
IN958DEN2012 IN2012DN00958A (enExample) 2009-07-06 2012-02-02
CO12020409A CO6612174A2 (es) 2009-07-06 2012-02-06 L-asparaginasa tratada con peg
US14/819,305 US9920311B2 (en) 2009-07-06 2015-08-05 PEGylated L-asparaginase
CY20171100834T CY1119779T1 (el) 2009-07-06 2017-08-03 Πεγκυλiωmenh l-ασπαραγιναση
US15/886,216 US20180346900A1 (en) 2009-07-06 2018-02-01 Pegylated L-Asparaginase

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US22332009P 2009-07-06 2009-07-06
US61/223,320 2009-07-06

Publications (1)

Publication Number Publication Date
WO2011003633A1 true WO2011003633A1 (en) 2011-01-13

Family

ID=42232655

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/EP2010/054156 Ceased WO2011003633A1 (en) 2009-07-06 2010-03-30 Pegylated l-asparaginase
PCT/EP2010/059599 Ceased WO2011003886A1 (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/EP2010/059599 Ceased WO2011003886A1 (en) 2009-07-06 2010-07-06 Pegylated l-asparaginase

Country Status (25)

Country Link
US (6) US20120100121A1 (enExample)
JP (1) JP6014956B2 (enExample)
KR (1) KR101731999B1 (enExample)
CN (1) CN102573917B (enExample)
AU (1) AU2010270294B2 (enExample)
BR (1) BR112012000367A2 (enExample)
CA (1) CA2767149C (enExample)
CO (1) CO6612174A2 (enExample)
DK (1) DK2451486T4 (enExample)
EA (1) EA021168B1 (enExample)
ES (1) ES2636476T5 (enExample)
FI (1) FI2451486T4 (enExample)
HU (1) HUE035771T2 (enExample)
IL (1) IL217392A (enExample)
IN (1) IN2012DN00958A (enExample)
LT (1) LT2451486T (enExample)
MA (1) MA33503B1 (enExample)
MX (1) MX2012000424A (enExample)
MY (1) MY180758A (enExample)
NZ (1) NZ597912A (enExample)
PE (2) PE20120501A1 (enExample)
PT (1) PT2451486T (enExample)
SG (1) SG176984A1 (enExample)
UA (1) UA104634C2 (enExample)
WO (2) WO2011003633A1 (enExample)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017151707A1 (en) * 2016-03-01 2017-09-08 The Board Of Trustees Of The University Of Illinois L-asparaginase variants and fusion proteins with reduced l-glutaminase activity and enhanced stability
EP3418383A1 (en) * 2017-06-21 2018-12-26 XL-protein GmbH Modified l-asparaginase
WO2018234492A1 (en) * 2017-06-21 2018-12-27 Xl-Protein Gmbh L-ASPARAGINASE MODIFIED
US10174302B1 (en) 2017-06-21 2019-01-08 Xl-Protein Gmbh Modified L-asparaginase
WO2021032997A1 (en) * 2019-08-21 2021-02-25 Porton Biopharma limited Therapeutic conjugate
WO2021078988A1 (en) * 2019-10-25 2021-04-29 Jazz Pharmaceuticals Ireland Ltd. Recombinant l-asparaginase
RU2775696C2 (ru) * 2017-06-21 2022-07-06 Джаз Фармасьютикалз Айрлэнд Лимитед Модифицированная l-аспарагиназа
US12551540B2 (en) 2021-03-30 2026-02-17 Jazz Pharmaceuticals Ireland Ltd. Dosing and administration of recombinant L-asparaginase

Families Citing this family (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE531779C2 (sv) * 2007-11-26 2009-08-04 Promimic Ab Framställning av kalciumfosfatpartiklar i nanostorlek som pulver eller beläggning via bifunktionella prekursorer
WO2011003633A1 (en) 2009-07-06 2011-01-13 Alize Pharma Ii Pegylated l-asparaginase
WO2015033344A1 (en) 2013-09-05 2015-03-12 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Methods and kits for inhibiting pathogenicity of group a streptococcus (gas) or group g streptococcus (ggs)
US20160213759A1 (en) * 2013-09-10 2016-07-28 Board Of Regents, The University Of Texas System Therapeutic asparaginases
CN104046600B (zh) * 2013-12-30 2019-04-05 江苏众红生物工程创药研究院有限公司 多臂聚乙二醇修饰剂的新用途及其在修饰门冬酰胺酶中的应用
BR102014000585B1 (pt) 2014-01-10 2021-01-12 Coppe/Ufrj-Instituto Alberto Luiz Coimbra De Pós-Graduação l-asparaginase recombinante de zymomonas
US9808011B2 (en) 2014-12-15 2017-11-07 Biovectra Inc. Pentacyclic triterpene compounds and uses thereof
CN105802948B (zh) 2014-12-29 2020-06-09 江苏众红生物工程创药研究院有限公司 聚乙二醇定点修饰的门冬酰胺酶及其制备方法与应用
ES2839212T3 (es) 2015-09-29 2021-07-05 Inst Nat Sante Rech Med Métodos para determinar el estado metabólico de linfomas B
EP3463308B2 (en) * 2016-06-01 2026-01-07 Servier IP UK Limited Formulations of polyalkylene oxide-asparaginase and methods of making and using the same
UY37341A (es) 2016-07-22 2017-11-30 Flamel Ireland Ltd Formulaciones de gamma-hidroxibutirato de liberación modificada con farmacocinética mejorada
US11602513B1 (en) 2016-07-22 2023-03-14 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US11602512B1 (en) 2016-07-22 2023-03-14 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US12478604B1 (en) 2016-07-22 2025-11-25 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US11986451B1 (en) 2016-07-22 2024-05-21 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US12186296B1 (en) 2016-07-22 2025-01-07 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US11504347B1 (en) 2016-07-22 2022-11-22 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
WO2018085493A1 (en) * 2016-11-04 2018-05-11 Georgia State University Research Foundation, Inc. Endotoxin free asparaginase
US10662433B2 (en) 2017-10-27 2020-05-26 Pfenex Inc. Method for production of recombinant E. coli asparaginase
WO2019083793A1 (en) * 2017-10-27 2019-05-02 Pfenex Inc. Method for production of recombinant erwinia asparaginase
BR112020010976A2 (pt) * 2017-11-30 2020-11-17 Jazz Pharmaceuticals Ireland Limited métodos de tratamento com asparaginase
CN112261949B (zh) * 2018-04-19 2025-05-06 伊兰科美国公司 用于医疗用途的变体天冬酰胺酶多肽
US20210299233A1 (en) 2018-07-12 2021-09-30 The Children's Medical Center Corporation Method for treating cancer
JP2022514942A (ja) * 2018-12-24 2022-02-16 ジェノバ バイオファーマスーティカルズ リミテッド ペグアスパラガーゼの凍結乾燥組成物
US11400065B2 (en) 2019-03-01 2022-08-02 Flamel Ireland Limited Gamma-hydroxybutyrate compositions having improved pharmacokinetics in the fed state
KR102269634B1 (ko) * 2019-10-31 2021-06-25 대상 주식회사 ansB 유전자 불활성화에 의해 아미노산 생산능력이 향상된 균주
KR20230125179A (ko) 2020-12-23 2023-08-29 재즈 파마슈티칼즈 아일랜드 리미티드 전하-차폐 융합 단백질의 정제 방법
CN114854729B (zh) * 2021-02-03 2025-09-02 重庆派金生物科技有限公司 定向化学偶联门冬酰胺酶突变体及其制备方法和应用
US11779557B1 (en) 2022-02-07 2023-10-10 Flamel Ireland Limited Modified release gamma-hydroxybutyrate formulations having improved pharmacokinetics
US11583510B1 (en) 2022-02-07 2023-02-21 Flamel Ireland Limited Methods of administering gamma hydroxybutyrate formulations after a high-fat meal
US20260000740A1 (en) 2022-07-04 2026-01-01 Institut National de la Santé et de la Recherche Médicale Use of a l-asparaginase in combination with a ferroptosis inducer for the treatment of extranodal natural killer/t-cell lymphoma
WO2024015529A2 (en) 2022-07-14 2024-01-18 Jazz Pharmaceuticals Ireland Ltd. Combination therapies involving l-asparaginase
WO2024211977A1 (pt) * 2023-04-12 2024-10-17 Biobreyer Pesquisa E Desenvolvimento Científico Ltda Processo de peguilação sítio específica de lasparaginase contendo cisteínas de superfície, produto obtido por processo e uso

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5672662A (en) 1995-07-07 1997-09-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
US6113906A (en) 1993-10-27 2000-09-05 Enzon, Inc. Water-soluble non-antigenic polymer linkable to biologically active material
US20020065397A1 (en) 2000-10-12 2002-05-30 Joseph Roberts Protecting therapeutic compositions from host-mediated inactivation
WO2003018742A2 (en) * 2001-08-22 2003-03-06 Gosudarstvennoe Uchrezhdenie Nauchno-Issledovatelsky Institut Biomeditsinskoy Khimii Im. Orekhovicha Rossiiskoy Akademii Meditsinskikh Nauk Recombinant l-asparaginase erwinia caratovora
WO2004083258A2 (en) 2003-03-14 2004-09-30 Neose Technologies Inc. Branched water-soluble polymers and their conjugates
WO2007103290A2 (en) 2006-03-03 2007-09-13 Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Materials and methods directed to asparagine synthetase and asparaginase therapies
US7419600B2 (en) 1995-01-10 2008-09-02 Nektar Therapeutics Al, Corporation Method for purifying a branched water-soluble polymer

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5286637A (en) 1989-08-07 1994-02-15 Debiopharm, S.A. Biologically active drug polymer derivatives and method for preparing same
GB9017002D0 (en) 1990-08-02 1990-09-19 Health Lab Service Board Improved method for the purification of erwina l-asparaginase
US5359030A (en) 1993-05-10 1994-10-25 Protein Delivery, Inc. Conjugation-stabilized polypeptide compositions, therapeutic delivery and diagnostic formulations comprising same, and method of making and using the same
US5681811A (en) 1993-05-10 1997-10-28 Protein Delivery, Inc. Conjugation-stabilized therapeutic agent compositions, delivery and diagnostic formulations comprising same, and method of making and using the same
US5776746A (en) 1996-05-01 1998-07-07 Genitope Corporation Gene amplification methods
US6309633B1 (en) 1999-06-19 2001-10-30 Nobex Corporation Amphiphilic drug-oligomer conjugates with hydroyzable lipophile components and methods for making and using the same
US6913915B2 (en) * 2001-08-02 2005-07-05 Phoenix Pharmacologics, Inc. PEG-modified uricase
JP5163491B2 (ja) 2006-04-21 2013-03-13 コニカミノルタホールディングス株式会社 ガスバリアフィルムの製造方法、有機エレクトロルミネッセンス用樹脂基材、それを用いた有機エレクトロルミネッセンス素子
EP2137307B1 (en) * 2007-03-09 2014-07-30 Novozymes A/S Thermostable asparaginases
WO2011003633A1 (en) 2009-07-06 2011-01-13 Alize Pharma Ii Pegylated l-asparaginase
WO2017106630A1 (en) 2015-12-18 2017-06-22 The General Hospital Corporation Polyacetal polymers, conjugates, particles and uses thereof

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US6113906A (en) 1993-10-27 2000-09-05 Enzon, Inc. Water-soluble non-antigenic polymer linkable to biologically active material
US7419600B2 (en) 1995-01-10 2008-09-02 Nektar Therapeutics Al, Corporation Method for purifying a branched water-soluble polymer
US20090054590A1 (en) 1995-01-10 2009-02-26 Nektar Therapeutics Al, Corporation Multi-armed, monofunctional, and hydrolytically stable derivatives of poly (ethylene glycol) and related polymers for modification of surfaces and molecules
US5672662A (en) 1995-07-07 1997-09-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
US20020065397A1 (en) 2000-10-12 2002-05-30 Joseph Roberts Protecting therapeutic compositions from host-mediated inactivation
WO2003018742A2 (en) * 2001-08-22 2003-03-06 Gosudarstvennoe Uchrezhdenie Nauchno-Issledovatelsky Institut Biomeditsinskoy Khimii Im. Orekhovicha Rossiiskoy Akademii Meditsinskikh Nauk Recombinant l-asparaginase erwinia caratovora
WO2004083258A2 (en) 2003-03-14 2004-09-30 Neose Technologies Inc. Branched water-soluble polymers and their conjugates
WO2007103290A2 (en) 2006-03-03 2007-09-13 Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Materials and methods directed to asparagine synthetase and asparaginase therapies

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
A. V. KUCHUMOVA, Y. V. KRASOTKINA, P. Z. KHASIGOV, N. N. SOKOLOV: "Modification of recombinant asparaginase from Erwinia carotovora with polyethylene glycol 5000", BIOCHEMISTRY (MOSCOW) SUPPLEMENTAL SERIES B: BIOMEDICAL CHEMISTRY, vol. 1, no. 3, 4 September 2007 (2007-09-04), pages 230 - 232, XP002587203, DOI: 10.1134/S1990750807030092 *
A.F.S.A. HABEEB: "Determination of free amino groups in proteins by trinitrobenzensulfonic acid", ANAL. BIOCHEM., vol. 14, 1966, pages 328
ABUCHOWSKI, A. ET AL.: "Alteration of Immunological Properties of Bovine Serum Albumin by Covalent Attachment of Polyethylene Glycol", J.BIOL.CHEM., vol. 252, no. 11, 1977, pages 3578 - 3581
AGHAIPOUR ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 5655 - 5664
ANALYTICAL BIOCHEMISTRY, vol. 309, 2002, pages 117 - 126
AVRAMIS ET AL., ANTICANCER RESEARCH, vol. 29, 2009, pages 299 - 302
AVRAMIS ET AL., J. PEDIATR. HEMATO ONCOL., vol. 29, 2007, pages 239 - 247
AVRAMIS VASSILIOS I ET AL: "Pharmacokinetic/pharmacodynamic relationships of asparaginase formulations: the past, the present and recommendations for the future", CLINICAL PHARMACOKINETICS, ADIS INTERNATIONAL LTD., AUCKLAND, NZ LNKD- DOI:10.2165/00003088-200544040-00003, vol. 44, no. 4, 1 April 2005 (2005-04-01), pages 367 - 393, XP008105154, ISSN: 0312-5963, Retrieved from the Internet <URL:http://pharmacokinetics.adisonline.com/pt/re/cpk/abstract.00003088-20 0544040-00003.htm> *
AVRAMIS; PANOSYAN, CLIN. PHARMACOKINET, vol. 44, 2005, pages 367 - 393
AVRAMIS; PANOSYAN, CLIN. PHARMACOKINET., vol. 44, 2005, pages 367 - 393
BILLETT A L ET AL: "Allergic reactions to Erwinia asparaginase in children with acute lymphoblastic leukemia who had previous allergic reactions to Escherichia coli asparaginase.", CANCER 1 JUL 1992 LNKD- PUBMED:1606543, vol. 70, no. 1, 1 July 1992 (1992-07-01), pages 201 - 206, XP002587207, ISSN: 0008-543X *
DUVAL MICHEL ET AL: "Comparison of Escherichia coli-asparaginase with Erwinia-asparaginase in the treatment of childhood lymphoid malignancies: results of a randomized European Organisation for Research and Treatment of Cancer-Children's Leukemia Group phase 3 trial.", BLOOD 15 APR 2002 LNKD- PUBMED:11929760, vol. 99, no. 8, 15 April 2002 (2002-04-15), pages 2734 - 2739, XP002587208, ISSN: 0006-4971 *
DUVAL, M. ET AL.: "Comparison of Escherichia coli-asparaginase with Erwinia-asparaginase in the treatment of childhood lymphoid malignancies: results of a randomized European Organisation for Research and Treatment of Cancer, Children's Leukemia Group phase 3 trial", BLOOD, vol. 15, 2002, pages 2734 - 2739
FISHBURN, C.S.: "The Pharmacology of PEGylation: Balancing PD with PK to Generate Novel Therapeutics", J. PHARM. SCI., 2008, pages 1 - 17
GOWARD, C.R. ET AL.: "Rapid large scale preparation of recombinant Erwinia chrysanthemi L-asparaginase", BIOSEPARATION, vol. 2, 1992, pages 335 - 341
GRAHAM MICHAEL L: "Pegaspargase: a review of clinical studies.", ADVANCED DRUG DELIVERY REVIEWS 26 SEP 2003 LNKD- PUBMED:14499708, vol. 55, no. 10, 26 September 2003 (2003-09-26), pages 1293 - 1302, XP002587206, ISSN: 0169-409X *
HARRIS, M., ADV. DRUG DEL. REV., vol. 54, 2002, pages 459 - 476
HOLCENBERG, J., J. PEDIATR. HEMATOL. ONCOL., vol. 26, 2004, pages 273 - 274
HOLTSBERG, F.W., JOURNAL OF CONTROLLED RELEASE, vol. 80, 2002, pages 259 - 271
KLUG ALBERTSEN B ET AL: "Comparison of intramuscular therapy with Erwinia asparaginase and asparaginase Medac: Pharmacokinetics, pharmacodynamics, formation of antibodies and influence on the coagulation system", BRITISH JOURNAL OF HAEMATOLOGY 2001 GB LNKD- DOI:10.1046/J.1365-2141.2001.03148.X, vol. 115, no. 4, 2001, pages 983 - 990, XP002587209, ISSN: 0007-1048 *
KLUG ALBERTSEN, B. ET AL.: "Comparison of intramuscular therapy with Erwinia asparaginase and asparaginase Medac: pharmacokinetics. pharmacodynamics, formation of antibodies and influence on the coagulation system", BRIT. J. HAEMATOL., vol. 115, 2001, pages 983 - 990
KOTZIA ET AL., J. BIOTECHNOL., vol. 127, 2007, pages 657 - 669
KOTZIA GA; LABROU E, JOURNAL OF BIOTECHNOLOGY, vol. 127, 2007, pages 657 - 669
KOTZIA; LABROU, J. BIOTECHNOL., vol. 127, 2007, pages 657 - 669
KUCHUMOVA, A.V. ET AL., BIOCHEMISTRY (MOSCOW) SUPPLEMENT SERIES B: BIOMEDICAL CHEMISTRY, vol. 1, 2007, pages 230 - 232
KUCHUMOVA, A.V. ET AL.: "Modification of Recombinant asparaginase from Erwinia carotovora with Polyethylene Glycol 5000", BIOCHEMISTRY (MOSCOW) SUPPLEMENT SERIES B: BIOMEDICAL CHEMISTRY, vol. 1, 2007, pages 230 - 232
MAKROMOL. CHEM., vol. 187, 1986, pages 1131 - 1144
MASHBURN, L.; WRISTON, J.: "Tumor Inhibitory Effect of L-Asparaginase", BIOCHEM BIOPHYS RES COMMUN, vol. 12, 1963, pages 50
MOOLA ET AL., BIOCHEM. J., vol. 302, 1994, pages 921 - 927
PAPAGEORGIOU ET AL., FEBS J., vol. 275, 2008, pages 4306 - 4316
ROBERTS M J ET AL: "Chemistry for peptide and protein PEGylation", ADVANCED DRUG DELIVERY REVIEWS, ELSEVIER BV, AMSTERDAM, NL LNKD- DOI:10.1016/S0169-409X(02)00022-4, vol. 54, no. 4, 17 June 2002 (2002-06-17), pages 459 - 476, XP002293146, ISSN: 0169-409X *
SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", 1989, COLD SPRING HARBOR LAB.
SAVITRI; AZMI, INDIAN J. BIOTECHNOL, vol. 2, 2003, pages 184 - 194
SHERMAN, M. R., ADV. DRUG DEL. REV., vol. 60, 2008, pages 59 - 68
SOKOLOV N N ET AL: "Design of recombinant L-Asparaginase erwinia carotovora drug with an antitumor action", MOLEKULYARNAYA MEDITSINA, IZDATEL'STVO MEDITSINA, RU, vol. 1, 1 January 2005 (2005-01-01), pages 45 - 53, XP008123303, ISSN: 1728-2918 *
WANG, B. ET AL., LEUKEMIA, vol. 17, 2003, pages 1583 - 1588
WANG, B. ET AL.: "Evaluation of immunologic cross reaction of anti-asparaginase antibodies in acute lymphoblastic leukemia (ALL and lymphoma patients)", LEUKEMIA, vol. 17, 2003, pages 1583 - 1588
WANG, B. ET AL.: "Evaluation of immunologic cross-reaction of anti-asparaginase antibodies in acute lymphoblastic leukemia (ALL and lymphoma patients)", LEUKEMIA, vol. 17, 2003, pages 1583 - 1588
WRISTON JR., J.C.: "L-asparaginase", METH. ENZYMOL., vol. 113, 1985, pages 608 - 618
ZALEWSKA-SZEWCZYK ET AL., CLIN. EXP. MED., vol. 9, 2009, pages 113 - 116

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10821160B2 (en) 2016-03-01 2020-11-03 The Board Of Trustees Of The University Of Illinois L-asparaginase variants and fusion proteins with reduced L-glutaminase activity and enhanced stability
WO2017151707A1 (en) * 2016-03-01 2017-09-08 The Board Of Trustees Of The University Of Illinois L-asparaginase variants and fusion proteins with reduced l-glutaminase activity and enhanced stability
RU2775696C2 (ru) * 2017-06-21 2022-07-06 Джаз Фармасьютикалз Айрлэнд Лимитед Модифицированная l-аспарагиназа
EP4180525A1 (en) * 2017-06-21 2023-05-17 Jazz Pharmaceuticals Ireland Limited Modified l-asparaginase
KR20200030065A (ko) * 2017-06-21 2020-03-19 재즈 파마슈티칼즈 아일랜드 리미티드 변형된 l-아스파라기나아제
WO2018234492A1 (en) * 2017-06-21 2018-12-27 Xl-Protein Gmbh L-ASPARAGINASE MODIFIED
KR102727396B1 (ko) 2017-06-21 2024-11-08 재즈 파마슈티칼즈 아일랜드 리미티드 변형된 l-아스파라기나아제
US11802279B2 (en) 2017-06-21 2023-10-31 Jazz Pharmaceuticals Ireland Ltd. Modified L-asparaginase
EP3418383A1 (en) * 2017-06-21 2018-12-26 XL-protein GmbH Modified l-asparaginase
US10174302B1 (en) 2017-06-21 2019-01-08 Xl-Protein Gmbh Modified L-asparaginase
US20220331411A1 (en) * 2019-08-21 2022-10-20 Porton Biopharma Limied Therapeutic conjugate
EP4368251A3 (en) * 2019-08-21 2024-07-24 Porton Biopharma Limited Therapeutic conjugate
WO2021032997A1 (en) * 2019-08-21 2021-02-25 Porton Biopharma limited Therapeutic conjugate
WO2021078988A1 (en) * 2019-10-25 2021-04-29 Jazz Pharmaceuticals Ireland Ltd. Recombinant l-asparaginase
US12121571B2 (en) 2019-10-25 2024-10-22 Jazz Pharmaceuticals Ireland Ltd. Recombinant L-asparaginase
US12551540B2 (en) 2021-03-30 2026-02-17 Jazz Pharmaceuticals Ireland Ltd. Dosing and administration of recombinant L-asparaginase

Also Published As

Publication number Publication date
CN102573917B (zh) 2015-06-17
IL217392A (en) 2017-06-29
KR20120104154A (ko) 2012-09-20
PE20161325A1 (es) 2016-12-30
KR101731999B1 (ko) 2017-05-11
IN2012DN00958A (enExample) 2015-04-10
JP6014956B2 (ja) 2016-10-26
US20160060613A1 (en) 2016-03-03
AU2010270294A1 (en) 2012-02-23
SG176984A1 (en) 2012-01-30
EA021168B1 (ru) 2015-04-30
PE20120501A1 (es) 2012-05-31
DK2451486T3 (en) 2017-08-28
CN102573917A (zh) 2012-07-11
NZ597912A (en) 2014-01-31
DK2451486T4 (da) 2023-04-17
IL217392A0 (en) 2012-02-29
US20120100121A1 (en) 2012-04-26
US20210348151A1 (en) 2021-11-11
US20200347374A1 (en) 2020-11-05
US9920311B2 (en) 2018-03-20
CO6612174A2 (es) 2013-02-01
AU2010270294B2 (en) 2015-06-25
MA33503B1 (fr) 2012-08-01
US20180346900A1 (en) 2018-12-06
MX2012000424A (es) 2012-07-23
MY180758A (en) 2020-12-08
FI2451486T4 (fi) 2023-04-25
UA104634C2 (xx) 2014-02-25
US12441992B2 (en) 2025-10-14
JP2012532185A (ja) 2012-12-13
US11046946B2 (en) 2021-06-29
CA2767149A1 (en) 2011-01-13
USRE49736E1 (en) 2023-11-28
HUE035771T2 (en) 2018-05-28
ES2636476T5 (es) 2023-06-01
CA2767149C (en) 2019-11-26
PT2451486T (pt) 2017-08-09
WO2011003886A1 (en) 2011-01-13
HK1173092A1 (zh) 2013-05-10
LT2451486T (lt) 2017-11-10
ES2636476T3 (es) 2017-10-05
EA201270134A1 (ru) 2012-07-30
BR112012000367A2 (pt) 2018-01-02

Similar Documents

Publication Publication Date Title
US12441992B2 (en) Method of treating AML with PEGylated l-asparaginase
EP2451486B2 (en) Pegylated l-asparaginase
EP3642340B1 (en) Modified l-asparaginase
US11802279B2 (en) Modified L-asparaginase
EP3418383A1 (en) Modified l-asparaginase
WO2019109018A1 (en) Methods of treatment with asparaginase
AU2015240806A1 (en) Conjugates of an IL-15 moiety and a polymer
AU2009246851A1 (en) Conjugates of a cholinesterase moiety and a polymer
HK1173092B (en) Pegylated l-asparaginase
RU2775696C2 (ru) Модифицированная l-аспарагиназа
HK40090811A (en) Modified l-asparaginase
HK40029594B (en) Modified l-asparaginase
HK40029594A (en) Modified l-asparaginase

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10711244

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10711244

Country of ref document: EP

Kind code of ref document: A1